Alignment Strategies for Large Scale Genome Alignments
|
|
- Allen Harper
- 5 years ago
- Views:
Transcription
1 Alignment Strategies for Large Scale Genome Alignments CSHL Computational Genomics 9 November 2003 Algorithms for Biological Sequence Comparison algorithm value scoring gap time calculated matrix penalty required Needleman- global arbitrary penalty/gap O(n 2 ) Needleman and Wunsch similarity q Wunsch, 1970 Sellers (global) unity penalty/residue O(n 2 ) Sellers, 1974 distance r k Smith- local S ij < 0.0 affine O(n 2 ) Smith and Waterman, 1981 Waterman similarity q + r k optimal Gotoh, 1982 SRCHN approx local S ij < 0.0 penalty/gap O(n)-O(n 2 ) Wilbur and Lipman, 1983 similarity lookup-diagonal FASTA approx. local S ij < 0.0 limited size O(n 2 )/K Lipman and Pearson, 1985 similarity q + r k lookup-rescan Pearson and Lipman, 1988 BLASTP maximum S ij < 0.0 multiple O(n 2 )/K Altshul et al., 1990 segment score segments DFA-extend BLAST2.0 approx. local S ij < 0.0 q+r k O(n 2 )/K Altshul et al., 1997 similarity lookup-extend 1
2 The sequence alignment problem: PMILGYWNVRGL PMILGYWNVRGL PM-ILGYWNVRGL : : : ::: : : : ::: PPYTIVYFPVRG PPYTIVYFPVRG PPYTIV-YFPVRG PMILGYWNVRGL PMILGYWNVRGL PM-ILGYWNVRGL :. :.. :. ::: :. :.:. ::: PPYTIVYFPVRG PPYTIVYFPVRG PPYTIV-YFPVRG P M I L G Y W N V R G L P X P X Y x X x T x x I X x x x V x x x X x Y x X x F x x x x x x P X V x x x X x R X G X Global: -PMILGYWNVRGL :..:. ::: PPYTIVYFPVRG- Local: AAAAAAAPMILGYWNVRGLBBBBB :..:. ::: XXXXXXPPYTIVYFPVRGYYYYYY Algorithms for Biological Sequence Comparison Global Local Distance HBHU vs HBHU Hemoglobin beta-chain - human HAHU Hemoglobin alpha-chain - human MYHU Myoglobin - Human GPYL Leghemoglobin - Yellow lupin LZCH Lysozyme precursor - Chicken NRBO Pancreatic ribonuclease - Bovine CCHU Cytochrome c - Human MCHU vs MCHU Calmodulin - Human TPHUCS Troponin C, skeletal muscle PVPK2 Parvalbumin beta - Pike CIHUH Calpain heavy chain - Human AQJFNV Aequorin precursor - Jelly fish KLSWM Calcium binding protein - Scallop QRHULD vs EGMSMG EGF precursor
3 Genomic Alignments nw/sw/lalign - dynamic programming -O(n 2 ) searchn - lookup on diagonals - O(n)-O(n 2 ) fasta - lookup on diagonals/rescan - O(n 2 )/K blast - DFA, extend O(n 2 )/K blastz - lookup/extend ssaha, blat, - lookup - waba mummer, avid - Suffix tree alignment dialign, glass, lagan Global and Local Alignment Paths Global A B D D E F G H I A \ \ \ \ \ \ \ \ \ 1 _ B \! \ \ \ \ \ \ \ -1 2 _ 0 _ D \! \ \ \ \ \ \ _ 1 _-1 _ E \ \!! \ \ \ \ _ 0 _-2 _-4-4 G \ \! \! \ \ \ _-1 _-3 K \ \ \! \! \! \ \ \ \ _-2 H \ \ \ \! \! \! \ \ \ _-1 I \ \ \ \ \! \! \!! \ Optimum global alignment ( score: 2) A B D D E F G H I (top) A B D - E G K H I (side) or A B - D E G K H I Local A B D D E F G H I A \ B \ 0 2 _ D! \ \ _ E! \ \ _ G \! \ \ \ K \ \ \ H \ I \ Optimal local alignment (score 3): A B D (top) A B D (side) 3
4 Algorithms for Global and Local Similarity Scores Global: Local: Smith-Waterman Space, Time Requirements scorespace: O(n); time: O(n 2 ) alignmentspace: O(n); time: O(n 2 ) 4
5 FAST alignment by lookup 1 9 GT8.7 KITQSNATQ.::. ::: XURT8C LLTQTRATQ Scan query, build 2 tables: n-1 entries AT 7 IT 2 KI 1 LL -1 LT -1 NA 6 QS 4 QT -1 SN 5 TR -1 TQ entries LL LT TQ QT TR RA AT TQ K I T Q S N A T Q L L T T T Q Q Q T R A A T T T Q Q Q O(n) space O(n+m) time (if few repeat hits) BLASTZ in a nutshell gap of length k is penalized by subtracting k from the score 5
