Seuqence Analysis '17--lecture 10. Trees types of trees Newick notation UPGMA Fitch Margoliash Distance vs Parsimony

Size: px
Start display at page:

Download "Seuqence Analysis '17--lecture 10. Trees types of trees Newick notation UPGMA Fitch Margoliash Distance vs Parsimony"

Transcription

1 Seuqence nalysis '17--lecture 10 Trees types of trees Newick notation UPGM Fitch Margoliash istance vs Parsimony

2 Phyogenetic trees What is a phylogenetic tree? model of evolutionary relationships -- common ancestors and speciation events. Why build phylogenetic trees? To trace the branch order of "taxa" (taxon = a gene, a species, a population, etc.) To understand the evolution of traits s part of a multiple sequence alignment algorithm Trees can be "rooted" or "unrooted" root no root

3 Tree Terminology time (rooted trees only) Lineages root ommon ancestors (hypothetical) outgroup taxa Taxa are observed species or genes.

4 Inferring evolutionary relationships between the taxa requires rooting the tree: To root a tree mentally, imagine that the tree is made of string. Grab the string at the root and tug on it until the ends of the string (the taxa) fall opposite the root: Root Unrooted tree Root Rooted tree

5 Where the tree is rooted changes its meaning. Each of these trees is possible by choosing a different root. This one says and branched late. This one says and branched early.

6 Taxon order doesn't matter. Rotating an ancestor node does not change the relationships. UGENE: swap siblings

7 Two strategies for rooting a tree: "outgroup" and "midpoint" 1. hoose the midpoint between the two most distant branches. cladogram 2. hoose one taxon as the "out group." (it branches first.) good outgroup is not too distant from the rest of the tree. phylogram

8 Newick notation (,(,(,))) Trees can be represented in plain text Newick notation. Each set of parentheses represents a branch-point (split), the comma separates left and right lineages. Implies a rooted tree. (,(,(,))) = Newick notation can contain sequence labels or not.

9 Here is a Newick Tree for 50 taxa (((((((((((((('Phoca caspica': ,'halichoerus grypus': ): ,'Phoca sibirica': ): ,('phoca largha': ,'Phoca vitulina': ): ): ,'phoca hispida': ): ,('phoca fasciata': ,'phoca groenlandica': ): ): ,'ystophora cristata': ): ,'Erignathus barbatus': ): ,((((('hydrurga leptonyx': ,'Leptonychotes weddellii': ): ,'lobodon carcinophaga': ): ,'ommatophoca rossii': ): ,('Mirounga angustirostris': ,'mirounga leonina': ): ): ,('Monachus schauinslandi': ,'monachus monachus': ): ): ): ,((((((('rctocephalus australis': ,'rctocephalus forsteri': ): ,'rctocephalus townsendi': ): ,('neophoca cinerea': ,'phocarctos hookeri': ): ): ,('Otaria byronia': ,'rctocephalus pusillus': ): ): ,('Eumetopias jubatus': ,'zalophus californianus': ): ): ,'allorhinus ursinus': ): ,'Odobenus rosmarus': ): ): ,((((((('Enhydra lutris': ,'lontra canadensis': ): ,'Mustela vison': ): ,(('martes americana': ,'Martes melampus': ): ,'gulo gulo': ): ): ,'Meles meles': ): ,'Taxidea taxus': ): ,'procyon lotor': ): ,(('Mephitis mephitis': ,'spilogale putorius': ): ,'ilurus fulgens': ): ): ): ,(((((('Ursus americanus': ,'ursus thibetanus': ): ,'Helarctos malayanus': ): , ('Ursus arctos': ,'ursus maritimus': ): ): ,'Melursus ursinus': ): ,'tremarctos ornatus': ): ,'iluropoda melanoleuca': ): ): ,(('lopex lagopus': ,'vulpes vulpes': ): ,('anis latrans': ,'anis lupus': ): ): ): ,((((('cinonyx jubatus': ,'puma concolor': ): ,'lynx canadensis': ): ,'Felis silvestris': ): ,((('panthera pardus': ,'Uncia uncia': ): ,'panthera tigris': ): ,'Neofelis nebulosa': ): ): ,'Herpestes auropunctatus': ): ): ,'manis 9 tetradactyla': );

