Ch. 9 Multiple Sequence Alignment (MSA)
|
|
- Britton Herbert Hutchinson
- 6 years ago
- Views:
Transcription
1 Ch. 9 Multiple Sequence Alignment (MSA) - gather seqs. to make MSA - doing MSA with ClustalW - doing MSA with Tcoffee - comparing seqs. that cannot align Introduction - from pairwise alignment to MSA - comparing DNA or protein seqs. - difficult for DNA because of mutation - why MSA? search for evolutionary (phylogentic analysis) and structure similarity - for protein seqs, regions that are similar in seq. are usually superimpose in structure as well - because it is easy to generate bad alignments that looks good, we need to evaluate the quality of alignment (use Tcoffee) - one can comparing seqs. that cannot align Gibbs sampler (identify related segments of the same length) and Pratt (a motif discover tool) MSA is ideal for study seqs. share the same common ancestor MSA cannot be used if the seqs. has no similarity The MSA problem - given N seqs., with L = the longest of the aligned seq. - a minimal number of gaps is introduced in the seqs. so that the number of matches or similarities in each column is maximized - let A i be the ith seq. and A i,k is the residue at the kth position of the ith seq., G(A i ) is a gap penalty function - the objective of MSA is to maximize the score function Score(A N ) - it is the sum of all possible pairwise alignement scores, i.e. there are N(N-1)/2 possible alignments A i, k Score( A N ) = L N 1 N k = 1 i= 1 j= i+ 1 A j, k sub( A, A ) N G( A ) i, k j, k i i= 1 where sub(, A j,k ) is the score of substitution for (i.e. insertion, deletion, substitution). A i, k
2 2 distance (MAMPR, LOXAF) = = distance (LOXAF, ELEMA) = = distance (MAMAPR, ELEMA) = = Help you research with MSA Applications Extrapolation Phylogentic analysis Pattern identification Domain identification DNA regulatory elements Structure prediction Procedure MSA help convince you that an uncharacterized seq. is really a member of a protein family If you carefully choose the seqs. to include in MSA, you can reconstruct the history of these proteins. By discovering very conserver region, one can identify regions that characterize function. Turn MSA into a profile that describes a protein family or domain. One can use this profile to scan the databases and look for new members for the family. Align promoters of a set of similarly regulated genes may reveal consensus binding sites for regulatory proteins. Turn a DNA MSA of a binding site into a weight matrix and scan the DNA database and look for potential binding site. A good MSA can give a very good prediction of the protein/rna secondary structure. - Consider the human parvalbumin, P20472, a calcium binding protein involved in muscle relaxation - Use Expasy BLAST server to retrieve similarity seqs., storing them and then MSA
3 3 - for protein/dna use blastp/tblastn to search the whole database - you can restrict the number of hits by selecting a smaller database, e.g. microbial database How to select the seqs. you want? - for a first analysis, select about 10 seqs., ideally the seqs. select is evenly spaced between very good E-value (say ) and less good value (say 10-5 ) - select seqs. that were about the same length, don t select fragment seqs., (MSA is good for alignment seqs. having similar length) - pick P20472, P80079, P02626, P02619, P43305, P32930, Q91482, P02620, P02622
4 4 Three are three ways to export these seqs.: FASTA, ClustalW, Tcoffee EBI ClustalW server Interpreting MSA result - (*) an entirely conserved column - (:) indicates columns where all the residues have roughly he same size and same hydropathy - (.) indicates columns where the size or hydropathy is roughly the same - a good block is a unit with at least amino-acids long exhibiting 1~3 (*), 5~7 (:) and a few (.) If you know the accession numbers of the seqs., you can retrieve them as shown in the following:
5 P20472, P80079, P02626, P02619, P43305, P32930, Q91482, P02620, P See Appendix A for all the seqs. FASTA format EBI ClustalW server
