Sara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)

Size: px
Start display at page:

Download "Sara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)"

Transcription

1 Bioinformática Sequence Alignment Pairwise Sequence Alignment Universidade da Beira Interior (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) 1 16/3/29 & 23/3/29 27/4/29 Outline Introduction What is pairwise sequence alignment? Scoring Sequence Alignments Pairwise Sequence Alignment Algorithms Needleman-Wunsch Algorithm (global alignment) Smith-Waterman Algorithm (local alignment) Extension to repeated matches (multiple local alignments) Heuristic Pairwise Sequence Alignment Algorithms BLAST FASTA 2 1

2 Introduction Advances in molecular biology allow increasingly rapid sequencing of genomes --> Exponential growth in Genbank. Francois Jacob (1977) [Evolution and tinkering, science 196: ] Nature is a tinkerer and not an inventor Eric Wieschaus (1995) [Associated Press, 9 October, 1995] We didn t know it at the time, but we found out everything in life is so similar, that the same genes that work in flies are the ones that work in humans. 3 Introduction New sequences are adapted from pre-existing sequences rather than invented de novo. Sequence similarity is an indicator of homology. Other (several) uses for sequence similarity Database queries Comparative genomics

3 Outline Introduction What is Pairwise Sequence Alignment? Scoring Sequence Alignments Pairwise Sequence Alignment Algorithms Needleman-Wunsch Algorithm (global alignment) Smith-Waterman Algorithm (local alignment) Extension to repeated matches (multiple local alignments) Heuristic Pairwise Sequence Alignment Algorithms BLAST FASTA 5 What is Pairwise Sequence Alignment? The problem of deciding if a pair of sequences are evolutionarily related or not. Two biological sequences are similar Two strings are similar Sequences accumulate Insertions Deletions and Substitutions 6 3

4 What is Pairwise Sequence Alignment? Distance Between DNA Sequences Hamming distance is not typically used to compare DNA or protein sequences. Levenshtein distance allows one to compare strings of different lengths. Edit distance Definition: The edit distance between two strings is defined as the minimum number of edit operations insertions, deletions and substitutions needed to transform the first string into the second. Matches are not counted. 7 What is Pairwise Sequence Alignment? String Alignment The concept of an alignment is crucial. Global Alignment Definition: A (global) alignment of two strings S1 e S2 is obtained by first inserting chosen spaces (or dashes), either into or at the ends of S1 and S2, and then placing the two resulting strings one above the other so that every character or space (dash) in either string is opposite to a unique character (dash) or unique space (dash) in the other string. 8 4

5 What is Pairwise Sequence Alignment? Gaps Gaps help create alignments that better conform to underlying biological models. Mechanisms that make long insertions or deletions in DNA include: unequal crossing-over in meiosis; DNA slippage during replication; insertion of transposable elements into DNA string; insertions of DNA by retro-viruses; etc... Definition: A gap is any maximal, consecutive run of spaces (or dashes) in a single string of a given alignment. 9 What is Pairwise Sequence Alignment? Example S1 = WEAGAWGHEE S2 = PAWHEAE WEAGAWGHE-E P-A--W-HEAE mismatch match gap WEAGAWGHE-E --P-AW-HEAE More than one possible alignment! Which one is better? Is it a true or a spurious alignment? 1 5

6 Outline Introduction What is Pairwise Sequence Alignment? Scoring Sequence Alignments Pairwise Sequence Alignment Algorithms Needleman-Wunsch Algorithm (global alignment) Smith-Waterman Algorithm (local alignment) Extension to repeated matches (multiple local alignments) Heuristic Pairwise Sequence Alignment Algorithms BLAST FASTA 11 How to Score an Alignment? Find the best alignment between two strings under some scoring scheme. Use a scoring model that quantifies evolutionary preferences. Substitution matrices Matches and mismatches Gap penalty Initiating a gap Gap extension penalty Extending a gap Set of values for quantifying the likelihood of one residue being substituted by another in an alignment. 12 6