10 id the Florida entist infect his patients with HIV? Phylogenetic tree of HIV sequences from the ENTIST, his Patients, & Local HIV-infected People: ENTIST Patient Patient Patient G Patient Patient E Patient ENTIST Local control 2 Local control 3 Patient F Local control 9 Local control 35 Local control 3 Patient Yes: The HIV sequences from these patients fall within the clade of HIV sequences found in the dentist. No No From Ou et al. (1992) and Page & Holmes (1998)

11 Evolutionary time ladogram Phylogram Ultrametric tree no meaning genetic change time (:5,(:1,(:1,:6):1):3) Newick format with distances

12 Neighbor joining: cladogram hoose the closest neighbors. dd a node between them. hoose the next closest, ad so on. E Species Species Species Species Species E E

13 UPGM E Species Species Species Species Species E J- corrected distances Unweighted pair group method using averages ssumes constant evolutionary clock. ll sequences have the same distance to the common ancestor. Ultrametric tree. raw p-distances 1) Generate neighbor-joining tree. (NJ) 2) For first neighbors, distance to ancestor is dij/2 3) For next neighbors, distance to ancestor is average pairwise distance between taxa in two clades, divided by two. 4) Subtract to get lineage distances. istance to common ancestor = verage distance between taxa in two clades, divided by two. fill in the blanks 2 = E 13

14 cladogram to phylogram: Fitch-Margoliash algorithm E sequence distances Species Species Species Species Species E lineages 0.59 E E Problem statement: Given a tree and a set of sequence distances, derive lineages such that the tree distances maximally match the sequence distances.

15 Fitch-Margoliash algorithm for calculating the branch lengths 1. Find the most closely-related pair of sequences, and 2. alculate the average distance from to all other sequences, then from to all other sequences. x x x 3. djust the position of the common ancestor node for and so that the difference between the averages is equal to the difference between the and branch lengths, while the sum of the branch lengths is still equal to. (=sequence distance, d=lineage distance) d -d = ( + )/2 - (+ )/2 d d NOTE: the difference between the averages may be greater than (,), making step 3 impossible.

16 Exercise 8: create a rooted phylogram with 4 taxa TTGGTGTGGTG TTGGTGGGTGG TGGTGTGTGG GTGGTTGTGTTG irections: K(,) = -3/4 ln [1-4/3 pdist(,)] pdist =1-identity 1.Make a distance matrix. (p-distance, then convert to J- distance) 2.Use Neighbor-joining to make a tree. 3.djust branch lengths using Fitch-Margoliash. 4.hoose the root using the Midpoint method. 5.Write tree in Newick format.

17 Orthologs/paralogs Orthologs: homologs originating from a speciation event Paralogs: homologs originating from a gene duplication event. 4 species 6 sequences duplication speciation gene loss speciation clam crab duck fish Species tree clam duck fish crab duck Sequence tree fish clam crab duck duck reconciled fish fish clam and fish are orthologs. clam and crab are paralogs.

18 How do I know it s a paralog? If it s a paralog, then at some point in evolutionary history, a species existed with two identical genes in it. One may have been lost since then. (escendants are still paralogs!) Paralogs can be from different species. Paralogous genes have more than the expected sequence divergence. ecause they are more likely to have different functions ecause they diverged earlier than the speciation event. Without species information or functional information, it s impossible to tell orthologs from paralogs.