6 Other improvements Formerly, BLASTZ looked for identical runs of eight consecutive nucleotides in each sequence. Ma et al. (2002) propose looking for runs of 19 consecutive nucleotides in each sequence, within which the 12 positions indicated by a 1 in the string are identical. To increase sensitivity, we allow a transition (A-G, G-A, C-T or T-C) in any one of the 12 positions. If the separation between the two alignments is <50 kb in both sequences, then BLASTZ recursively searches the intervening regions for 7-mer exact matches and requires a threshold of 2200 for initiating dynamic programming (without the adjustment for sequence complexity). If the separation is <10 kb, the threshold is lowered to In either case, the higher-sensitivity matches are required to occur with an order and orientation consistent with the stronger flanking matches. blastz local alignments 6
7 PipMaker PipMaker GSTM1 vs Cluster 7
8 Suffix trees - Mummer, AVID Figure 2 Finding maximal matches using a suffix tree: The suffixes of the word at the root are represented by the characters along the paths from the root to the leaves. Branchings in the tree correspond to locations where different suffixes shared the same prefix, and therefore are matches. Every internal node in the tree is therefore a match (with the matching sequence corresponding to the path characters along the path from the root). Maximal matches can be efficiently detected by considering some additional criteria. Figure 3 Selecting anchors from the set of matches. Every maximal match is shown in blue. A set of good anchors is shown in red. 8
9 Table 1. Coverage Results for the Different Programs on Human Sequence Alignments With Cat, Chicken, Cow, Dog, Pig, and Rat Coverage (bp) RefSeq UTR Time (S) Cat AVID BLASTZ BLASTZ (chaining) CHAOS GLASS Chicken AVID BLASTZ BLASTZ (chaining) CHAOS GLASS Chimp AVID BLASTZ BLASTZ (chaining) CHAOS GLASS Cow * * * * AVID BLASTZ BLASTZ (chaining) CHAOS GLASS Coverage of the human genome using the mouse genome is described in O. Couronne (2003). An asterisk indicates that the program was not able to successfully align the sequences. A minus sign indicates that the program crashed on one sequence pair. Multiple minus signs are used for multiple crashes. RefSeq annotations are based on the human December 2001 hg10 freeze. LAGAN "anchor" local alignments (CHAOS) rough global map ("band")recursive anchoring translated anchoring Genome Research (2003) 13:721 9
10 parameters: k: word length c: degeneracy t: score threshold 10
11 MLAGAN Tree-guided, progressive with anchors affine gaps, open/continue/end penalties iterative refinement with anchors 11
12 12
13 13
14 14
15 Figure 2 Visualization of a multiple alignment using VISTA. (A) MLAGAN alignments can be visualized using VISTA, if they are projected to pairwise alignments with respect to one reference sequence. This plot shows the conservation between human and chimpanzee, cow, mouse, and fugu around the first intron of the cmet gene. The human/chimpanzee conservation is uniformly very high; human/cow and human/mouse show varying levels of conservation. The human/chicken alignment also shows some conservation in the non-coding