7 The Scoring Model The total score will be a sum of terms for each aligned pair of residues, plus terms for each gap. Identities and conservative substitutions will be more likely in alignments than expected by chance. contribute with positive score terms. Non-conservative changes are expected to be observed less frequently in real alignments than expected by chance contribute with negative score terms. 13 The Scoring Model The score assigned to an alignment is computed using this function: where S =! s i ( 2 s1( i), s ( i)) + G( g) s(s1(i),s2(i)) is the score for each aligned pair of residues and Given by a Scoring Matrix! G(g) are the gap penalties Given apriori! Scores s(.,.) and gap penalties G(g) can be computed using different models (scoring matrices, probabilistics models,...)! 14 7

8 Example Alignment Scores A E H P W A 5 E 6 G H 1 W Gap penalty: -8 Gap extension penalty: -8 WEAGAWGHE-E --P-AW-HEAE (-8) + (-8) + () + (-8) (-8) (-8) + 6 = 1 15 Example Alignment Scores A E H P W A 5 E 6 G H 1 W Gap penalty: -8 Gap extension penalty: -8 Exercise: What is the score of the following alignment? WEAGAWGHE-E P-A--W-HEAE 16 8

9 Example Alignment Scores A E H P W A 5 E 6 G H 1 W Gap penalty: -8 Gap extension penalty: -8 Exercise: What is the score of the following alignment? WEAGAWGHE-E P-A--W-HEAE (-4) + (-8) (-8) + (-8) (-8) (-8) + 6 = 17 Scoring Matrices Family of matrices listing the likelihood of change from one sequence to another during evolution. Amino acid substitution matrices PAM (Point Accepted Mutation) BLOSUM (BLOcks of Amino Acid SUbstitution Matrix) DNA substitution matrices DNA: less conserved than protein sequences. Less effective to compare coding regions at nucleotide level. 18 9

10 DNA Substitution Matrices Scoring matrices for nucleotide sequences are relatively simple. A positive value or a high score is given for a match and a negative value/low positive score is given for a mismatch. This assignment is based on the assumption that the frequencies of mutation are equal for all bases. However, this assumption may not be realistic! Observations show that transitions (substitutions between purines and purines, A<->C) occur more frequently than transversions (substitutions between pyrimidines and pyrimidines, T<->G) Therefore, a more sophisticated statistical model with different probability values to reflect two types of mutations is needed! Several nucleotide substitution models (Example: Kimura model) 19 Amino acid substitution matrices PAM Matrices (Dayhoff, 1978) Encode and summarize expected evolutionary change at the amino acid level. Each matrix is designed to be used to compare pairs of sequences that are a specific number of PAM units diverged. 1 PAM unit indicates the probability of 1 point mutation per 1 residues. 2 1

11 Amino acid substitution matrices After 1 PAMs of evolution, not every residue will have changed Some residues may have mutated several times. Some residues may have returned to their original state. Some residues may not changed at all. PAM matrices started by constructing hypothetical phylogenetic trees relating the sequences in 71 families, where each pair of sequences differed by no more than 15% of their residues. For each amino acid pair, A i and A j, count the number of times that A i aligns opposite A j, and divide that number by the total number of pairs in all the aligned data. 21 PAM Matrices Let F(i,j) denote the resulting frequency. Let F i and F j be the frequencies that amino acids A i and A j appear in the sequences. The (i,j) entry for the ideal PAMn matrix is: F( i, j) log ( ) F( i) F( j) The image cannot be displayed. Your computer may not have enoug been corrupted. Restart your computer, and then open the file again image and then insert it again

12 Amino acid substitution matrices Evolutionary distance (PAM) Observed difference % Most widely Used PAM Matrix PAM

13 Amino acid substitution matrices BLOSUM Matrices (Henikoff, 1992) Substitution matrices derived using probabilistic models. Matrices derived from a much larger dataset: the protein families BLOCKS database. Sequences are clustered whenever their percentage of identical residues exceed some level L%. BLOSUM5 and BLOSUM62 are widely used. BLOSUM observes significantly more replacements than PAM, even for infrequent pairs. 25 BLOSUM5 A R N D C Q E G H I L K M F P S T W Y V! A 5 1! R! ! N ! D ! C ! Q ! E ! G ! H ! I ! L ! K ! M ! F ! P ! S ! T 2 5! W ! Y ! V