6 6 Changing ClustalW parameters Parameter Effect Substitution matrix Substitution matrices control the cost of mutations in seq. alignments. If you select a matrix, like PAM or BLOSUM, ClustalW automatically chooses the adapted index. If the seqs. are closely related, a change of matrix has no effect. If your seqs. alignment is difficult to interpret, it is worth to change from BLOSUM PAM. Gap-opening penalty (GOP) The higher the value of GOP, the more difficult it is to open a gap. Turning has little effect because ClustalW readjust GOP automatically. Gap-extension penalty (GEP) GEP control the size of the gaps. It is impossible to predict the optimal combination of GOP/GEP. The only way to find this combination is empirical. - reason for changing the parameters is to test whether slightly changes can improve the overall alignment. ClustalW - Clustal program by Higgins & Sharp,1988, - ClustalW is a more recent revision with W assign weights to the seqs. reflect the evolutionary changes in the aligned seqs. and the distribution of gaps between conserved domains - ClustalX a graphic interfaces Progressive algorithm (fast but errors made earlier in the process cannot be corrected (frozen-in errors)) for obvious errors edit manually tools : such Jalview (Chpater 10), Seaview or Cinema - Start with the most similarity seq. pair and continue to add seqs. in decreasing order of similarity - One builds a cluster of seqs. looks like a phylogenetic tree (dendrogram, that is the file with.dnd extension), for instance one has two alignments AB and CD - Then it aligns the two alignments as if each of them was a single seq., for instance one can replace each alignment with a consensus seq. - alignment of AB alignment of CD alignment of AB with CD (ABCD) alignment of (ABCD)E alignment of (ABCDE)F alignment of (ABCDE)F)G. Making MSA with Tcoffee - one of the most recently developed method for MSA - yields more accurate alignments at the cost of a longer running time
7 7 - - aln : a text file has the same format as ClustalW alignment - pdf Pattern of Conservation in MSA Amino Acid Characteristic W, Y, F Tryptophans large hydrophobic a.a., locate in the core of proteins, important for stability not easy to mutate, if mutate W Y or F (aromatic a.a.) - conserved aromatic a.a domains
8 G, P Often associated with beta strands or alpha helices C - conserved column of C C-C disulphide bridge - conserved columns of C with a distance signature of domains H, S Probably a catalytic site, especially proteases D, E, R, K Charged a.a. often involved in ligand binding or salt bridge (association of two ionic protein groups of +/- charge) L Rarely very conserved unless involved in protein-protein interactions such as leucine zipper. 8 Adding distantly related seq. - the alignment contains many conserved positions - add a few distantly related seq. one by one and check the effect of these seqs. on the overall alignment quality - want to make sure these distantly related seqs. enhance existing patterns rather destroy them - include those seqs. that BLAST reported as marginal hits when we scan SWISS-PROT for homologues - add P02591, TPCC_RABIT, the troponin C of rabbit, BLAST e-value = 3.1
9 9 - the new seq. respects the blocks that already existed, and shunting some conserved positions - it also reveals regions where insertion and deletions are likely to occur mostly likely a loop - add another distantly related seq. to check that these few highly conserved regions are indeed conserved across the whole protein family, even when we compare distantly related species - include P19123, TPCC_MOUSE, mouse troponin C, BLAST E-value = 3.1
10 - the most conserved columns remain - these two highly conserved regions are involved in some biological processes - we know most of the proteins binds calcium - one can safely bet that the calcium-binding site involves some of these conserved positions - in fact SWISS-PROT annotation indicate that these regions involved in calcium binding 10 Comparing sequences that you cannot align - sometimes may need to compare seqs. don t necessary have a common ancestor - Gibbs sampler looks for short, partially conserved gap-free segments - Pratt looks for flexible patterns that can contains gaps and only needs to conserved at certain positions Gibbs Sampler - stochastic method, difficult to reproduce the same results - but it can offer very sensible solutions - very good at identifying HTH (Helix Turn Helix) domains across a protein family - a nice way to search for regulatory elements shared by unrelated DNA seqs. - to get good results you need >20 seqs. - Gibbs sampler is useful only when the segments your are looking have exactly the same length, like HTH domains - For motif of different length use Pratt ( TEIRESIAS ( MEME (