areas. The human/fugu alignment shows conservation only within the first coding exon, and to a lesser degree within the regions upstream and downstream of that exon. (B) First introns of cmet, comparison of CLUSTALW and MLAGAN alignments. We compared the alignment generated by LAGAN and CLUSTALW for the first intron of the cmet gene in eight mammalian sequences (human, baboon, cat, dog, cow, pig, mouse, and rat). The alignments between all of the species except rodents were similar. VISTA plots of the projections to human and mouse are shown. CLUSTALW (top) misaligned the mouse sequence around 4 Kb and 10 Kb, whereas MLAGAN (bottom) found significant conservation in these regions. 15
16 Genome Alignment Strategies Alignment based or Lookup based? (BLASTZ vs BLAT) Identities vs Similarities (EST:genome vs Human:Cat:Mouse) Scoring Matrix? Statistical Estimates (BLASTN) Memory vs Speed Iterative alignment? 16
Whole Genome Alignments and Synteny Maps
Whole Genome Alignments and Synteny Maps IINTRODUCTION It was not until closely related organism genomes have been sequenced that people start to think about aligning genomes and chromosomes instead of
More informationBMI/CS 776 Lecture #20 Alignment of whole genomes. Colin Dewey (with slides adapted from those by Mark Craven)
BMI/CS 776 Lecture #20 Alignment of whole genomes Colin Dewey (with slides adapted from those by Mark Craven) 2007.03.29 1 Multiple whole genome alignment Input set of whole genome sequences genomes diverged
More informationBiol4230 Tues, February 21, 2017 Bill Pearson Jordan 6-057
Multiple Sequence Alignment Biol4230 Tues, February 2, 207 Bill Pearson wrp@virginia.edu 488 Jordan 6-057 Goals of today s lecture: Why multiple sequence alignment (MSA)? identify conserved (functional?)
More informationMultiple Alignment of Genomic Sequences
Ross Metzger June 4, 2004 Biochemistry 218 Multiple Alignment of Genomic Sequences Genomic sequence is currently available from ENTREZ for more than 40 eukaryotic and 157 prokaryotic organisms. As part
More informationTiffany Samaroo MB&B 452a December 8, Take Home Final. Topic 1
Tiffany Samaroo MB&B 452a December 8, 2003 Take Home Final Topic 1 Prior to 1970, protein and DNA sequence alignment was limited to visual comparison. This was a very tedious process; even proteins with
More informationBioinformatics and BLAST
Bioinformatics and BLAST Overview Recap of last time Similarity discussion Algorithms: Needleman-Wunsch Smith-Waterman BLAST Implementation issues and current research Recap from Last Time Genome consists
More informationAlgorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 05: Index-based alignment algorithms Slides adapted from Dr. Shaojie Zhang (University of Central Florida) Real applications of alignment Database search
More informationTHEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
More informationTools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2015 Week-4 BLAST Algorithm Continued Multiple Sequence Alignment Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and
More informationIn-Depth Assessment of Local Sequence Alignment
2012 International Conference on Environment Science and Engieering IPCBEE vol.3 2(2012) (2012)IACSIT Press, Singapoore In-Depth Assessment of Local Sequence Alignment Atoosa Ghahremani and Mahmood A.