14 Amino acid substitution matrices PAM Matrices vs BLOSUM Matrices PAM model is designed to track evolutionary origin of proteins. BLOSUM model is designed to find conserved domains of proteins. Thumb Rules Lower PAMs and higher BLOSUMs find short local alignment of highly similar sequences. Higher PAMs and lower BLOSUMs find longer weaker local alignments

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot

More information

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between

More information

3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT

3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT 3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode

More information

CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I)

CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) Contents Alignment algorithms Needleman-Wunsch (global alignment) Smith-Waterman (local alignment) Heuristic algorithms FASTA BLAST

More information

Sequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University

Sequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University Sequence Alignment: A General Overview COMP 571 - Fall 2010 Luay Nakhleh, Rice University Life through Evolution All living organisms are related to each other through evolution This means: any pair of

More information

Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM)

Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Bioinformatics II Probability and Statistics Universität Zürich and ETH Zürich Spring Semester 2009 Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Dr Fraser Daly adapted from

More information

Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment

Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value

More information

Tools and Algorithms in Bioinformatics

Tools and Algorithms in Bioinformatics Tools and Algorithms in Bioinformatics GCBA815, Fall 2013 Week3: Blast Algorithm, theory and practice Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and Systems Biology

More information

Practical considerations of working with sequencing data

Practical considerations of working with sequencing data Practical considerations of working with sequencing data File Types Fastq ->aligner -> reference(genome) coordinates Coordinate files SAM/BAM most complete, contains all of the info in fastq and more!

More information

Quantifying sequence similarity

Quantifying sequence similarity Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity

More information

Single alignment: Substitution Matrix. 16 march 2017

Single alignment: Substitution Matrix. 16 march 2017 Single alignment: Substitution Matrix 16 march 2017 BLOSUM Matrix BLOSUM Matrix [2] (Blocks Amino Acid Substitution Matrices ) It is based on the amino acids substitutions observed in ~2000 conserved block

More information

Bioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre

Bioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre Bioinformatics Scoring Matrices David Gilbert Bioinformatics Research Centre www.brc.dcs.gla.ac.uk Department of Computing Science, University of Glasgow Learning Objectives To explain the requirement

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of omputer Science San José State University San José, alifornia, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Pairwise Sequence Alignment Homology

More information

Pairwise & Multiple sequence alignments

Pairwise & Multiple sequence alignments Pairwise & Multiple sequence alignments Urmila Kulkarni-Kale Bioinformatics Centre 411 007 urmila@bioinfo.ernet.in Basis for Sequence comparison Theory of evolution: gene sequences have evolved/derived

More information

Sequence analysis and Genomics

Sequence analysis and Genomics Sequence analysis and Genomics October 12 th November 23 rd 2 PM 5 PM Prof. Peter Stadler Dr. Katja Nowick Katja: group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute

More information

Sequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013

Sequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013 Sequence Alignments Dynamic programming approaches, scoring, and significance Lucy Skrabanek ICB, WMC January 31, 213 Sequence alignment Compare two (or more) sequences to: Find regions of conservation

More information

Biochemistry 324 Bioinformatics. Pairwise sequence alignment

Biochemistry 324 Bioinformatics. Pairwise sequence alignment Biochemistry 324 Bioinformatics Pairwise sequence alignment How do we compare genes/proteins? When we have sequenced a genome, we try and identify the function of unknown genes by finding a similar gene

More information

In-Depth Assessment of Local Sequence Alignment

In-Depth Assessment of Local Sequence Alignment 2012 International Conference on Environment Science and Engieering IPCBEE vol.3 2(2012) (2012)IACSIT Press, Singapoore In-Depth Assessment of Local Sequence Alignment Atoosa Ghahremani and Mahmood A.