19 Maximum parsimony -- it's character-building Optimality criterion: The most-parsimonious tree is the one that requires the fewest number of evolutionary events (e.g., nucleotide substitutions, amino acid replacements) to explain the sequences. E TGGTTTTTTGTG TGTGTTTTTT TTTGTGTGGT TTGGTGTGGTG TTGGTTTTGTTG T T For this column, and this tree, one mutation event is required. T

20 character-based tree-building For this other column, the same tree requires two mutation events. different tree would require only one. E TGGTTTTTTGTG TGTGTTTTTT TTTGTGTGGT TTGGTGTGGTG TTGGTTTTGTTG T T T

21 Finding the minimum number of mutations Given a tree and a set of taxa, one-letter each (1) choose optional characters for each ancestor. (2) Select the root character that minimizes the number of mutations by selecting each and propagating it through the tree. T// T/ T/ T/ T T T T minimum 2 mutations minimum 1 mutation

22 Parsimony tips: Ignore non-informative sites No mismatchs ---> noninformative! dds 0 mutations in all trees One mismatch --> noninformative! dds 1 mutation in all trees. ll different --> noninformative! dds same number of mutation in all trees. Only possible if number of sequences alphabet 22

23 Find noninformative columns TGGGTTTTTGTG TGGTGTGTTTTT TGTTGTGGT TGGTGTGGTG 23

24 Sum the Max Unweighted Parsimony for 4 5-taxa trees......,......, TGGTTTTTTGTG TGGTGTTTTTT TTTGTGTGGT TTGGTGTGGTG E TTGGTTTTGTTG TOTLS

25 Which method do I use? Sequence similarity strong weak very weak Method to use distance parsimony maximum likelihood

26 Review What do nodes and lineages in a tree represent? What are the two strategies for rooting a tree? Why root a tree? What is maximum parsimony? How do I find the most parsimonious tree? What is maximum likelihood? How does it relate to maximum parsimony? What kind of MS positions are not informative of the tree? What problem does Fitch-Margoliash solve? How? What is an ortholog? Paralog? How can I tell them apart? Unroot and re-root this tree: ((,),((,),E)) 26

Bioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony

Bioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony ioinformatics -- lecture 9 Phylogenetic trees istance-based tree building Parsimony (,(,(,))) rees can be represented in "parenthesis notation". Each set of parentheses represents a branch-point (bifurcation),

More information

Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny

More information

Theory of Evolution. Charles Darwin

Theory of Evolution. Charles Darwin Theory of Evolution harles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (8-6) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties

More information

Phylogenetic trees 07/10/13

Phylogenetic trees 07/10/13 Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share

More information

Theory of Evolution Charles Darwin

Theory of Evolution Charles Darwin Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties

More information

Phylogenetic inference

Phylogenetic inference Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods

More information

9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)

9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree) I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by

More information

Evolutionary Tree Analysis. Overview

Evolutionary Tree Analysis. Overview CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based

More information

C3020 Molecular Evolution. Exercises #3: Phylogenetics

C3020 Molecular Evolution. Exercises #3: Phylogenetics C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from

More information

Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline

Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying

More information

Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.

Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5. Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony

More information

Dr. Amira A. AL-Hosary

Dr. Amira A. AL-Hosary Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

More information

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological

More information

Phylogenetic Tree Reconstruction

Phylogenetic Tree Reconstruction I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven

More information

"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky

Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally

More information

Multiple Sequence Alignment. Sequences

Multiple Sequence Alignment. Sequences Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe

More information

8/23/2014. Phylogeny and the Tree of Life

8/23/2014. Phylogeny and the Tree of Life Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major

More information

EVOLUTIONARY DISTANCES

EVOLUTIONARY DISTANCES EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:

More information

Constructing Evolutionary/Phylogenetic Trees

Constructing Evolutionary/Phylogenetic Trees Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood

More information

What is Phylogenetics

What is Phylogenetics What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)

More information

Phylogeny Tree Algorithms

Phylogeny Tree Algorithms Phylogeny Tree lgorithms Jianlin heng, PhD School of Electrical Engineering and omputer Science University of entral Florida 2006 Free for academic use. opyright @ Jianlin heng & original sources for some

More information

CS5263 Bioinformatics. Guest Lecture Part II Phylogenetics

CS5263 Bioinformatics. Guest Lecture Part II Phylogenetics CS5263 Bioinformatics Guest Lecture Part II Phylogenetics Up to now we have focused on finding similarities, now we start focusing on differences (dissimilarities leading to distance measures). Identifying

More information

POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics

POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the

More information

UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)

UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the

More information

C.DARWIN ( )

C.DARWIN ( ) C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships

More information

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species

More information

Page 1. Evolutionary Trees. Why build evolutionary tree? Outline

Page 1. Evolutionary Trees. Why build evolutionary tree? Outline Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny

More information

Phylogenetic analyses. Kirsi Kostamo

Phylogenetic analyses. Kirsi Kostamo Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,

More information

Anatomy of a tree. clade is group of organisms with a shared ancestor. a monophyletic group shares a single common ancestor = tapirs-rhinos-horses

Anatomy of a tree. clade is group of organisms with a shared ancestor. a monophyletic group shares a single common ancestor = tapirs-rhinos-horses Anatomy of a tree outgroup: an early branching relative of the interest groups sister taxa: taxa derived from the same recent ancestor polytomy: >2 taxa emerge from a node Anatomy of a tree clade is group

More information

BINF6201/8201. Molecular phylogenetic methods

BINF6201/8201. Molecular phylogenetic methods BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics

More information

Phylogeny and Systematics

Phylogeny and Systematics Chapter 25 Phylogeny and Systematics PowerPoint Lectures for Biology, Seventh Edition Neil Campbell and Jane Reece Lectures by Chris Romero Modified by Maria Morlin racing phylogeny Phylogeny: he evolutionary

More information

Smith et. al, Carnivore Cooperation, Page, 1

Smith et. al, Carnivore Cooperation, Page, 1 Smith et. al, Carnivore Cooperation, Page, 1 Electronic supplement. Natural history data for each available species of Carnivora. Family Lo ngevity (yrs) Ailuridae Ailurus fulgens Red panda 2 423 5 1.0

More information

Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science

Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.

More information

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between

More information

Lecture 11 Friday, October 21, 2011

Lecture 11 Friday, October 21, 2011 Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system

More information

Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships

Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic

More information

molecular evolution and phylogenetics

molecular evolution and phylogenetics molecular evolution and phylogenetics Charlotte Darby Computational Genomics: Applied Comparative Genomics 2.13.18 https://www.thinglink.com/scene/762084640000311296 Internal node Root TIME Branch Leaves

More information

Introduction to characters and parsimony analysis

Introduction to characters and parsimony analysis Introduction to characters and parsimony analysis Genetic Relationships Genetic relationships exist between individuals within populations These include ancestordescendent relationships and more indirect

More information

Phylogenetics: Building Phylogenetic Trees

Phylogenetics: Building Phylogenetic Trees 1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should

More information

Copyright notice. Molecular Phylogeny and Evolution. Goals of the lecture. Introduction. Introduction. December 15, 2008

Copyright notice. Molecular Phylogeny and Evolution. Goals of the lecture. Introduction. Introduction. December 15, 2008 opyright notice Molecular Phylogeny and volution ecember 5, 008 ioinformatics J. Pevsner pevsner@kennedykrieger.org Many of the images in this powerpoint presentation are from ioinformatics and Functional

More information

Constructing Evolutionary/Phylogenetic Trees

Constructing Evolutionary/Phylogenetic Trees Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood

More information

! A species tree aims at representing the evolutionary relationships between species. ! Species trees and gene trees are generally related...

! A species tree aims at representing the evolutionary relationships between species. ! Species trees and gene trees are generally related... Bioinformatics Phylogeny Species trees versus molecule tree! A species tree aims at representing the evolutionary relationships between species.! A molecule tree represents the evolutionary history of

More information

Phylogeny and the Tree of Life

Phylogeny and the Tree of Life Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from

More information

Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University

Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary

More information

Cladistics and Bioinformatics Questions 2013

Cladistics and Bioinformatics Questions 2013 AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species

More information

Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz

Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels

More information

How to read and make phylogenetic trees Zuzana Starostová

How to read and make phylogenetic trees Zuzana Starostová How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation

More information

DNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi

DNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi DNA Phylogeny Signals and Systems in Biology Kushal Shah @ EE, IIT Delhi Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics :

More information

Introduction to Bioinformatics Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics Dr. rer. nat. Gong Jing Cancer Research Center Medicine School of Shandong University 2012.11.09 1 Chapter 4 Phylogenetic Tree 2 Phylogeny Evidence from morphological ( 形态学的 ), biochemical, and gene sequence

More information

Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center

Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods

More information

Chapter 26 Phylogeny and the Tree of Life

Chapter 26 Phylogeny and the Tree of Life Chapter 26 Phylogeny and the Tree of Life Biologists estimate that there are about 5 to 100 million species of organisms living on Earth today. Evidence from morphological, biochemical, and gene sequence

More information

Bioinformatics tools for phylogeny and visualization. Yanbin Yin

Bioinformatics tools for phylogeny and visualization. Yanbin Yin Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and

More information

Chapter 19: Taxonomy, Systematics, and Phylogeny

Chapter 19: Taxonomy, Systematics, and Phylogeny Chapter 19: Taxonomy, Systematics, and Phylogeny AP Curriculum Alignment Chapter 19 expands on the topics of phylogenies and cladograms, which are important to Big Idea 1. In order for students to understand

More information

A (short) introduction to phylogenetics

A (short) introduction to phylogenetics A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field

More information

Gene Families part 2. Review: Gene Families /727 Lecture 8. Protein family. (Multi)gene family

Gene Families part 2. Review: Gene Families /727 Lecture 8. Protein family. (Multi)gene family Review: Gene Families Gene Families part 2 03 327/727 Lecture 8 What is a Case study: ian globin genes Gene trees and how they differ from species trees Homology, orthology, and paralogy Last tuesday 1

More information

Phylogenetics. BIOL 7711 Computational Bioscience

Phylogenetics. BIOL 7711 Computational Bioscience Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium

More information

Lecture 6 Phylogenetic Inference

Lecture 6 Phylogenetic Inference Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,

More information

Phylogeny and the Tree of Life

Phylogeny and the Tree of Life LECTURE PRESENTATIONS For CAMPBELL BIOLOGY, NINTH EDITION Jane B. Reece, Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Robert B. Jackson Chapter 26 Phylogeny and the Tree of Life

More information

Michael Yaffe Lecture #5 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D

Michael Yaffe Lecture #5 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D 7.91 Lecture #5 Database Searching & Molecular Phylogenetics Michael Yaffe B C D B C D (((,B)C)D) Outline Distance Matrix Methods Neighbor-Joining Method and Related Neighbor Methods Maximum Likelihood

More information

Phylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction. Lesser Tenrec (Echinops telfairi)

Phylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction. Lesser Tenrec (Echinops telfairi) Phylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction Lesser Tenrec (Echinops telfairi) Goals: 1. Use phylogenetic experimental design theory to select optimal taxa to

More information

Building Phylogenetic Trees UPGMA & NJ

Building Phylogenetic Trees UPGMA & NJ uilding Phylogenetic Trees UPGM & NJ UPGM UPGM Unweighted Pair-Group Method with rithmetic mean Unweighted = all pairwise distances contribute equally. Pair-Group = groups are combined in pairs. rithmetic

More information

Phylogeny: building the tree of life

Phylogeny: building the tree of life Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan

More information

How should we organize the diversity of animal life?

How should we organize the diversity of animal life? How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)

More information

Chapter 26: Phylogeny and the Tree of Life

Chapter 26: Phylogeny and the Tree of Life Chapter 26: Phylogeny and the Tree of Life 1. Key Concepts Pertaining to Phylogeny 2. Determining Phylogenies 3. Evolutionary History Revealed in Genomes 1. Key Concepts Pertaining to Phylogeny PHYLOGENY

More information

Phylogeny and the Tree of Life

Phylogeny and the Tree of Life Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from

More information

Biology 211 (2) Week 1 KEY!