More informationLecture 14: Multiple Sequence Alignment (Gene Finding, Conserved Elements) Scribe: John Ekins
Lecture 14: Multiple Sequence Alignment (Gene Finding, Conserved Elements) 2 19 2015 Scribe: John Ekins Multiple Sequence Alignment Given N sequences x 1, x 2,, x N : Insert gaps in each of the sequences
More informationSequence Alignment Techniques and Their Uses
Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this
More informationIntroduction to sequence alignment. Local alignment the Smith-Waterman algorithm
Lecture 2, 12/3/2003: Introduction to sequence alignment The Needleman-Wunsch algorithm for global sequence alignment: description and properties Local alignment the Smith-Waterman algorithm 1 Computational
More informationMultiple Whole Genome Alignment
Multiple Whole Genome Alignment BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 206 Anthony Gitter gitter@biostat.wisc.edu These slides, excluding third-party material, are licensed under CC BY-NC 4.0 by
More informationSara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)
Bioinformática Sequence Alignment Pairwise Sequence Alignment Universidade da Beira Interior (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) 1 16/3/29 & 23/3/29 27/4/29 Outline
More informationComparative Gene Finding. BMI/CS 776 Spring 2015 Colin Dewey
Comparative Gene Finding BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2015 Colin Dewey cdewey@biostat.wisc.edu Goals for Lecture the key concepts to understand are the following: using related genomes
More informationPairwise sequence alignment
Department of Evolutionary Biology Example Alignment between very similar human alpha- and beta globins: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL G+ +VK+HGKKV A+++++AH+D++ +++++LS+LH KL GNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKL
More informationIntroduction to Bioinformatics
Introduction to Bioinformatics Jianlin Cheng, PhD Department of Computer Science Informatics Institute 2011 Topics Introduction Biological Sequence Alignment and Database Search Analysis of gene expression
More information20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, Global and local alignment of two sequences using dynamic programming
20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, 2008 4 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance 4. Global and local alignment
More information3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT
3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode
More informationBioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment
Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value
More informationCollected Works of Charles Dickens
Collected Works of Charles Dickens A Random Dickens Quote If there were no bad people, there would be no good lawyers. Original Sentence It was a dark and stormy night; the night was dark except at sunny
More informationHeuristic Alignment and Searching
3/28/2012 Types of alignments Global Alignment Each letter of each sequence is aligned to a letter or a gap (e.g., Needleman-Wunsch). Local Alignment An optimal pair of subsequences is taken from the two
More informationEnsembl focuses on metazoan (animal) genomes. The genomes currently available at the Ensembl site are:
Comparative genomics and proteomics Species available Ensembl focuses on metazoan (animal) genomes. The genomes currently available at the Ensembl site are: Vertebrates: human, chimpanzee, mouse, rat,
More informationAlignment principles and homology searching using (PSI-)BLAST. Jaap Heringa Centre for Integrative Bioinformatics VU (IBIVU)
Alignment principles and homology searching using (PSI-)BLAST Jaap Heringa Centre for Integrative Bioinformatics VU (IBIVU) http://ibivu.cs.vu.nl Bioinformatics Nothing in Biology makes sense except in
More informationSequence analysis and Genomics
Sequence analysis and Genomics October 12 th November 23 rd 2 PM 5 PM Prof. Peter Stadler Dr. Katja Nowick Katja: group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute
More informationSingle alignment: Substitution Matrix. 16 march 2017
Single alignment: Substitution Matrix 16 march 2017 BLOSUM Matrix BLOSUM Matrix [2] (Blocks Amino Acid Substitution Matrices ) It is based on the amino acids substitutions observed in ~2000 conserved block
More informationSequence Database Search Techniques I: Blast and PatternHunter tools
Sequence Database Search Techniques I: Blast and PatternHunter tools Zhang Louxin National University of Singapore Outline. Database search 2. BLAST (and filtration technique) 3. PatternHunter (empowered
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of omputer Science San José State University San José, alifornia, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Pairwise Sequence Alignment Homology
More information17 Non-collinear alignment Motivation A B C A B C A B C A B C D A C. This exposition is based on:
17 Non-collinear alignment This exposition is based on: 1. Darling, A.E., Mau, B., Perna, N.T. (2010) progressivemauve: multiple genome alignment with gene gain, loss and rearrangement. PLoS One 5(6):e11147.