More information

Computational Biology

Computational Biology Computational Biology Lecture 6 31 October 2004 1 Overview Scoring matrices (Thanks to Shannon McWeeney) BLAST algorithm Start sequence alignment 2 1 What is a homologous sequence? A homologous sequence,

More information

20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, Global and local alignment of two sequences using dynamic programming

20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, Global and local alignment of two sequences using dynamic programming 20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, 2008 4 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance 4. Global and local alignment

More information

Sequence analysis and comparison

Sequence analysis and comparison The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species

More information

Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment

Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Introduction to Bioinformatics online course : IBT Jonathan Kayondo Learning Objectives Understand

More information

Sequence Analysis 17: lecture 5. Substitution matrices Multiple sequence alignment

Sequence Analysis 17: lecture 5. Substitution matrices Multiple sequence alignment Sequence Analysis 17: lecture 5 Substitution matrices Multiple sequence alignment Substitution matrices Used to score aligned positions, usually of amino acids. Expressed as the log-likelihood ratio of

More information

Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics Jianlin Cheng, PhD Department of Computer Science Informatics Institute 2011 Topics Introduction Biological Sequence Alignment and Database Search Analysis of gene expression

More information

Sequence Alignment: Scoring Schemes. COMP 571 Luay Nakhleh, Rice University

Sequence Alignment: Scoring Schemes. COMP 571 Luay Nakhleh, Rice University Sequence Alignment: Scoring Schemes COMP 571 Luay Nakhleh, Rice University Scoring Schemes Recall that an alignment score is aimed at providing a scale to measure the degree of similarity (or difference)

More information

Pairwise Alignment. Guan-Shieng Huang. Dept. of CSIE, NCNU. Pairwise Alignment p.1/55

Pairwise Alignment. Guan-Shieng Huang. Dept. of CSIE, NCNU. Pairwise Alignment p.1/55 Pairwise Alignment Guan-Shieng Huang shieng@ncnu.edu.tw Dept. of CSIE, NCNU Pairwise Alignment p.1/55 Approach 1. Problem definition 2. Computational method (algorithms) 3. Complexity and performance Pairwise

More information

Pairwise sequence alignments

Pairwise sequence alignments Pairwise sequence alignments Volker Flegel VI, October 2003 Page 1 Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs VI, October

More information

BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University

BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University Measures of Sequence Similarity Alignment with dot

More information

Large-Scale Genomic Surveys

Large-Scale Genomic Surveys Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction

More information

Lecture 4: Evolutionary models and substitution matrices (PAM and BLOSUM).

Lecture 4: Evolutionary models and substitution matrices (PAM and BLOSUM). 1 Bioinformatics: In-depth PROBABILITY & STATISTICS Spring Semester 2011 University of Zürich and ETH Zürich Lecture 4: Evolutionary models and substitution matrices (PAM and BLOSUM). Dr. Stefanie Muff

More information

Lecture 5,6 Local sequence alignment

Lecture 5,6 Local sequence alignment Lecture 5,6 Local sequence alignment Chapter 6 in Jones and Pevzner Fall 2018 September 4,6, 2018 Evolution as a tool for biological insight Nothing in biology makes sense except in the light of evolution

More information

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and

More information

Collected Works of Charles Dickens

Collected Works of Charles Dickens Collected Works of Charles Dickens A Random Dickens Quote If there were no bad people, there would be no good lawyers. Original Sentence It was a dark and stormy night; the night was dark except at sunny

More information

Tools and Algorithms in Bioinformatics

Tools and Algorithms in Bioinformatics Tools and Algorithms in Bioinformatics GCBA815, Fall 2015 Week-4 BLAST Algorithm Continued Multiple Sequence Alignment Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and

More information

Sequence Alignment Techniques and Their Uses

Sequence Alignment Techniques and Their Uses Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this

More information

Scoring Matrices. Shifra Ben-Dor Irit Orr

Scoring Matrices. Shifra Ben-Dor Irit Orr Scoring Matrices Shifra Ben-Dor Irit Orr Scoring matrices Sequence alignment and database searching programs compare sequences to each other as a series of characters. All algorithms (programs) for comparison

More information

Bioinformatics and BLAST

Bioinformatics and BLAST Bioinformatics and BLAST Overview Recap of last time Similarity discussion Algorithms: Needleman-Wunsch Smith-Waterman BLAST Implementation issues and current research Recap from Last Time Genome consists

More information

Local Alignment: Smith-Waterman algorithm

Local Alignment: Smith-Waterman algorithm Local Alignment: Smith-Waterman algorithm Example: a shared common domain of two protein sequences; extended sections of genomic DNA sequence. Sensitive to detect similarity in highly diverged sequences.

