Building Phylogenetic Trees UPGMA & NJ
|
|
- Sherilyn Young
- 6 years ago
- Views:
Transcription
1 uilding Phylogenetic Trees UPGM & NJ
2 UPGM UPGM Unweighted Pair-Group Method with rithmetic mean Unweighted = all pairwise distances contribute equally. Pair-Group = groups are combined in pairs. rithmetic mean = pairwise distances to each group (clade) are mean distances to all members of that group. Sokal R &Michener C (1958). statistical method for evaluating systematic relationships. University of Kansas Science ulletin 38:
3 UPGM: Principle UPGM Principle C E C E Find the 2 nodes with the shortest distance (here: C+) Start with unjoined ndoes and a pair-wise distance matrix - C E d, - C d,c d,c - d, d, d C, - E d,e d,e d C,E d,e - Join the 2 nodes Compute the branch lengths (d C,, d C,, d C,E )
4 UPGM: Principle UPGM Principle C E C E Repeat this process iteratively till the whole tree is obtained
5 UPGM: Example C E F G C E F G istance matrix (can be obtained from pair-wise sequence alignments) The following example is from r Richard J. Edwards
6 UPGM: Example C E F G C E F G Find the shortest distance. Here the shortest distance is 1 (between and F) Join the "nodes" (sequences) with the shortest distance: Here we join and F to create node F. epth of the new branch = 1/2 of the shortest distance (so that the node-to-node path length is equal to the shortest distance). Here: d F /2 = F 0.5
7 UPGM: Example F C E F G - F? - C 27? - 8? 26 - E 33? F G 13? Calculate mean pairwise distances with the other nodes (sequences) F C...
8 UPGM: Example F C E F G - F C E F G Calculate mean pairwise distances with the other nodes (sequences) Example d F, = (d, + d F, ) / 2 = ( ) / 2 = 18.5 F C...
9 UPGM: Example F C E G - F C E G Repeat cycle with new shortest distances. Here, the next shortest distance is 8 (between and ). We thus join and with branch length = 8 / 2 = F 0.5
10 UPGM: Example F C E G - F 18 - C E G We join the closest nodes/groups and we recalculate the distances between nodes/groups. Example d F, = (d, + d F, + d, + d F, ) / 4 = = ( ) / 4 = 18 F...
11 UPGM: Example F C E G - F 18 - C E G F G Repeat cycle with new shortest distances. Here, the next shortest distance is 12.5 (between F and G). We thus join F and G with branch length = 12.5 / 2 =
12 UPGM: Example FG C E G - FG C E G The distances between nodes/groups are recalculated.
13 UPGM: Example FG C E - FG C E F G The shortest disance is recalculated, the nodes/groups are joined and the branch length is calculated
14 UPGM: Example FG FG C E FG - FG C E
15 UPGM: Example FG C E FG - C 29 - E F G C
16 UPGM: Example FGC E FGC - E 34 - F G C E
17 UPGM: Example Remark: The source data for this example is a selection of Cytochrome C distances from Table 3 of Fitch & Margoliash (1967) Construction of phylogenetic tree, Science 155: Turtle - Human 19 - C Tuna C Chicken E Moth F Monkey G og Tutle 4 Chick Man 5.75 F Monkey 0.5 G og 6.25 C Tuna E Moth E F G Newick representation: Source: r Richard J. Edwards Slides: Software: 2.5
18 NJ Neighbour Joining (NJ) Neighbours = pair of nodes (sequences, OTUs) who have one node connecting them. Example: C Nodes and are neighbours (connected by only one internal node), and nodes C and are neighbours, whereas nodes and C (for ex.) are not neighbours. Saitou N, Nei M. (1987) The neighbor-joining method: a new method for reconstructing phylogenetic trees. Mol iol Evol. 4:
19 NJ: Principle Neighbour Joining (NJ) How to find neighbours? How to construct the tree? Principle: C Find the 2 nodes with the shortest distance (here: C+) Create an internal node (C) C C Compute the branch lengths (d C,C,d,C,d,C,...) E E Start with a "star" tree and a distance matrix dditive principle: d C, = d C,C + d,c
20 NJ: Principle Neighbour Joining (NJ) How to find neighbours? How to construct the tree? Principle: C Repeat this process iteratively till the whole tree is obtained C E E
21 NJ: Principle Neighbour Joining (NJ) How to find neighbours? How to construct the tree? Principle: C Repeat this process iteratively till the whole tree is obtained C E C E - d, - C d,c d,c - d, d, d C, - E d,e d,e d C,E d,e - E The distance between two nodes = distance given in the initial distance matrix
22 NJ: Principle Neighbour Joining (NJ) How to find neighbours? How to construct the tree? Theory: Saitou N, Nei M. (1987) The neighbor-joining method: a new method for reconstructing phylogenetic trees. Mol iol Evol. 4: Zvelebil & aum (2008) Terry Speed, lecture notes The Saitou-Nei algorithm is a good approximation of the exact method and run faster. It is illustrated on an example hereafter.