Biology 211 (2) Week 1 KEY! Biology 211 (2) Week 1 KEY Chapter 1 KEY FIGURES: 1.2, 1.3, 1.4, 1.5, 1.6, 1.7 VOCABULARY: Adaptation: a trait that increases the fitness Cells: a developed, system bound with a thin outer layer made of

More information

AP Biology. Cladistics

AP Biology. Cladistics Cladistics Kingdom Summary Review slide Review slide Classification Old 5 Kingdom system Eukaryote Monera, Protists, Plants, Fungi, Animals New 3 Domain system reflects a greater understanding of evolution

More information

Inferring Phylogenetic Trees. Distance Approaches. Representing distances. in rooted and unrooted trees. The distance approach to phylogenies

Inferring Phylogenetic Trees. Distance Approaches. Representing distances. in rooted and unrooted trees. The distance approach to phylogenies Inferring Phylogenetic Trees Distance Approaches Representing distances in rooted and unrooted trees The distance approach to phylogenies given: an n n matrix M where M ij is the distance between taxa

More information

Phylogeny: traditional and Bayesian approaches

Phylogeny: traditional and Bayesian approaches Phylogeny: traditional and Bayesian approaches 5-Feb-2014 DEKM book Notes from Dr. B. John Holder and Lewis, Nature Reviews Genetics 4, 275-284, 2003 1 Phylogeny A graph depicting the ancestor-descendent

More information

GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.

GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS. !! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory

More information

Phylogenetics Todd Vision Spring Some applications. Uncultured microbial diversity

Phylogenetics Todd Vision Spring Some applications. Uncultured microbial diversity Phylogenetics Todd Vision Spring 2008 Tree basics Sequence alignment Inferring a phylogeny Neighbor joining Maximum parsimony Maximum likelihood Rooting trees and measuring confidence Software and file

More information

Sequence Analysis 17: lecture 5. Substitution matrices Multiple sequence alignment

Sequence Analysis 17: lecture 5. Substitution matrices Multiple sequence alignment Sequence Analysis 17: lecture 5 Substitution matrices Multiple sequence alignment Substitution matrices Used to score aligned positions, usually of amino acids. Expressed as the log-likelihood ratio of

More information

Classification, Phylogeny yand Evolutionary History

Classification, Phylogeny yand Evolutionary History Classification, Phylogeny yand Evolutionary History The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize

More information

CHAPTERS 24-25: Evidence for Evolution and Phylogeny

CHAPTERS 24-25: Evidence for Evolution and Phylogeny CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology

More information

Unit 9: Evolution Guided Reading Questions (80 pts total)

Unit 9: Evolution Guided Reading Questions (80 pts total) Name: AP Biology Biology, Campbell and Reece, 7th Edition Adapted from chapter reading guides originally created by Lynn Miriello Unit 9: Evolution Guided Reading Questions (80 pts total) Chapter 22 Descent

More information

Chapter 27: Evolutionary Genetics

Chapter 27: Evolutionary Genetics Chapter 27: Evolutionary Genetics Student Learning Objectives Upon completion of this chapter you should be able to: 1. Understand what the term species means to biology. 2. Recognize the various patterns

More information

Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis

Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis 10 December 2012 - Corrections - Exercise 1 Non-vertebrate chordates generally possess 2 homologs, vertebrates 3 or more gene copies; a Drosophila

More information

Phylogenetic analysis. Characters

Phylogenetic analysis. Characters Typical steps: Phylogenetic analysis Selection of taxa. Selection of characters. Construction of data matrix: character coding. Estimating the best-fitting tree (model) from the data matrix: phylogenetic

More information

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

More information

Phylogenetics: Distance Methods. COMP Spring 2015 Luay Nakhleh, Rice University

Phylogenetics: Distance Methods. COMP Spring 2015 Luay Nakhleh, Rice University Phylogenetics: Distance Methods COMP 571 - Spring 2015 Luay Nakhleh, Rice University Outline Evolutionary models and distance corrections Distance-based methods Evolutionary Models and Distance Correction

More information

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

More information

CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny

CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny To trace phylogeny or the evolutionary history of life, biologists use evidence from paleontology, molecular data, comparative

More information

BIOINFORMATICS. Many-Core Algorithms for Statistical Phylogenetics. Marc A. Suchard 1,2,3 and Andrew Rambaut 4

