SUPPLEMENTARY INFORMATION

Size: px
Start display at page:

Download "SUPPLEMENTARY INFORMATION"

Transcription

1 doi: /nature11419 Supplementary Figure 1 Schematic representation of innate immune signaling pathways induced by intracellular Salmonella in cultured macrophages. a, During the infection Salmonella LPS activates TLR4, thus inducing pro-il-1" expression via MyD88 and contributing to pro-caspase-11 expression via both signaling adaptors. In addition, a non-tlr dependent pathway contributes to pro-caspase-11 induction (grey arrows). b, Trif also activates IRF3 and initiates the production of type-i-interferon. Paracrine and/or autocrine signaling by IFN-" through the type-i-ifn receptor (IFN#R) results in the expression of a interferon-inducible activator of caspase-11, which is required for the assembly or activity of non-canonical inflammasomes. c, Salmonella establishes itself in its intracellular niche, a vacuolar compartment called Salmonella Containing Vacuole (SCV), requiring the expression and activity of the T3SS encoded by the S. Typhimurium Pathogenicity Island 2 (SPI-2). Intracellular Salmonella subsequently activate a multitude of inflammasomes: Flagellin secreted by the SPI-2 T3SS activates NLRC4 and induces caspase-1-dependent pyroptosis and cytokine maturation. Intracellular Salmonella also induce non-canonical cell death via caspase-11, which requires the expression of an interferon-inducible activator (b). Caspase-11 also triggers the activation of a canonical NLRP3-dependent signaling pathway leading to cytokine maturation. 1

2 RESEARCH Supplementary Figure 2 Intracellular S. Typhimurium induces cell death through caspase-11 and the NLRC4-caspase-1 axis. a, b, IL-1" secretion, LDH release and immunoblots for processed caspase-1, caspase-11 and IL-1 " released from unprimed BMDMs infected with wild-type (wt) S. Typhimurium, SPI-2-deficient (#SPI-2) or flagellin-deficient (#flag) strains grown to stationary phase for 17 h. c, d, LDH release at 17 h or during timecourse (0-16 h) from unprimed BMDMs infected with the indicated strains. Graphs show the mean ± s.d. of quadruplicate wells and are representative of three (a, b) and two (c, d) independent experiments. $ P < 0.01 as compared to WT macrophages. 2

3 RESEARCH Supplementary Figure 3 Cell death and cytokine release require live S. Typhimurium. Unprimed primary WT bone-marrow derived macrophages were infected with untreated or heat-killed (HK), UV-killed (UVK), Paraformaldehyde-treated (PFAK) or 70% Ethanol treated (EK) S. Typhimurium (grown to stationary phase) for 17 hours. IL-1" release (± s.d.) was measured by ELISA. Cell death (± s.d.) was determined by LDH release. Data shown are representative of three independent experiments. 3

4 RESEARCH Supplementary Figure 4 Activity of the NLRP3 inflammasome triggered by S. Typhimurium infection requires both caspase-1 and caspase-11. Unprimed primary bone-marrow derived macrophages were infected with the indicated S. Typhimurium strains for 17 h. IL-1" release (± s.d.) was measured by ELISA. Immunoblotting was used to measure pro- and cleaved forms of caspase-1, caspase-11, IL-1" and IL-18 in the culture supernatant and cell lysates. Loading was controlled by blotting for "-actin. Data shown are representative of at least two independent experiments. 4

5 RESEARCH Supplementary Figure 5 Assembly of ASC foci by NLRP3 requires preceding caspase-11 activation. a, Fluorescence microscopy of primary murine macrophages from the indicated genotypes, infected with S. Typhimurium "SPI-2 for 17 h. Cells were stained for ASC, Caspase-1 and DNA (with DAPI). Arrowhead point to ASC foci. b, Percentage of ASC foci in (a). Images (original magnification, 63) and quantification are a representative of three independent experiments with a mean of 100 ASC foci counted in each experiment. Error bars represent the mean SD of triplicate experiments. Scale bars, 10 µm. 5

6 RESEARCH Supplementary Figure 6 Pro-caspase-11 protein levels in different knockout macrophages at selected timepoints or during timecourse. a, c, Unprimed primary bone-marrow derived macrophages were infected with S. Typhimurium "flag mutant for 8, 12 and/or 16 hours. b, Induction of pro-caspase-11 and pro-il-1# expression by immunoblot in unprimed BMDMs infected with "flag S. Typhimurium. Immunoblotting was used to measure pro-forms of caspase-11 and IL-1# in cell lysates. Loading was controlled by blotting for pro-caspase-1 and #-actin. Graphs show the mean ± s.d. of quadruplicate wells and are representative of two independent experiments. 6