23 NJ: Example C E C E istance matrix The following example is from Prof. Tore Samuelsson (2012) Genomics and ioinformatics - n introduction to Programming Tools for Life Scientists (Chap. 9)
24 NJ: Example C E C E We start by calculating the S x value defined by the sum of all the distances to node X: S x = d X,i Here, we have: N! i=1 S = d, + d,c + d, + d,e = = 64 S = = 60 S C = = 61 S = = 73 S E = = 96
25 NJ: Example - C E 11 - C E We then calculate a δ matrix where δ ij = d ij - (S i + S j ) / (N-2) Here, we have: δ, = d, - (S + S ) / (N-2) = 11 - ( ) / 3 = S,C = 12 - ( ) / 3 = S, = 17 - ( ) / 3 =
26 NJ: Example C E C E δ matrix The number in this matrix reflect the relative total branch length of trees where the nodes i and j have been joined as neighbours.
27 NJ: Example C E C E δ matrix The number in this matrix reflect the relative total branch length of trees where the nodes i and j have been joins as neighbours. s we prefer the tree with the smallest total branch length we identify the minimum value, which in this case is δ,e = Thus and E are the first nodes to be joined, to form a new node E.
28 NJ: Example C E C E δ matrix The distance d,e and d E,E are calulated as d,e = (d,e +(S -S E )/(N-2))/2 = (24+(73-96)/3) /2 = 8.2 d E,E = d,e - d,e = 15.8 These distances are used to build the tree: C 8.2 E 15.8 E
29 NJ: Example C E C E New distance matrix The distances to the new node E are calulated as d,e = (d, + d E, - d,e ) / 2 = ( ) / 2 = 8.5 d,e = (d, + d E, - d,e ) / 2 = ( ) / 2 = 8 d C,E = (d,c + d E,C - d,e ) / 2 = ( ) / 2 = 8
30 NJ: Example C E C E New δ matrix We repeat the operation. Note that here there are two minimum values. We have selected nodes and C (to form node C) but the same final tree is obtained if we choose and E.