11 11 Appendix A >sp P20472 PRVA_HUMAN Parvalbumin alpha - Homo sapiens (Human). SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEE DELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES >sp P80079 PRVA_FELCA Parvalbumin alpha - Felis silvestris catus (Cat). SMTDLLGAEDIKKAVEAFTAVDSFDYKKFFQMVGLKKKSPDDIKKVFHILDKDKSGFIEE DELGFILKGFYPDARDLSVKETKMLMAAGDKDGDGKIDVDEFFSLVAKS >sp P02626 PRVA_AMPME Parvalbumin alpha - Amphiuma means (Salamander) (Two-toed amphiuma). SMTDVIPEADINKAIHAFKAGEAFDFKKFVHLLGLNKRSPADVTKAFHILDKDRSGYIEE EELQLILKGFSKEGRELTDKETKDLLIKGDKDGDGKIGVDEFTSLVAES >sp P02619 PRVB_ESOLU Parvalbumin beta - Esox lucius (Northern pike). SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEED ELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA >sp P43305 PRVU_CHICK Parvalbumin, thymic CPV3 (Parvalbumin 3) - Gallus gallus (Chicken). MSLTDILSPSDIAAALRDCQAPDSFSPKKFFQISGMSKKSSSQLKEIFRILDNDQSGFIE EDELKYFLQRFECGARVLTASETKTFLAAADHDGDGKIGAEEFQEMVQS >sp P32930 ONCO_HUMAN Oncomodulin (OM) (Parvalbumin beta) - Homo sapiens (Human). SITDVLSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDE EELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS >sp Q91482 PRV1_SALSA Parvalbumin beta 1 (Major allergen Sal s 1) - Salmo salar (Atlantic salmon). MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIE VEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVKQ >sp P02620 PRVB_MERME Parvalbumin beta - Merluccius merluccius (European hake). AFAGILADADITAALAACKAEGSFKHGEFFTKIGLKGKSAADIKKVFGIIDQDKSDFVEE DELKLFLQNFSAGARALTDAETATFLKAGDSDGDGKIGVEEFAAMVKG >sp P02622 PRVB_GADCA Parvalbumin beta (Allergen Gad c 1) (Gad c I) (Allergen M) - Gadus callarias (Baltic cod). AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEE DELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG >sp P02591 TPCC_RABIT Troponin C, slow skeletal and cardiac muscles (TN-C) - Oryctolagus cuniculus (Rabbit). MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIM LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE >sp P19123 TPCC_MOUSE Troponin C, slow skeletal and cardiac muscles (TN-C) - Mus musculus (Mouse). MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMM LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Introduction to Bioinformatics Online Course: IBT
Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple
More informationTHEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
More informationSequence analysis and comparison
The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species
More informationWeek 10: Homology Modelling (II) - HHpred
Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative
More informationAlgorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot
More information5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT
5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT.03.239 03.10.2012 ALIGNMENT Alignment is the task of locating equivalent regions of two or more sequences to maximize their similarity. Homology:
More informationChapter 5. Proteomics and the analysis of protein sequence Ⅱ
Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and
More informationOverview Multiple Sequence Alignment
Overview Multiple Sequence Alignment Inge Jonassen Bioinformatics group Dept. of Informatics, UoB Inge.Jonassen@ii.uib.no Definition/examples Use of alignments The alignment problem scoring alignments
More informationCONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018
CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of
More informationMultiple Sequence Alignments
Multiple Sequence Alignments...... Elements of Bioinformatics Spring, 2003 Tom Carter http://astarte.csustan.edu/ tom/ March, 2003 1 Sequence Alignments Often, we would like to make direct comparisons
More informationHomology Modeling. Roberto Lins EPFL - summer semester 2005
Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,
More informationMolecular Modeling Lecture 7. Homology modeling insertions/deletions manual realignment
Molecular Modeling 2018-- Lecture 7 Homology modeling insertions/deletions manual realignment Homology modeling also called comparative modeling Sequences that have similar sequence have similar structure.
More informationCISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I)
CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) Contents Alignment algorithms Needleman-Wunsch (global alignment) Smith-Waterman (local alignment) Heuristic algorithms FASTA BLAST
More informationMultiple sequence alignment
Multiple sequence alignment Multiple sequence alignment: today s goals to define what a multiple sequence alignment is and how it is generated; to describe profile HMMs to introduce databases of multiple
More informationQuantifying sequence similarity
Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity
More informationSingle alignment: Substitution Matrix. 16 march 2017
Single alignment: Substitution Matrix 16 march 2017 BLOSUM Matrix BLOSUM Matrix [2] (Blocks Amino Acid Substitution Matrices ) It is based on the amino acids substitutions observed in ~2000 conserved block
More informationLarge-Scale Genomic Surveys
Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction
More informationComparing Genomes! Homologies and Families! Sequence Alignments!