More information

Effects of Gap Open and Gap Extension Penalties

Effects of Gap Open and Gap Extension Penalties Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See

More information

Sequence Alignment (chapter 6)

Sequence Alignment (chapter 6) Sequence lignment (chapter 6) he biological problem lobal alignment Local alignment Multiple alignment Introduction to bioinformatics, utumn 6 Background: comparative genomics Basic question in biology:

More information

Alignment principles and homology searching using (PSI-)BLAST. Jaap Heringa Centre for Integrative Bioinformatics VU (IBIVU)

Alignment principles and homology searching using (PSI-)BLAST. Jaap Heringa Centre for Integrative Bioinformatics VU (IBIVU) Alignment principles and homology searching using (PSI-)BLAST Jaap Heringa Centre for Integrative Bioinformatics VU (IBIVU) http://ibivu.cs.vu.nl Bioinformatics Nothing in Biology makes sense except in

More information

Pairwise sequence alignments. Vassilios Ioannidis (From Volker Flegel )

Pairwise sequence alignments. Vassilios Ioannidis (From Volker Flegel ) Pairwise sequence alignments Vassilios Ioannidis (From Volker Flegel ) Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs Importance

More information

Similarity or Identity? When are molecules similar?

Similarity or Identity? When are molecules similar? Similarity or Identity? When are molecules similar? Mapping Identity A -> A T -> T G -> G C -> C or Leu -> Leu Pro -> Pro Arg -> Arg Phe -> Phe etc If we map similarity using identity, how similar are

More information

Pairwise sequence alignment

Pairwise sequence alignment Department of Evolutionary Biology Example Alignment between very similar human alpha- and beta globins: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL G+ +VK+HGKKV A+++++AH+D++ +++++LS+LH KL GNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKL

More information

Sequence Comparison. mouse human

Sequence Comparison. mouse human Sequence Comparison Sequence Comparison mouse human Why Compare Sequences? The first fact of biological sequence analysis In biomolecular sequences (DNA, RNA, or amino acid sequences), high sequence similarity

More information

8 Grundlagen der Bioinformatik, SS 09, D. Huson, April 28, 2009

8 Grundlagen der Bioinformatik, SS 09, D. Huson, April 28, 2009 8 Grundlagen der Bioinformatik, SS 09, D. Huson, April 28, 2009 2 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance and alignment 4. The number

More information

Motivating the need for optimal sequence alignments...

Motivating the need for optimal sequence alignments... 1 Motivating the need for optimal sequence alignments... 2 3 Note that this actually combines two objectives of optimal sequence alignments: (i) use the score of the alignment o infer homology; (ii) use

More information

5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT

5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT 5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT.03.239 03.10.2012 ALIGNMENT Alignment is the task of locating equivalent regions of two or more sequences to maximize their similarity. Homology:

More information

Pairwise Sequence Alignment

Pairwise Sequence Alignment Introduction to Bioinformatics Pairwise Sequence Alignment Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Outline Introduction to sequence alignment pair wise sequence alignment The Dot Matrix Scoring

More information

Bioinformatics for Computer Scientists (Part 2 Sequence Alignment) Sepp Hochreiter

Bioinformatics for Computer Scientists (Part 2 Sequence Alignment) Sepp Hochreiter Bioinformatics for Computer Scientists (Part 2 Sequence Alignment) Institute of Bioinformatics Johannes Kepler University, Linz, Austria Sequence Alignment 2. Sequence Alignment Sequence Alignment 2.1