31 NJ: Example C E C E New δ matrix The branch lengths are given by: d,c = (d,c + (S -S C ) / (N-2) ) / 2 = (9+(60-61)/2) / 2 = 4.25 d C,C = d,c - d,c = = 4.75 and the tree becomes: 4.25 C E 8.2 C E
32 NJ: Example C E - C 7 - E New distance matrix The distances to the new node E are calulated as d,c = (d, + d C, - d,c ) / 2 = ( ) / 2 = 7 d E,C = (d,e + d C,E - d,c ) / 2 = (8+8-9) / 2 = 3.5
33 NJ: Example C E - C E New δ matrix The branch lengths are given by: d C,C = 1 d,c = 6 and the tree becomes: C C 1 C 6 E E
34 NJ: Example C - C E New distance matrix E Final tree 4.25 C C E 8.2 C E
35 NJ: Example C E Check C E d C, (distance matrix) = 16 d C, (tree) = = C C E 8.2 C E
36 References
Phylogenetic trees 07/10/13
Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share
More informationTheory of Evolution. Charles Darwin
Theory of Evolution harles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (8-6) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
More informationBioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony
ioinformatics -- lecture 9 Phylogenetic trees istance-based tree building Parsimony (,(,(,))) rees can be represented in "parenthesis notation". Each set of parentheses represents a branch-point (bifurcation),
More informationBINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
More informationCS5263 Bioinformatics. Guest Lecture Part II Phylogenetics
CS5263 Bioinformatics Guest Lecture Part II Phylogenetics Up to now we have focused on finding similarities, now we start focusing on differences (dissimilarities leading to distance measures). Identifying
More informationTree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
More informationPhylogenetics: Distance Methods. COMP Spring 2015 Luay Nakhleh, Rice University
Phylogenetics: Distance Methods COMP 571 - Spring 2015 Luay Nakhleh, Rice University Outline Evolutionary models and distance corrections Distance-based methods Evolutionary Models and Distance Correction
More informationDNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi
DNA Phylogeny Signals and Systems in Biology Kushal Shah @ EE, IIT Delhi Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics :
More informationEvolutionary Tree Analysis. Overview
CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based
More informationWeek 5: Distance methods, DNA and protein models
Week 5: Distance methods, DNA and protein models Genome 570 February, 2016 Week 5: Distance methods, DNA and protein models p.1/69 A tree and the expected distances it predicts E A 0.08 0.05 0.06 0.03
More informationPhylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
More informationConsistency Index (CI)
Consistency Index (CI) minimum number of changes divided by the number required on the tree. CI=1 if there is no homoplasy negatively correlated with the number of species sampled Retention Index (RI)
More informationCSCI1950 Z Computa4onal Methods for Biology Lecture 5
CSCI1950 Z Computa4onal Methods for Biology Lecture 5 Ben Raphael February 6, 2009 hip://cs.brown.edu/courses/csci1950 z/ Alignment vs. Distance Matrix Mouse: ACAGTGACGCCACACACGT Gorilla: CCTGCGACGTAACAAACGC
More informationSeuqence Analysis '17--lecture 10. Trees types of trees Newick notation UPGMA Fitch Margoliash Distance vs Parsimony
Seuqence nalysis '17--lecture 10 Trees types of trees Newick notation UPGM Fitch Margoliash istance vs Parsimony Phyogenetic trees What is a phylogenetic tree? model of evolutionary relationships -- common
More informationConstructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
More informationPhylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
More information9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
More informationBioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics
Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods
More informationInDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
More informationEVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
More informationPhylogeny: traditional and Bayesian approaches
Phylogeny: traditional and Bayesian approaches 5-Feb-2014 DEKM book Notes from Dr. B. John Holder and Lewis, Nature Reviews Genetics 4, 275-284, 2003 1 Phylogeny A graph depicting the ancestor-descendent
More informationPhylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
More informationPhylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
More informationLetter to the Editor. Department of Biology, Arizona State University