More informationHandling Rearrangements in DNA Sequence Alignment
Handling Rearrangements in DNA Sequence Alignment Maneesh Bhand 12/5/10 1 Introduction Sequence alignment is one of the core problems of bioinformatics, with a broad range of applications such as genome
More informationLecture 2: Pairwise Alignment. CG Ron Shamir
Lecture 2: Pairwise Alignment 1 Main source 2 Why compare sequences? Human hexosaminidase A vs Mouse hexosaminidase A 3 www.mathworks.com/.../jan04/bio_genome.html Sequence Alignment עימוד רצפים The problem:
More informationCISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I)
CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) Contents Alignment algorithms Needleman-Wunsch (global alignment) Smith-Waterman (local alignment) Heuristic algorithms FASTA BLAST
More informationI519 Introduction to Bioinformatics, Genome Comparison. Yuzhen Ye School of Informatics & Computing, IUB
I519 Introduction to Bioinformatics, 2015 Genome Comparison Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Whole genome comparison/alignment Build better phylogenies Identify polymorphism
More informationComparative genomics. Lucy Skrabanek ICB, WMC 6 May 2008
Comparative genomics Lucy Skrabanek ICB, WMC 6 May 2008 What does it encompass? Genome conservation transfer knowledge gained from model organisms to non-model organisms Genome evolution understand how
More informationCh. 9 Multiple Sequence Alignment (MSA)
Ch. 9 Multiple Sequence Alignment (MSA) - gather seqs. to make MSA - doing MSA with ClustalW - doing MSA with Tcoffee - comparing seqs. that cannot align Introduction - from pairwise alignment to MSA -
More informationLecture 5: September Time Complexity Analysis of Local Alignment
CSCI1810: Computational Molecular Biology Fall 2017 Lecture 5: September 21 Lecturer: Sorin Istrail Scribe: Cyrus Cousins Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes
More informationMegAlign Pro Pairwise Alignment Tutorials
MegAlign Pro Pairwise Alignment Tutorials All demo data for the following tutorials can be found in the MegAlignProAlignments.zip archive here. Tutorial 1: Multiple versus pairwise alignments 1. Extract
More informationRELATIONSHIPS BETWEEN GENES/PROTEINS HOMOLOGUES
Molecular Biology-2018 1 Definitions: RELATIONSHIPS BETWEEN GENES/PROTEINS HOMOLOGUES Heterologues: Genes or proteins that possess different sequences and activities. Homologues: Genes or proteins that
More informationChapter 5. Proteomics and the analysis of protein sequence Ⅱ
Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and
More informationIntroduction to Sequence Alignment. Manpreet S. Katari
Introduction to Sequence Alignment Manpreet S. Katari 1 Outline 1. Global vs. local approaches to aligning sequences 1. Dot Plots 2. BLAST 1. Dynamic Programming 3. Hash Tables 1. BLAT 4. BWT (Burrow Wheeler
More informationLecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm. Alignment scoring schemes and theory: substitution matrices and gap models
Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm Alignment scoring schemes and theory: substitution matrices and gap models 1 Local sequence alignments Local sequence alignments are necessary
More informationTools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2013 Week3: Blast Algorithm, theory and practice Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and Systems Biology
More informationContact 1 University of California, Davis, 2 Lawrence Berkeley National Laboratory, 3 Stanford University * Corresponding authors
Phylo-VISTA: Interactive Visualization of Multiple DNA Sequence Alignments Nameeta Shah 1,*, Olivier Couronne 2,*, Len A. Pennacchio 2, Michael Brudno 3, Serafim Batzoglou 3, E. Wes Bethel 2, Edward M.
More informationPairwise Alignment. Guan-Shieng Huang. Dept. of CSIE, NCNU. Pairwise Alignment p.1/55
Pairwise Alignment Guan-Shieng Huang shieng@ncnu.edu.tw Dept. of CSIE, NCNU Pairwise Alignment p.1/55 Approach 1. Problem definition 2. Computational method (algorithms) 3. Complexity and performance Pairwise
More informationGrundlagen der Bioinformatik, SS 08, D. Huson, May 2,
Grundlagen der Bioinformatik, SS 08, D. Huson, May 2, 2008 39 5 Blast This lecture is based on the following, which are all recommended reading: R. Merkl, S. Waack: Bioinformatik Interaktiv. Chapter 11.4-11.7
More informationPractical search strategies
Computational and Comparative Genomics Similarity Searching II Practical search strategies Bill Pearson wrp@virginia.edu 1 Protein Evolution and Sequence Similarity Similarity Searching I What is Homology
More informationSequence Comparison. mouse human
Sequence Comparison Sequence Comparison mouse human Why Compare Sequences? The first fact of biological sequence analysis In biomolecular sequences (DNA, RNA, or amino acid sequences), high sequence similarity
More informationDNA and protein databases. EMBL/GenBank/DDBJ database of nucleic acids
Database searches 1 DNA and protein databases EMBL/GenBank/DDBJ database of nucleic acids 2 DNA and protein databases EMBL/GenBank/DDBJ database of nucleic acids (cntd) 3 DNA and protein databases SWISS-PROT
More information8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011
8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011 2 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance and alignment 4. The number
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Head, Biocomputing Whitehead Institute Bioinformatics Definitions The use of computational
More informationLecture 4: September 19
CSCI1810: Computational Molecular Biology Fall 2017 Lecture 4: September 19 Lecturer: Sorin Istrail Scribe: Cyrus Cousins Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes
More informationEffective Cluster-Based Seed Design for Cross-Species Sequence Comparisons
Effective Cluster-Based Seed Design for Cross-Species Sequence Comparisons Leming Zhou and Liliana Florea 1 Methods Supplementary Materials 1.1 Cluster-based seed design 1. Determine Homologous Genes.