Comparing Genomes! Homologies and Families! Sequence Alignments! Allows us to achieve a greater understanding of vertebrate evolution! Tells us what is common and what is unique between different species
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More informationCopyright 2000 N. AYDIN. All rights reserved. 1
Introduction to Bioinformatics Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Multiple Sequence Alignment Outline Multiple sequence alignment introduction to msa methods of msa progressive global alignment
More informationSequencing alignment Ameer Effat M. Elfarash
Sequencing alignment Ameer Effat M. Elfarash Dept. of Genetics Fac. of Agriculture, Assiut Univ. aelfarash@aun.edu.eg Why perform a multiple sequence alignment? MSAs are at the heart of comparative genomics
More informationStatistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic
More informationBioinformatics Exercises
Bioinformatics Exercises AP Biology Teachers Workshop Susan Cates, Ph.D. Evolution of Species Phylogenetic Trees show the relatedness of organisms Common Ancestor (Root of the tree) 1 Rooted vs. Unrooted
More informationSequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University
Sequence Alignment: A General Overview COMP 571 - Fall 2010 Luay Nakhleh, Rice University Life through Evolution All living organisms are related to each other through evolution This means: any pair of
More informationChapter 11 Multiple sequence alignment
Chapter 11 Multiple sequence alignment Burkhard Morgenstern 1. INTRODUCTION Sequence alignment is of crucial importance for all aspects of biological sequence analysis. Virtually all methods of nucleic
More informationIntroduction to protein alignments
Introduction to protein alignments Comparative Analysis of Proteins Experimental evidence from one or more proteins can be used to infer function of related protein(s). Gene A Gene X Protein A compare
More informationSequence Analysis '17- lecture 8. Multiple sequence alignment
Sequence Analysis '17- lecture 8 Multiple sequence alignment Ex5 explanation How many random database search scores have e-values 10? (Answer: 10!) Why? e-value of x = m*p(s x), where m is the database
More informationAlignment & BLAST. By: Hadi Mozafari KUMS
Alignment & BLAST By: Hadi Mozafari KUMS SIMILARITY - ALIGNMENT Comparison of primary DNA or protein sequences to other primary or secondary sequences Expecting that the function of the similar sequence
More informationSequencing alignment Ameer Effat M. Elfarash
Sequencing alignment Ameer Effat M. Elfarash Dept. of Genetics Fac. of Agriculture, Assiut Univ. amir_effat@yahoo.com Why perform a multiple sequence alignment? MSAs are at the heart of comparative genomics
More informationTools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2015 Week-4 BLAST Algorithm Continued Multiple Sequence Alignment Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and
More informationSara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)
Bioinformática Sequence Alignment Pairwise Sequence Alignment Universidade da Beira Interior (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) 1 16/3/29 & 23/3/29 27/4/29 Outline
More informationScoring Matrices. Shifra Ben-Dor Irit Orr
Scoring Matrices Shifra Ben-Dor Irit Orr Scoring matrices Sequence alignment and database searching programs compare sequences to each other as a series of characters. All algorithms (programs) for comparison
More information08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega
BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments
More informationChristian Sigrist. November 14 Protein Bioinformatics: Sequence-Structure-Function 2018 Basel
Christian Sigrist General Definition on Conserved Regions Conserved regions in proteins can be classified into 5 different groups: Domains: specific combination of secondary structures organized into a
More informationMultiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:
Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:50 5001 5 Multiple Sequence Alignment The first part of this exposition is based on the following sources, which are recommended reading:
More informationStatistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD William and Nancy Thompson Missouri Distinguished Professor Department
More informationBIOINFORMATICS: An Introduction
BIOINFORMATICS: An Introduction What is Bioinformatics? The term was first coined in 1988 by Dr. Hwa Lim The original definition was : a collective term for data compilation, organisation, analysis and
More informationGenomics and bioinformatics summary. Finding genes -- computer searches
Genomics and bioinformatics summary 1. Gene finding: computer searches, cdnas, ESTs, 2. Microarrays 3. Use BLAST to find homologous sequences 4. Multiple sequence alignments (MSAs) 5. Trees quantify sequence
More informationHands-On Nine The PAX6 Gene and Protein
Hands-On Nine The PAX6 Gene and Protein Main Purpose of Hands-On Activity: Using bioinformatics tools to examine the sequences, homology, and disease relevance of the Pax6: a master gene of eye formation.