Letter to the Editor Traditional Phylogenetic Reconstruction Methods Reconstruct Shallow and Deep Evolutionary Relationships Equally Well Michael S. Rosenberg and Sudhir Kumar Department of Biology, Arizona
More informationUnderstanding phylogenies: Constructing and interpreting phylogenetic trees
SCIENCE EDUCATION Understanding phylogenies: Constructing and interpreting phylogenetic trees Joseph L. Staton 1 1 University of South Carolina Beaufort Interpretation of phylogenetic trees is fundamental
More informationBioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
More informationCREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
More informationTheory of Evolution Charles Darwin
Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
More informationCS5238 Combinatorial methods in bioinformatics 2003/2004 Semester 1. Lecture 8: Phylogenetic Tree Reconstruction: Distance Based - October 10, 2003
CS5238 Combinatorial methods in bioinformatics 2003/2004 Semester 1 Lecture 8: Phylogenetic Tree Reconstruction: Distance Based - October 10, 2003 Lecturer: Wing-Kin Sung Scribe: Ning K., Shan T., Xiang
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationPROTEIN PHYLOGENETIC INFERENCE USING MAXIMUM LIKELIHOOD WITH A GENETIC ALGORITHM
512 PROTEN PHYLOGENETC NFERENCE USNG MXMUM LKELHOOD WTH GENETC LGORTHM H. MTSUD Department of nformation and Computer Sciences, Faculty of Engineering Science, Osaka University 1-3 Machikaneyama, Toyonaka,
More informationAlgorithmic Methods Well-defined methodology Tree reconstruction those that are well-defined enough to be carried out by a computer. Felsenstein 2004,
Tracing the Evolution of Numerical Phylogenetics: History, Philosophy, and Significance Adam W. Ferguson Phylogenetic Systematics 26 January 2009 Inferring Phylogenies Historical endeavor Darwin- 1837
More informationB (a) n = 3 B D C. (b) n = 4
onstruction of Phylogenetic Trees from mino cid Sequences using a Genetic lgorithm Hideo Matsuda matsuda@ics.es.osaka-u.ac.jp epartment of Information and omputer Sciences, Faculty of Engineering Science,
More informationPOPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
More informationThe least-squares approach to phylogenetics was first suggested
Combinatorics of least-squares trees Radu Mihaescu and Lior Pachter Departments of Mathematics and Computer Science, University of California, Berkeley, CA 94704; Edited by Peter J. Bickel, University
More informationPhylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
More informationAN ALTERNATING LEAST SQUARES APPROACH TO INFERRING PHYLOGENIES FROM PAIRWISE DISTANCES
Syst. Biol. 46(l):11-lll / 1997 AN ALTERNATING LEAST SQUARES APPROACH TO INFERRING PHYLOGENIES FROM PAIRWISE DISTANCES JOSEPH FELSENSTEIN Department of Genetics, University of Washington, Box 35736, Seattle,
More informationON THE UNIQUENESS OF BALANCED MINIMUM EVOLUTION
ON THE UNIQUENESS OF LNE MINIMUM EVOLUTION RON KLEINMN ecember 3, 20 bstract. Minimum evolution is a class of parsimonious distance-based phylogenetic reconstruction methods. One noteworthy example is
More informationEstimating Phylogenies (Evolutionary Trees) II. Biol4230 Thurs, March 2, 2017 Bill Pearson Jordan 6-057
Estimating Phylogenies (Evolutionary Trees) II Biol4230 Thurs, March 2, 2017 Bill Pearson wrp@virginia.edu 4-2818 Jordan 6-057 Tree estimation strategies: Parsimony?no model, simply count minimum number
More informationPlan: Evolutionary trees, characters. Perfect phylogeny Methods: NJ, parsimony, max likelihood, Quartet method
Phylogeny 1 Plan: Phylogeny is an important subject. We have 2.5 hours. So I will teach all the concepts via one example of a chain letter evolution. The concepts we will discuss include: Evolutionary
More informationPhylogenetics Todd Vision Spring Some applications. Uncultured microbial diversity
Phylogenetics Todd Vision Spring 2008 Tree basics Sequence alignment Inferring a phylogeny Neighbor joining Maximum parsimony Maximum likelihood Rooting trees and measuring confidence Software and file
More informationMolecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
More informationEvolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between
More informationPage 1. Evolutionary Trees. Why build evolutionary tree? Outline
Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny
More informationCopyright notice. Molecular Phylogeny and Evolution. Goals of the lecture. Introduction. Introduction. December 15, 2008
opyright notice Molecular Phylogeny and volution ecember 5, 008 ioinformatics J. Pevsner pevsner@kennedykrieger.org Many of the images in this powerpoint presentation are from ioinformatics and Functional