More informationCopyright 2000 N. AYDIN. All rights reserved. 1
Introduction to Bioinformatics Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Multiple Sequence Alignment Outline Multiple sequence alignment introduction to msa methods of msa progressive global alignment
More informationSequence Homology and Analysis. Understanding How FASTA and BLAST work to optimize your sequence similarity searches.
Sequence Homology and Analysis Understanding How FASTA and BLAST work to optimize your sequence similarity searches. Brandi Cantarel, PhD BICF 04/27/2016 Take Home Messages 1. Homologous sequences share
More informationSequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013
Sequence Alignments Dynamic programming approaches, scoring, and significance Lucy Skrabanek ICB, WMC January 31, 213 Sequence alignment Compare two (or more) sequences to: Find regions of conservation
More informationAnalysis of Genome Evolution and Function, University of Toronto, Toronto, ON M5R 3G4 Canada
Multiple Whole Genome Alignments Without a Reference Organism Inna Dubchak 1,2, Alexander Poliakov 1, Andrey Kislyuk 3, Michael Brudno 4* 1 Genome Sciences Division, Lawrence Berkeley National Laboratory,
More informationMultiple Genome Alignment by Clustering Pairwise Matches
Multiple Genome Alignment by Clustering Pairwise Matches Jeong-Hyeon Choi 1,3, Kwangmin Choi 1, Hwan-Gue Cho 3, and Sun Kim 1,2 1 School of Informatics, Indiana University, IN 47408, USA, {jeochoi,kwchoi,sunkim}@bio.informatics.indiana.edu
More information08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega
BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments
More informationA Browser for Pig Genome Data
A Browser for Pig Genome Data Thomas Mailund January 2, 2004 This report briefly describe the blast and alignment data available at http://www.daimi.au.dk/ mailund/pig-genome/ hits.html. The report describes
More informationCONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018
CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of
More informationBLAT The BLAST-Like Alignment Tool
Resource BLAT The BLAST-Like Alignment Tool W. James Kent Department of Biology and Center for Molecular Biology of RNA, University of California, Santa Cruz, Santa Cruz, California 95064, USA Analyzing
More informationSEPA: Approximate Non-Subjective Empirical p-value Estimation for Nucleotide Sequence Alignment
SEPA: Approximate Non-Subjective Empirical p-value Estimation for Nucleotide Sequence Alignment Ofer Gill and Bud Mishra Courant Institute of Mathematical Sciences, New York University, 251 Mercer Street,
More informationModule: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment
Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Introduction to Bioinformatics online course : IBT Jonathan Kayondo Learning Objectives Understand
More informationBioinformatics Exercises
Bioinformatics Exercises AP Biology Teachers Workshop Susan Cates, Ph.D. Evolution of Species Phylogenetic Trees show the relatedness of organisms Common Ancestor (Root of the tree) 1 Rooted vs. Unrooted
More informationI519 Introduction to Bioinformatics, Genome Comparison. Yuzhen Ye School of Informatics & Computing, IUB
I519 Introduction to Bioinformatics, 2011 Genome Comparison Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Whole genome comparison/alignment Build better phylogenies Identify polymorphism
More informationInDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
More informationAlgorithms in Bioinformatics I, ZBIT, Uni Tübingen, Daniel Huson, WS 2003/4 1
Algorithms in Bioinformatics I, ZBIT, Uni Tübingen, Daniel Huson, WS 2003/4 1 Algorithms in Bioinformatics I Winter Semester 2003/4, Center for Bioinformatics Tübingen, WSI-Informatik, Universität Tübingen
More information8 Grundlagen der Bioinformatik, SS 09, D. Huson, April 28, 2009
8 Grundlagen der Bioinformatik, SS 09, D. Huson, April 28, 2009 2 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance and alignment 4. The number
More informationMotivating the need for optimal sequence alignments...