More information

BIOINFORMATICS: An Introduction

BIOINFORMATICS: An Introduction BIOINFORMATICS: An Introduction What is Bioinformatics? The term was first coined in 1988 by Dr. Hwa Lim The original definition was : a collective term for data compilation, organisation, analysis and

More information

Copyright 2000 N. AYDIN. All rights reserved. 1

Copyright 2000 N. AYDIN. All rights reserved. 1 Introduction to Bioinformatics Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Multiple Sequence Alignment Outline Multiple sequence alignment introduction to msa methods of msa progressive global alignment

More information

Basic Local Alignment Search Tool

Basic Local Alignment Search Tool Basic Local Alignment Search Tool Alignments used to uncover homologies between sequences combined with phylogenetic studies o can determine orthologous and paralogous relationships Local Alignment uses

More information

CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018

CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018 CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of

More information

Pairwise alignment. 2.1 Introduction GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSD----LHAHKL

Pairwise alignment. 2.1 Introduction GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSD----LHAHKL 2 Pairwise alignment 2.1 Introduction The most basic sequence analysis task is to ask if two sequences are related. This is usually done by first aligning the sequences (or parts of them) and then deciding

More information

Dr. Amira A. AL-Hosary

Dr. Amira A. AL-Hosary Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

More information

Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm. Alignment scoring schemes and theory: substitution matrices and gap models

Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm. Alignment scoring schemes and theory: substitution matrices and gap models Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm Alignment scoring schemes and theory: substitution matrices and gap models 1 Local sequence alignments Local sequence alignments are necessary

More information

Substitution matrices

Substitution matrices Introduction to Bioinformatics Substitution matrices Jacques van Helden Jacques.van-Helden@univ-amu.fr Université d Aix-Marseille, France Lab. Technological Advances for Genomics and Clinics (TAGC, INSERM

More information

First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences

First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences 140.638 where do sequences come from? DNA is not hard to extract (getting DNA from a

More information

Alignment & BLAST. By: Hadi Mozafari KUMS

Alignment & BLAST. By: Hadi Mozafari KUMS Alignment & BLAST By: Hadi Mozafari KUMS SIMILARITY - ALIGNMENT Comparison of primary DNA or protein sequences to other primary or secondary sequences Expecting that the function of the similar sequence

More information

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded

More information

8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011

8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011 8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011 2 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance and alignment 4. The number

More information

Introduction to Computation & Pairwise Alignment

Introduction to Computation & Pairwise Alignment Introduction to Computation & Pairwise Alignment Eunok Paek eunokpaek@hanyang.ac.kr Algorithm what you already know about programming Pan-Fried Fish with Spicy Dipping Sauce This spicy fish dish is quick

More information

Week 10: Homology Modelling (II) - HHpred

Week 10: Homology Modelling (II) - HHpred Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative

More information

Phylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches

Phylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell

More information

Local Alignment Statistics

Local Alignment Statistics Local Alignment Statistics Stephen Altschul National Center for Biotechnology Information National Library of Medicine National Institutes of Health Bethesda, MD Central Issues in Biological Sequence Comparison

More information

Moreover, the circular logic

Moreover, the circular logic Moreover, the circular logic How do we know what is the right distance without a good alignment? And how do we construct a good alignment without knowing what substitutions were made previously? ATGCGT--GCAAGT

More information

Biology Tutorial. Aarti Balasubramani Anusha Bharadwaj Massa Shoura Stefan Giovan

Biology Tutorial. Aarti Balasubramani Anusha Bharadwaj Massa Shoura Stefan Giovan Biology Tutorial Aarti Balasubramani Anusha Bharadwaj Massa Shoura Stefan Giovan Viruses A T4 bacteriophage injecting DNA into a cell. Influenza A virus Electron micrograph of HIV. Cone-shaped cores are

More information

Study and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis

Study and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis Study and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis Kumud Joseph Kujur, Sumit Pal Singh, O.P. Vyas, Ruchir Bhatia, Varun Singh* Indian Institute of Information