More informationAmira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
More informationMolecular Evolution and Phylogenetic Tree Reconstruction
1 4 Molecular Evolution and Phylogenetic Tree Reconstruction 3 2 5 1 4 2 3 5 Orthology, Paralogy, Inparalogs, Outparalogs Phylogenetic Trees Nodes: species Edges: time of independent evolution Edge length
More informationMolecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
More informationEvolutionary Trees. Evolutionary tree. To describe the evolutionary relationship among species A 3 A 2 A 4. R.C.T. Lee and Chin Lung Lu
Evolutionary Trees R.C.T. Lee and Chin Lung Lu CS 5313 Algorithms for Molecular Biology Evolutionary Trees p.1 Evolutionary tree To describe the evolutionary relationship among species Root A 3 Bifurcating
More information"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
More informationApplication of new distance matrix to phylogenetic tree construction
Application of new distance matrix to phylogenetic tree construction P.V.Lakshmi Computer Science & Engg Dept GITAM Institute of Technology GITAM University Andhra Pradesh India Allam Appa Rao Jawaharlal
More informationA (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
More informationPhylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
More informationDr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
More informationNJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees Erin Molloy and Tandy Warnow {emolloy2, warnow}@illinois.edu University of Illinois at Urbana
More informationMinimum evolution using ordinary least-squares is less robust than neighbor-joining
Minimum evolution using ordinary least-squares is less robust than neighbor-joining Stephen J. Willson Department of Mathematics Iowa State University Ames, IA 50011 USA email: swillson@iastate.edu November
More informationVariances of the Average Numbers of Nucleotide Substitutions Within and Between Populations
Variances of the Average Numbers of Nucleotide Substitutions Within and Between Populations Masatoshi Nei and Li Jin Center for Demographic and Population Genetics, Graduate School of Biomedical Sciences,
More informationChapter 3: Phylogenetics
Chapter 3: Phylogenetics 3. Computing Phylogeny Prof. Yechiam Yemini (YY) Computer Science epartment Columbia niversity Overview Computing trees istance-based techniques Maximal Parsimony (MP) techniques
More informationA Comparative Analysis of Popular Phylogenetic. Reconstruction Algorithms
A Comparative Analysis of Popular Phylogenetic Reconstruction Algorithms Evan Albright, Jack Hessel, Nao Hiranuma, Cody Wang, and Sherri Goings Department of Computer Science Carleton College MN, 55057
More informationSequence Analysis '17- lecture 8. Multiple sequence alignment
Sequence Analysis '17- lecture 8 Multiple sequence alignment Ex5 explanation How many random database search scores have e-values 10? (Answer: 10!) Why? e-value of x = m*p(s x), where m is the database
More informationWhat is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
More informationAgricultural University
, April 2011 p : 8-16 ISSN : 0853-811 Vol16 No.1 PERFORMANCE COMPARISON BETWEEN KIMURA 2-PARAMETERS AND JUKES-CANTOR MODEL IN CONSTRUCTING PHYLOGENETIC TREE OF NEIGHBOUR JOINING Hendra Prasetya 1, Asep
More informationPhylogeny Tree Algorithms
Phylogeny Tree lgorithms Jianlin heng, PhD School of Electrical Engineering and omputer Science University of entral Florida 2006 Free for academic use. opyright @ Jianlin heng & original sources for some
More informationELE4120 Bioinformatics Tutorial 8
ELE4120 ioinformatics Tutorial 8 ontent lassifying Organisms Systematics and Speciation Taxonomy and phylogenetics Phenetics versus cladistics Phylogenetic trees iological classification Goal: To develop
More informationEvolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies Anatomical features were the dominant
More informationOn the Uniqueness of the Selection Criterion in Neighbor-Joining
Journal of Classification 22:3-15 (2005) DOI: 10.1007/s00357-005-0003-x On the Uniqueness of the Selection Criterion in Neighbor-Joining David Bryant McGill University, Montreal Abstract: The Neighbor-Joining
More informationPhylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying
More informationTHEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
More informationPhylogenetic inference: from sequences to trees
W ESTFÄLISCHE W ESTFÄLISCHE W ILHELMS -U NIVERSITÄT NIVERSITÄT WILHELMS-U ÜNSTER MM ÜNSTER VOLUTIONARY FUNCTIONAL UNCTIONAL GENOMICS ENOMICS EVOLUTIONARY Bioinformatics 1 Phylogenetic inference: from sequences