1 Motivating the need for optimal sequence alignments... 2 3 Note that this actually combines two objectives of optimal sequence alignments: (i) use the score of the alignment o infer homology; (ii) use
More informationSimilarity or Identity? When are molecules similar?
Similarity or Identity? When are molecules similar? Mapping Identity A -> A T -> T G -> G C -> C or Leu -> Leu Pro -> Pro Arg -> Arg Phe -> Phe etc If we map similarity using identity, how similar are
More informationMitochondrial Genome Annotation
Protein Genes 1,2 1 Institute of Bioinformatics University of Leipzig 2 Department of Bioinformatics Lebanese University TBI Bled 2015 Outline Introduction Mitochondrial DNA Problem Tools Training Annotation
More informationPractical considerations of working with sequencing data
Practical considerations of working with sequencing data File Types Fastq ->aligner -> reference(genome) coordinates Coordinate files SAM/BAM most complete, contains all of the info in fastq and more!
More informationAlignment & BLAST. By: Hadi Mozafari KUMS
Alignment & BLAST By: Hadi Mozafari KUMS SIMILARITY - ALIGNMENT Comparison of primary DNA or protein sequences to other primary or secondary sequences Expecting that the function of the similar sequence
More information7 Multiple Genome Alignment
94 Bioinformatics I, WS /3, D. Huson, December 3, 0 7 Multiple Genome Alignment Assume we have a set of genomes G,..., G t that we want to align with each other. If they are short and very closely related,
More informationBiochemistry 324 Bioinformatics. Pairwise sequence alignment
Biochemistry 324 Bioinformatics Pairwise sequence alignment How do we compare genes/proteins? When we have sequenced a genome, we try and identify the function of unknown genes by finding a similar gene
More informationBLAST. Varieties of BLAST
BLAST Basic Local Alignment Search Tool (1990) Altschul, Gish, Miller, Myers, & Lipman Uses short-cuts or heuristics to improve search speed Like speed-reading, does not examine every nucleotide of database
More informationIntroduction to Bioinformatics Online Course: IBT
Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple
More informationPairwise alignment, Gunnar Klau, November 9, 2005, 16:
Pairwise alignment, Gunnar Klau, November 9, 2005, 16:36 2012 2.1 Growth rates For biological sequence analysis, we prefer algorithms that have time and space requirements that are linear in the length
More informationEarly History up to Schedule. Proteins DNA & RNA Schwann and Schleiden Cell Theory Charles Darwin publishes Origin of Species
Schedule Bioinformatics and Computational Biology: History and Biological Background (JH) 0.0 he Parsimony criterion GKN.0 Stochastic Models of Sequence Evolution GKN 7.0 he Likelihood criterion GKN 0.0
More informationTree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
More informationBasic Local Alignment Search Tool
Basic Local Alignment Search Tool Alignments used to uncover homologies between sequences combined with phylogenetic studies o can determine orthologous and paralogous relationships Local Alignment uses
More informationComparative Genomics. Chapter for Human Genetics - Principles and Approaches - 4 th Edition
Chapter for Human Genetics - Principles and Approaches - 4 th Edition Editors: Friedrich Vogel, Arno Motulsky, Stylianos Antonarakis, and Michael Speicher Comparative Genomics Ross C. Hardison Affiliations:
More informationBenchmarking tools for the alignment of functional
Benchmarking tools for the alignment of functional noncoding DNA. Daniel A. Pollard (dpollard@socrates.berkeley.edu) 1, Casey M. Bergman (cbergman@gen.cam.ac.uk) 2,3,,*, Jens Stoye (stoye@techfak.uni-bielefeld.de)
More informationMultiple sequence alignment