More informationSequence analysis and Genomics
Sequence analysis and Genomics October 12 th November 23 rd 2 PM 5 PM Prof. Peter Stadler Dr. Katja Nowick Katja: group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute
More informationIn-Depth Assessment of Local Sequence Alignment
2012 International Conference on Environment Science and Engieering IPCBEE vol.3 2(2012) (2012)IACSIT Press, Singapoore In-Depth Assessment of Local Sequence Alignment Atoosa Ghahremani and Mahmood A.
More informationBiochemistry 324 Bioinformatics. Pairwise sequence alignment
Biochemistry 324 Bioinformatics Pairwise sequence alignment How do we compare genes/proteins? When we have sequenced a genome, we try and identify the function of unknown genes by finding a similar gene
More informationBioinformatics: Investigating Molecular/Biochemical Evidence for Evolution
Bioinformatics: Investigating Molecular/Biochemical Evidence for Evolution Background How does an evolutionary biologist decide how closely related two different species are? The simplest way is to compare
More informationSequence Bioinformatics. Multiple Sequence Alignment Waqas Nasir
Sequence Bioinformatics Multiple Sequence Alignment Waqas Nasir 2010-11-12 Multiple Sequence Alignment One amino acid plays coy; a pair of homologous sequences whisper; many aligned sequences shout out
More information3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT
3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode
More informationCSCE555 Bioinformatics. Protein Function Annotation
CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The
More informationMoreover, the circular logic
Moreover, the circular logic How do we know what is the right distance without a good alignment? And how do we construct a good alignment without knowing what substitutions were made previously? ATGCGT--GCAAGT
More informationAn Introduction to Sequence Similarity ( Homology ) Searching
An Introduction to Sequence Similarity ( Homology ) Searching Gary D. Stormo 1 UNIT 3.1 1 Washington University, School of Medicine, St. Louis, Missouri ABSTRACT Homologous sequences usually have the same,
More informationProtein Structures. Sequences of amino acid residues 20 different amino acids. Quaternary. Primary. Tertiary. Secondary. 10/8/2002 Lecture 12 1
Protein Structures Sequences of amino acid residues 20 different amino acids Primary Secondary Tertiary Quaternary 10/8/2002 Lecture 12 1 Angles φ and ψ in the polypeptide chain 10/8/2002 Lecture 12 2
More informationAmino Acid Structures from Klug & Cummings. Bioinformatics (Lec 12)
Amino Acid Structures from Klug & Cummings 2/17/05 1 Amino Acid Structures from Klug & Cummings 2/17/05 2 Amino Acid Structures from Klug & Cummings 2/17/05 3 Amino Acid Structures from Klug & Cummings
More informationRELATIONSHIPS BETWEEN GENES/PROTEINS HOMOLOGUES
Molecular Biology-2018 1 Definitions: RELATIONSHIPS BETWEEN GENES/PROTEINS HOMOLOGUES Heterologues: Genes or proteins that possess different sequences and activities. Homologues: Genes or proteins that
More informationComputational Biology
Computational Biology Lecture 6 31 October 2004 1 Overview Scoring matrices (Thanks to Shannon McWeeney) BLAST algorithm Start sequence alignment 2 1 What is a homologous sequence? A homologous sequence,
More informationExamples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE
Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To
More informationSequence Alignment: Scoring Schemes. COMP 571 Luay Nakhleh, Rice University
Sequence Alignment: Scoring Schemes COMP 571 Luay Nakhleh, Rice University Scoring Schemes Recall that an alignment score is aimed at providing a scale to measure the degree of similarity (or difference)
More informationIntroductory course on Multiple Sequence Alignment Part I: Theoretical foundations
Sequence Analysis and Structure Prediction Service Centro Nacional de Biotecnología CSIC 8-10 May, 2013 Introductory course on Multiple Sequence Alignment Part I: Theoretical foundations Course Notes Instructor:
More informationJournal of Proteomics & Bioinformatics - Open Access
Abstract Methodology for Phylogenetic Tree Construction Kudipudi Srinivas 2, Allam Appa Rao 1, GR Sridhar 3, Srinubabu Gedela 1* 1 International Center for Bioinformatics & Center for Biotechnology, Andhra
More informationHomology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB
Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded
More informationModule: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment
Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Introduction to Bioinformatics online course : IBT Jonathan Kayondo Learning Objectives Understand
More informationGibbs Sampling Methods for Multiple Sequence Alignment
Gibbs Sampling Methods for Multiple Sequence Alignment Scott C. Schmidler 1 Jun S. Liu 2 1 Section on Medical Informatics and 2 Department of Statistics Stanford University 11/17/99 1 Outline Statistical
More informationSequence Analysis, '18 -- lecture 9. Families and superfamilies. Sequence weights. Profiles. Logos. Building a representative model for a gene.