More informationIncremental Phylogenetics by Repeated Insertions: An Evolutionary Tree Algorithm
Incremental Phylogenetics by Repeated Insertions: An Evolutionary Tree Algorithm Peter Z. Revesz, Zhiqiang Li Abstract We introduce the idea of constructing hypothetical evolutionary trees using an incremental
More informationPhylogeny. November 7, 2017
Phylogeny November 7, 2017 Phylogenetics Phylon = tribe/race, genetikos = relative to birth Phylogenetics: study of evolutionary relationships among organisms, sequences, or anything in between Related
More informationWeighted Neighbor Joining: A Likelihood-Based Approach to Distance-Based Phylogeny Reconstruction
Weighted Neighbor Joining: A Likelihood-Based Approach to Distance-Based Phylogeny Reconstruction William J. Bruno,* Nicholas D. Socci, and Aaron L. Halpern *Theoretical Biology and Biophysics, Los Alamos
More informationInferring phylogeny. Today s topics. Milestones of molecular evolution studies Contributions to molecular evolution
Today s topics Inferring phylogeny Introduction! Distance methods! Parsimony method!"#$%&'(!)* +,-.'/01!23454(6!7!2845*0&4'9#6!:&454(6 ;?@AB=C?DEF Overview of phylogenetic inferences Methodology Methods
More informationPhylogenetic Analysis and Intraspeci c Variation : Performance of Parsimony, Likelihood, and Distance Methods
Syst. Biol. 47(2): 228± 23, 1998 Phylogenetic Analysis and Intraspeci c Variation : Performance of Parsimony, Likelihood, and Distance Methods JOHN J. WIENS1 AND MARIA R. SERVEDIO2 1Section of Amphibians
More informationExample questions. Z:\summer_10_teaching\bioinfo\Beispiel_frage_bioinformatik.doc [1 / 5]
Example questions for Bioinformatics, first semester half Sommersemester 00 ote The schriftliche Klausur wurde auf deutsch geschrieben The questions will be based on material from the Übungen and the Lectures.
More informationmolecular evolution and phylogenetics
molecular evolution and phylogenetics Charlotte Darby Computational Genomics: Applied Comparative Genomics 2.13.18 https://www.thinglink.com/scene/762084640000311296 Internal node Root TIME Branch Leaves
More informationCSCI1950 Z Computa4onal Methods for Biology Lecture 4. Ben Raphael February 2, hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary
CSCI1950 Z Computa4onal Methods for Biology Lecture 4 Ben Raphael February 2, 2009 hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary Parsimony Probabilis4c Method Input Output Sankoff s & Fitch
More informationLecture 8 Multiple Alignment and Phylogeny
Introduction to Bioinformatics for Medical Research Gideon Greenspan gdg@cs.technion.ac.il Lecture 8 Multiple Alignment and Phylogeny Multiple Alignment & Phylogeny Multiple Alignment Scoring Complexity
More informationPhylogenetic Trees. How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species?
Why? Phylogenetic Trees How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species? The saying Don t judge a book by its cover. could be applied
More informationMichael Yaffe Lecture #5 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D
7.91 Lecture #5 Database Searching & Molecular Phylogenetics Michael Yaffe B C D B C D (((,B)C)D) Outline Distance Matrix Methods Neighbor-Joining Method and Related Neighbor Methods Maximum Likelihood
More informationSupplementary Information
Supplementary Information For the article"comparable system-level organization of Archaea and ukaryotes" by J. Podani, Z. N. Oltvai, H. Jeong, B. Tombor, A.-L. Barabási, and. Szathmáry (reference numbers
More informationInferring Phylogenetic Trees. Distance Approaches. Representing distances. in rooted and unrooted trees. The distance approach to phylogenies
Inferring Phylogenetic Trees Distance Approaches Representing distances in rooted and unrooted trees The distance approach to phylogenies given: an n n matrix M where M ij is the distance between taxa
More informationLecture 14: Multiple Sequence Alignment (Gene Finding, Conserved Elements) Scribe: John Ekins
Lecture 14: Multiple Sequence Alignment (Gene Finding, Conserved Elements) 2 19 2015 Scribe: John Ekins Multiple Sequence Alignment Given N sequences x 1, x 2,, x N : Insert gaps in each of the sequences
More informationHow to read and make phylogenetic trees Zuzana Starostová
How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation
More informationPhylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
More informationNature Biotechnology: doi: /nbt Supplementary Figure 1. Detailed overview of the primer-free full-length SSU rrna library preparation.