BIOINFORMATICS. Many-Core Algorithms for Statistical Phylogenetics. Marc A. Suchard 1,2,3 and Andrew Rambaut 4 BIOINFORMATICS Vol. 00 no. 00 XXXX Pages 1 9 Many-Core Algorithms for Statistical Phylogenetics Marc A. Suchard 1,2,3 and Andrew Rambaut 4 1 Department of Biomathematics, 2 Department of Biostatistics

More information

X X (2) X Pr(X = x θ) (3)

X X (2) X Pr(X = x θ) (3) Notes for 848 lecture 6: A ML basis for compatibility and parsimony Notation θ Θ (1) Θ is the space of all possible trees (and model parameters) θ is a point in the parameter space = a particular tree

More information

The Tree of Life. Phylogeny

The Tree of Life. Phylogeny The Tree of Life Phylogeny Phylogenetics Phylogenetic trees illustrate the evolutionary relationships among groups of organisms, or among a family of related nucleic acid or protein sequences Each branch

More information

Module 13: Molecular Phylogenetics

Module 13: Molecular Phylogenetics Module 13: Molecular Phylogenetics http://evolution.gs.washington.edu/sisg/2013/ MTH Thanks to Paul Lewis, Joe Felsenstein, Peter Beerli, Derrick Zwickl, and Joe Bielawski for slides Wednesday July 17:

More information

Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them?

Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them? Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them? Carolus Linneaus:Systema Naturae (1735) Swedish botanist &

More information

Phylogeny. Properties of Trees. Properties of Trees. Trees represent the order of branching only. Phylogeny: Taxon: a unit of classification

Phylogeny. Properties of Trees. Properties of Trees. Trees represent the order of branching only. Phylogeny: Taxon: a unit of classification Multiple sequence alignment global local Evolutionary tree reconstruction Pairwise sequence alignment (global and local) Substitution matrices Gene Finding Protein structure prediction N structure prediction

More information

Many of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks!

Many of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks! Many of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks! Paul has many great tools for teaching phylogenetics at his web site: http://hydrodictyon.eeb.uconn.edu/people/plewis

More information

Phylogeny and the Tree of Life

Phylogeny and the Tree of Life Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from

More information

Phylogenetic Analysis

Phylogenetic Analysis Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)

More information

Phylogenetic Analysis

Phylogenetic Analysis Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)

More information

Phylogenetic Analysis

Phylogenetic Analysis Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)

More information

Module 13: Molecular Phylogenetics

Module 13: Molecular Phylogenetics Module 13: Molecular Phylogenetics Instructors: Joe Felsenstein (University of Washington) Mark Holder (University of Kansas) Jeff Thorne (North Carolina State University) Wednesday July 18: Day I 1:30

More information

Module 12: Molecular Phylogenetics

Module 12: Molecular Phylogenetics Module 12: Molecular Phylogenetics http://evolution.gs.washington.edu/sisg/2014/ MTH Thanks to Paul Lewis, Tracy Heath, Joe Felsenstein, Peter Beerli, Derrick Zwickl, and Joe Bielawski for slides Monday

More information

Reconstructing the history of lineages

Reconstructing the history of lineages Reconstructing the history of lineages Class outline Systematics Phylogenetic systematics Phylogenetic trees and maps Class outline Definitions Systematics Phylogenetic systematics/cladistics Systematics

More information

Intraspecific gene genealogies: trees grafting into networks

Intraspecific gene genealogies: trees grafting into networks Intraspecific gene genealogies: trees grafting into networks by David Posada & Keith A. Crandall Kessy Abarenkov Tartu, 2004 Article describes: Population genetics principles Intraspecific genetic variation

More information

Evolutionary trees. Describe the relationship between objects, e.g. species or genes

Evolutionary trees. Describe the relationship between objects, e.g. species or genes Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between

More information

Reconstructing Evolutionary Trees. Chapter 14

Reconstructing Evolutionary Trees. Chapter 14 Reconstructing Evolutionary Trees Chapter 14 Phylogenetic trees The evolutionary history of a group of species = phylogeny The problem: Evolutionary histories can never truly be known. Once again, we are

More information