Sequence Analysis, '18 -- lecture 9 Families and superfamilies. Sequence weights. Profiles. Logos. Building a representative model for a gene. How can I represent thousands of homolog sequences in a compact
More informationInDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
More informationIntroduction to Bioinformatics Introduction to Bioinformatics
Dr. rer. nat. Gong Jing Cancer Research Center Medicine School of Shandong University 2012.11.07 1 Chapter 3 Alignment 2 Similarity Searches on Sequence Databases In the game of Mahjong Titans, you want
More informationUsing Bioinformatics to Study Evolutionary Relationships Instructions
3 Using Bioinformatics to Study Evolutionary Relationships Instructions Student Researcher Background: Making and Using Multiple Sequence Alignments One of the primary tasks of genetic researchers is comparing
More informationBioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre
Bioinformatics Scoring Matrices David Gilbert Bioinformatics Research Centre www.brc.dcs.gla.ac.uk Department of Computing Science, University of Glasgow Learning Objectives To explain the requirement
More informationPairwise sequence alignment
Department of Evolutionary Biology Example Alignment between very similar human alpha- and beta globins: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL G+ +VK+HGKKV A+++++AH+D++ +++++LS+LH KL GNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKL
More informationProtein function prediction based on sequence analysis
Performing sequence searches Post-Blast analysis, Using profiles and pattern-matching Protein function prediction based on sequence analysis Slides from a lecture on MOL204 - Applied Bioinformatics 18-Oct-2005
More informationBioinformatics. Dept. of Computational Biology & Bioinformatics
Bioinformatics Dept. of Computational Biology & Bioinformatics 3 Bioinformatics - play with sequences & structures Dept. of Computational Biology & Bioinformatics 4 ORGANIZATION OF LIFE ROLE OF BIOINFORMATICS
More informationGraph Alignment and Biological Networks
Graph Alignment and Biological Networks Johannes Berg http://www.uni-koeln.de/ berg Institute for Theoretical Physics University of Cologne Germany p.1/12 Networks in molecular biology New large-scale
More informationMultiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins
Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins J. Baussand, C. Deremble, A. Carbone Analytical Genomics Laboratoire d Immuno-Biologie Cellulaire
More informationSequence Alignment Techniques and Their Uses
Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this
More informationIntroduction to Bioinformatics
Introduction to Bioinformatics http://1.51.212.243/bioinfo.html Dr. rer. nat. Jing Gong Cancer Research Center School of Medicine, Shandong University 211.1.12 Chapter 3 Alignment Similarity Searches on
More informationSimilarity searching summary (2)
Similarity searching / sequence alignment summary Biol4230 Thurs, February 22, 2016 Bill Pearson wrp@virginia.edu 4-2818 Pinn 6-057 What have we covered? Homology excess similiarity but no excess similarity
More informationEffects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
More informationPractical considerations of working with sequencing data
Practical considerations of working with sequencing data File Types Fastq ->aligner -> reference(genome) coordinates Coordinate files SAM/BAM most complete, contains all of the info in fastq and more!