Supplementary Figure 1 Detailed overview of the primer-free full-length SSU rrna library preparation. Detailed overview of the primer-free full-length SSU rrna library preparation. Supplementary Figure
More informationarxiv: v1 [q-bio.pe] 3 May 2016
PHYLOGENETIC TREES AND EUCLIDEAN EMBEDDINGS MARK LAYER AND JOHN A. RHODES arxiv:1605.01039v1 [q-bio.pe] 3 May 2016 Abstract. It was recently observed by de Vienne et al. that a simple square root transformation
More informationPhylogeny Jan 5, 2016
גנומיקה חישובית Computational Genomics Phylogeny Jan 5, 2016 Slides: Adi Akavia Nir Friedman s slides at HUJI (based on ALGMB 98) Anders Gorm Pedersen,Technical University of Denmark Sources: Joe Felsenstein
More informationThe Generalized Neighbor Joining method
The Generalized Neighbor Joining method Ruriko Yoshida Dept. of Mathematics Duke University Joint work with Dan Levy and Lior Pachter www.math.duke.edu/ ruriko data mining 1 Challenge We would like to
More informationMultiple Sequence Alignment (MAS)
Multiple Sequence lignment (MS) Group-to-group alignments Steven driaensen & Ken Tanaka References Osamu Goto Optimal lignment between groups of sequences and its application to multiple sequence alignment
More informationNearest Neighbor Search with Keywords
Nearest Neighbor Search with Keywords Yufei Tao KAIST June 3, 2013 In recent years, many search engines have started to support queries that combine keyword search with geography-related predicates (e.g.,
More informationReconstructing Trees from Subtree Weights
Reconstructing Trees from Subtree Weights Lior Pachter David E Speyer October 7, 2003 Abstract The tree-metric theorem provides a necessary and sufficient condition for a dissimilarity matrix to be a tree
More informationPhylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
More informationUsing Phylogenomics to Predict Novel Fungal Pathogenicity Genes
Using Phylogenomics to Predict Novel Fungal Pathogenicity Genes David DeCaprio, Ying Li, Hung Nguyen (sequenced Ascomycetes genomes courtesy of the Broad Institute) Phylogenomics Combining whole genome
More informationPhylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
More informationMaximum Likelihood Estimation on Large Phylogenies and Analysis of Adaptive Evolution in Human Influenza Virus A
J Mol Evol (2000) 51:423 432 DOI: 10.1007/s002390010105 Springer-Verlag New York Inc. 2000 Maximum Likelihood Estimation on Large Phylogenies and Analysis of Adaptive Evolution in Human Influenza Virus
More informationMultiple Whole Genome Alignment
Multiple Whole Genome Alignment BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 206 Anthony Gitter gitter@biostat.wisc.edu These slides, excluding third-party material, are licensed under CC BY-NC 4.0 by
More informationOMICS Journals are welcoming Submissions
OMICS Journals are welcoming Submissions OMICS International welcomes submissions that are original and technically so as to serve both the developing world and developed countries in the best possible
More informationPart III: Traveling salesman problems
Transportation Logistics Part III: Traveling salesman problems c R.F. Hartl, S.N. Parragh 1/282 Motivation Motivation Why do we study the TSP? c R.F. Hartl, S.N. Parragh 2/282 Motivation Motivation Why
More information