Multiple sequence alignment Multiple sequence alignment: today s goals to define what a multiple sequence alignment is and how it is generated; to describe profile HMMs to introduce databases of multiple
More informationPairwise & Multiple sequence alignments
Pairwise & Multiple sequence alignments Urmila Kulkarni-Kale Bioinformatics Centre 411 007 urmila@bioinfo.ernet.in Basis for Sequence comparison Theory of evolution: gene sequences have evolved/derived
More informationSequence Analysis '17- lecture 8. Multiple sequence alignment
Sequence Analysis '17- lecture 8 Multiple sequence alignment Ex5 explanation How many random database search scores have e-values 10? (Answer: 10!) Why? e-value of x = m*p(s x), where m is the database
More informationFrazer et al. ago (Aparicio et al. 2002), conserved long-range sequence organization has not been reported for more distantly related species. Figure
Review Cross-Species Sequence Comparisons: A Review of Methods and Available Resources Kelly A. Frazer, 1,6 Laura Elnitski, 2,3 Deanna M. Church, 4 Inna Dubchak, 5 and Ross C. Hardison 3 1 Perlegen Sciences,
More informationChromosomal rearrangements in mammalian genomes : characterising the breakpoints. Claire Lemaitre
PhD defense Chromosomal rearrangements in mammalian genomes : characterising the breakpoints Claire Lemaitre Laboratoire de Biométrie et Biologie Évolutive Université Claude Bernard Lyon 1 6 novembre 2008
More informationString Matching Problem
String Matching Problem Pattern P Text T Set of Locations L 9/2/23 CAP/CGS 5991: Lecture 2 Computer Science Fundamentals Specify an input-output description of the problem. Design a conceptual algorithm
More informationSequence alignment methods. Pairwise alignment. The universe of biological sequence analysis
he universe of biological sequence analysis Word/pattern recognition- Identification of restriction enzyme cleavage sites Sequence alignment methods PstI he universe of biological sequence analysis - prediction
More informationBioinformatics for Computer Scientists (Part 2 Sequence Alignment) Sepp Hochreiter
Bioinformatics for Computer Scientists (Part 2 Sequence Alignment) Institute of Bioinformatics Johannes Kepler University, Linz, Austria Sequence Alignment 2. Sequence Alignment Sequence Alignment 2.1
More informationIntroduction to Evolutionary Concepts
Introduction to Evolutionary Concepts and VMD/MultiSeq - Part I Zaida (Zan) Luthey-Schulten Dept. Chemistry, Beckman Institute, Biophysics, Institute of Genomics Biology, & Physics NIH Workshop 2009 VMD/MultiSeq
More informationStatistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic
More informationDistribution and intensity of constraint in mammalian genomic sequence
Article Distribution and intensity of constraint in mammalian genomic sequence Gregory M. Cooper, 1 Eric A. Stone, 2,3 George Asimenos, 4 NISC Comparative Sequencing Program, 5 Eric D. Green, 5 Serafim
More informationWhole Genome Alignment. Adam Phillippy University of Maryland, Fall 2012
Whole Genome Alignment Adam Phillippy University of Maryland, Fall 2012 Motivation cancergenome.nih.gov Breast cancer karyotypes www.path.cam.ac.uk Goal of whole-genome alignment } For two genomes, A and
More informationBINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
More informationStatistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD William and Nancy Thompson Missouri Distinguished Professor Department
More information1.5 Sequence alignment
1.5 Sequence alignment The dramatic increase in the number of sequenced genomes and proteomes has lead to development of various bioinformatic methods and algorithms for extracting information (data mining)
More information