More informationBioinformatics and BLAST
Bioinformatics and BLAST Overview Recap of last time Similarity discussion Algorithms: Needleman-Wunsch Smith-Waterman BLAST Implementation issues and current research Recap from Last Time Genome consists
More informationMultiple Sequence Alignment
Multiple equence lignment Four ami Khuri Dept of omputer cience an José tate University Multiple equence lignment v Progressive lignment v Guide Tree v lustalw v Toffee v Muscle v MFFT * 20 * 0 * 60 *
More informationAlignment principles and homology searching using (PSI-)BLAST. Jaap Heringa Centre for Integrative Bioinformatics VU (IBIVU)
Alignment principles and homology searching using (PSI-)BLAST Jaap Heringa Centre for Integrative Bioinformatics VU (IBIVU) http://ibivu.cs.vu.nl Bioinformatics Nothing in Biology makes sense except in
More informationFirst generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences
First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences 140.638 where do sequences come from? DNA is not hard to extract (getting DNA from a
More informationSequence and Structure Alignment Z. Luthey-Schulten, UIUC Pittsburgh, 2006 VMD 1.8.5
Sequence and Structure Alignment Z. Luthey-Schulten, UIUC Pittsburgh, 2006 VMD 1.8.5 Why Look at More Than One Sequence? 1. Multiple Sequence Alignment shows patterns of conservation 2. What and how many
More informationSequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013
Sequence Alignments Dynamic programming approaches, scoring, and significance Lucy Skrabanek ICB, WMC January 31, 213 Sequence alignment Compare two (or more) sequences to: Find regions of conservation
More informationCAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan
CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs15.html Describing & Modeling Patterns
More informationLearning Sequence Motif Models Using Expectation Maximization (EM) and Gibbs Sampling
Learning Sequence Motif Models Using Expectation Maximization (EM) and Gibbs Sampling BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 009 Mark Craven craven@biostat.wisc.edu Sequence Motifs what is a sequence
More informationA New Similarity Measure among Protein Sequences
A New Similarity Measure among Protein Sequences Kuen-Pin Wu, Hsin-Nan Lin, Ting-Yi Sung and Wen-Lian Hsu * Institute of Information Science Academia Sinica, Taipei 115, Taiwan Abstract Protein sequence
More informationIntroduction to Bioinformatics
Introduction to Bioinformatics Jianlin Cheng, PhD Department of Computer Science Informatics Institute 2011 Topics Introduction Biological Sequence Alignment and Database Search Analysis of gene expression
More informationSimilarity or Identity? When are molecules similar?
Similarity or Identity? When are molecules similar? Mapping Identity A -> A T -> T G -> G C -> C or Leu -> Leu Pro -> Pro Arg -> Arg Phe -> Phe etc If we map similarity using identity, how similar are
More informationMultiple Alignment. Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis
Multiple Alignment Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis gorm@cbs.dtu.dk Refresher: pairwise alignments 43.2% identity; Global alignment score: 374 10 20
More informationSequence Analysis and Databases 2: Sequences and Multiple Alignments
1 Sequence Analysis and Databases 2: Sequences and Multiple Alignments Jose María González-Izarzugaza Martínez CNIO Spanish National Cancer Research Centre (jmgonzalez@cnio.es) 2 Sequence Comparisons:
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison
CMPS 6630: Introduction to Computational Biology and Bioinformatics Structure Comparison Protein Structure Comparison Motivation Understand sequence and structure variability Understand Domain architecture
More informationSequences, Structures, and Gene Regulatory Networks
Sequences, Structures, and Gene Regulatory Networks Learning Outcomes After this class, you will Understand gene expression and protein structure in more detail Appreciate why biologists like to align
More informationNeural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha
Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this
More informationAmino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1
Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings
More information8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011
8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011 2 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance and alignment 4. The number
More informationA Browser for Pig Genome Data
A Browser for Pig Genome Data Thomas Mailund January 2, 2004 This report briefly describe the blast and alignment data available at http://www.daimi.au.dk/ mailund/pig-genome/ hits.html. The report describes
More informationPhylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
More informationGetting To Know Your Protein
Getting To Know Your Protein Comparative Protein Analysis: Part III. Protein Structure Prediction and Comparison Robert Latek, PhD Sr. Bioinformatics Scientist Whitehead Institute for Biomedical Research
More informationLecture 14: Multiple Sequence Alignment (Gene Finding, Conserved Elements) Scribe: John Ekins
Lecture 14: Multiple Sequence Alignment (Gene Finding, Conserved Elements) 2 19 2015 Scribe: John Ekins Multiple Sequence Alignment Given N sequences x 1, x 2,, x N : Insert gaps in each of the sequences
More informationProtein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationBioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment
Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value
More informationSequence Analysis 17: lecture 5. Substitution matrices Multiple sequence alignment
Sequence Analysis 17: lecture 5 Substitution matrices Multiple sequence alignment Substitution matrices Used to score aligned positions, usually of amino acids. Expressed as the log-likelihood ratio of
More informationPhylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
More information