More information

Bioinformatics Exercises

Bioinformatics Exercises Bioinformatics Exercises AP Biology Teachers Workshop Susan Cates, Ph.D. Evolution of Species Phylogenetic Trees show the relatedness of organisms Common Ancestor (Root of the tree) 1 Rooted vs. Unrooted

More information

Bioinformatics for Biologists

Bioinformatics for Biologists Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Head, Biocomputing Whitehead Institute Bioinformatics Definitions The use of computational

More information

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological

More information

Algorithms in Bioinformatics: A Practical Introduction. Sequence Similarity

Algorithms in Bioinformatics: A Practical Introduction. Sequence Similarity Algorithms in Bioinformatics: A Practical Introduction Sequence Similarity Earliest Researches in Sequence Comparison Doolittle et al. (Science, July 1983) searched for platelet-derived growth factor (PDGF)

More information

1.5 Sequence alignment

1.5 Sequence alignment 1.5 Sequence alignment The dramatic increase in the number of sequenced genomes and proteomes has lead to development of various bioinformatic methods and algorithms for extracting information (data mining)

More information

Tiffany Samaroo MB&B 452a December 8, Take Home Final. Topic 1

Tiffany Samaroo MB&B 452a December 8, Take Home Final. Topic 1 Tiffany Samaroo MB&B 452a December 8, 2003 Take Home Final Topic 1 Prior to 1970, protein and DNA sequence alignment was limited to visual comparison. This was a very tedious process; even proteins with

More information

Lecture Notes: Markov chains

Lecture Notes: Markov chains Computational Genomics and Molecular Biology, Fall 5 Lecture Notes: Markov chains Dannie Durand At the beginning of the semester, we introduced two simple scoring functions for pairwise alignments: a similarity

More information

BLAST: Target frequencies and information content Dannie Durand

BLAST: Target frequencies and information content Dannie Durand Computational Genomics and Molecular Biology, Fall 2016 1 BLAST: Target frequencies and information content Dannie Durand BLAST has two components: a fast heuristic for searching for similar sequences

More information

Sequence Database Search Techniques I: Blast and PatternHunter tools

Sequence Database Search Techniques I: Blast and PatternHunter tools Sequence Database Search Techniques I: Blast and PatternHunter tools Zhang Louxin National University of Singapore Outline. Database search 2. BLAST (and filtration technique) 3. PatternHunter (empowered

More information

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas Sequence comparison: Score matrices Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas Informal inductive proof of best alignment path onsider the last step in the best

More information

Introduction to sequence alignment. Local alignment the Smith-Waterman algorithm

Introduction to sequence alignment. Local alignment the Smith-Waterman algorithm Lecture 2, 12/3/2003: Introduction to sequence alignment The Needleman-Wunsch algorithm for global sequence alignment: description and properties Local alignment the Smith-Waterman algorithm 1 Computational

More information

7.36/7.91 recitation CB Lecture #4

7.36/7.91 recitation CB Lecture #4 7.36/7.91 recitation 2-19-2014 CB Lecture #4 1 Announcements / Reminders Homework: - PS#1 due Feb. 20th at noon. - Late policy: ½ credit if received within 24 hrs of due date, otherwise no credit - Answer

More information

Background: comparative genomics. Sequence similarity. Homologs. Similarity vs homology (2) Similarity vs homology. Sequence Alignment (chapter 6)

Background: comparative genomics. Sequence similarity. Homologs. Similarity vs homology (2) Similarity vs homology. Sequence Alignment (chapter 6) Sequence lignment (chapter ) he biological problem lobal alignment Local alignment Multiple alignment Background: comparative genomics Basic question in biology: what properties are shared among organisms?

More information

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas Sequence comparison: Score matrices Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas FYI - informal inductive proof of best alignment path onsider the last step in

More information

COPIA: A New Software for Finding Consensus Patterns. Chengzhi Liang. A thesis. presented to the University ofwaterloo. in fulfilment of the

COPIA: A New Software for Finding Consensus Patterns. Chengzhi Liang. A thesis. presented to the University ofwaterloo. in fulfilment of the COPIA: A New Software for Finding Consensus Patterns in Unaligned Protein Sequences by Chengzhi Liang A thesis presented to the University ofwaterloo in fulfilment of the thesis requirement for the degree

More information

BINF 730. DNA Sequence Alignment Why?

BINF 730. DNA Sequence Alignment Why? BINF 730 Lecture 2 Seuence Alignment DNA Seuence Alignment Why? Recognition sites might be common restriction enzyme start seuence stop seuence other regulatory seuences Homology evolutionary common progenitor

More information

Finding the Best Biological Pairwise Alignment Through Genetic Algorithm Determinando o Melhor Alinhamento Biológico Através do Algoritmo Genético

Finding the Best Biological Pairwise Alignment Through Genetic Algorithm Determinando o Melhor Alinhamento Biológico Através do Algoritmo Genético Finding the Best Biological Pairwise Alignment Through Genetic Algorithm Determinando o Melhor Alinhamento Biológico Através do Algoritmo Genético Paulo Mologni 1, Ailton Akira Shinoda 2, Carlos Dias Maciel

More information

... and searches for related sequences probably make up the vast bulk of bioinformatics activities.

... and searches for related sequences probably make up the vast bulk of bioinformatics activities. 1 2 ... and searches for related sequences probably make up the vast bulk of bioinformatics activities. 3 The terms homology and similarity are often confused and used incorrectly. Homology is a quality.

More information

C E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 5 G R A T I V. Pair-wise Sequence Alignment

C E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 5 G R A T I V. Pair-wise Sequence Alignment C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Introduction to bioinformatics 2007 Lecture 5 Pair-wise Sequence Alignment Bioinformatics Nothing in Biology makes sense except in

More information

Scoring Matrices. Shifra Ben Dor Irit Orr

Scoring Matrices. Shifra Ben Dor Irit Orr Scoring Matrices Shifra Ben Dor Irit Orr Scoring matrices Sequence alignment and database searching programs compare sequences to each other as a series of characters. All algorithms (programs) for comparison

More information

Homology Modeling. Roberto Lins EPFL - summer semester 2005

Homology Modeling. Roberto Lins EPFL - summer semester 2005 Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,

More information

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments

More information

An Introduction to Sequence Similarity ( Homology ) Searching

An Introduction to Sequence Similarity ( Homology ) Searching An Introduction to Sequence Similarity ( Homology ) Searching Gary D. Stormo 1 UNIT 3.1 1 Washington University, School of Medicine, St. Louis, Missouri ABSTRACT Homologous sequences usually have the same,

More information

BLAST. Varieties of BLAST

BLAST. Varieties of BLAST BLAST Basic Local Alignment Search Tool (1990) Altschul, Gish, Miller, Myers, & Lipman Uses short-cuts or heuristics to improve search speed Like speed-reading, does not examine every nucleotide of database

More information

Sequence comparison: Score matrices

Sequence comparison: Score matrices Sequence comparison: Score matrices http://facultywashingtonedu/jht/gs559_2013/ Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas FYI - informal inductive proof of best

More information

Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:

Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17: Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:50 5001 5 Multiple Sequence Alignment The first part of this exposition is based on the following sources, which are recommended reading:

More information

Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences

Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic

More information

Phylogenetic inference

Phylogenetic inference Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types

More information

InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9

InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9 Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic

More information

Administration. ndrew Torda April /04/2008 [ 1 ]

Administration. ndrew Torda April /04/2008 [ 1 ] ndrew Torda April 2008 Administration 22/04/2008 [ 1 ] Sprache? zu verhandeln (Englisch, Hochdeutsch, Bayerisch) Selection of topics Proteins / DNA / RNA Two halves to course week 1-7 Prof Torda (larger

More information

BLAST Database Searching. BME 110: CompBio Tools Todd Lowe April 8, 2010

BLAST Database Searching. BME 110: CompBio Tools Todd Lowe April 8, 2010 BLAST Database Searching BME 110: CompBio Tools Todd Lowe April 8, 2010 Admin Reading: Read chapter 7, and the NCBI Blast Guide and tutorial http://www.ncbi.nlm.nih.gov/blast/why.shtml Read Chapter 8 for

More information