7 RESEARCH Supplementary Figure 7 Exogenous IFN- restores caspase-11 activation in MyD88 -/- /Trif -/- macrophages. Caspase-11 and caspase-1 processing were examined in unprimed macrophages infected with S. Typhimurium "flag for 17 hours. Cells were left untreated or treated with the indicated amount of recombinant murine IFN-# at 2 hours post-infection for the remainder of the experiment. Immunoblotting was used to measure pro- and cleaved forms of caspase-1, caspase-11 in the culture supernatant and cell lysates. Supplementary Figure 8 Bacterial burden in Nlrp3 -/- /Nlrc4 -/- mice phenocopies Casp-1 -/- mice. WT, Casp-1 -/- /Casp-11 -/-, Nlrp3 -/- /Nlrc4 -/- mice were infected orally with 2.5x10 7 wild-type S. Typhimurium for 5 days. Bacterial counts were determined by plating serial dilutions. Graphs show ± s.e.m of 6-10 mice per genotype and are representative of three independent experiments. ", P < Dashed line: detection limit. 7

8 RESEARCH Supplementary Figure 9 Immunofluorescence analysis of tissue sections from mice of different genotypes infected with S. Typhimurium. WT, Casp-11 -/-, Casp-1 -/- /Casp-11 -/- and Casp-1 -/- (Casp-1 -/- /Casp-11 tg ) mice were infected orally with 1x10 8 wild-type S. Typhimurium for 4 days. a, Immunostaining of liver tissue sections, stained with a Salmonella-specific antibody (green) and for Phalloidin (actin, red) to visualize cell bodies. Images were taken at 20x original magnification. Scale bars are 30 µm. Stars indicate extracellular Salmonella filling sinusoids. b, Close-up views of boxed areas in (a) taken at 63x original magnification. 8

9 RESEARCH Supplementary Figure 10 Extracellular Salmonella in Casp-1-/- mice. a, Histopathology of livers from Casp-1-/- (Casp-1-/-/Casp-11tg) mice infected with 1x108 wild-type S. Typhimurium for 4 days. Tissue sections stained with H&E or Gram stain. Original magnification 10x (overview) or 100x (close-up of boxed areas). Stars indicate mats of extracellular bacteria, arrowheads point out single S. Typhimurium bacteria, arrows indicate the border of large necrotic areas surrounding typhoid nodules. b, In vivo gentamicin protection assay. Comparison of bacterial burden in the spleen of WT, Casp1-/-/Casp-11-/-, Casp-1-/- (Casp-1-/-/Casp-11tg) and Casp-11-/- mice treated with gentamicin or a vehicle control. Animals were infected orally with 1x108 wild-type S. Typhimurium for 4 days and injected intra-peritoneally with 1 mg gentamicin at 48 h, 24 h and 12 h before euthanizing. Bacterial numbers in the spleen were determined by plating serial dilutions. Circles indicate control animals, boxes gentamicin treated animals. Statistical significance was determined using the unpaired Mann-Whitney U test. ", P < Dashed lines represent the detection limit of the CFU counts. W W W. N A T U R E. C O M / N A T U R E 9

Supplementary Figure 1. AnnexinV FITC and Sytox orange staining in wild type, Nlrp3 /, ASC / and casp1/11 / TEC treated with TNF /CHX.

Supplementary Figure 1. AnnexinV FITC and Sytox orange staining in wild type, Nlrp3 /, ASC / and casp1/11 / TEC treated with TNF /CHX. Supplementary Figure 1. AnnexinV FITC and Sytox orange staining in wild type, Nlrp3 /, ASC / and casp1/11 / TEC treated with TNF /CHX. Phase contrast and widefield fluorescence microscopy (20x magnification).

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION GP2 Type I-piliated bacteria FAE M cell M cell pocket idc T cell mdc Generation of antigenspecific T cells Induction of antigen-specific mucosal immune response Supplementary Figure 1 Schematic diagram

More information

Actin polymerization as a novel innate immune effector mechanism to control Salmonella infection

Actin polymerization as a novel innate immune effector mechanism to control Salmonella infection Actin polymerization as a novel innate immune effector mechanism to control Salmonella infection Si Ming Man 1, Andrew E. Ekpenyong 2,3, Panagiotis Tourlomousis 1, Sarra Achouri 2, Eugenia Cammarota 2,

More information

Biology of Salmonella David Holden

Biology of Salmonella David Holden Biology of Salmonella David Holden Lecture 2 life on the inside trafficking and phagolysosomal avoidance PhoP/Q and the SPI-2 T3SS control of SPI-2 effector translocation effector function analysis at

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2362 Figure S1 CYLD and CASPASE 8 genes are co-regulated. Analysis of gene expression across 79 tissues was carried out as described previously [Ref: PMID: 18636086]. Briefly, microarray

More information

Actinobacteria Relative abundance (%) Co-housed CD300f WT. CD300f KO. Colon length (cm) Day 9. Microscopic inflammation score

Actinobacteria Relative abundance (%) Co-housed CD300f WT. CD300f KO. Colon length (cm) Day 9. Microscopic inflammation score y groups y individuals 9 Actinobacteria Relative abundance (%) acteroidetes Cyanobacteria Deferribacteres Firmicutes Proteobacteria TM Tenericutes Unclassified CDf CDf Co-housed CDf Co-housed CDf CDf CDf

More information

DOI: 10.1038/ncb2819 Gαi3 / Actin / Acetylated Tubulin Gαi3 / Actin / Acetylated Tubulin a a Gαi3 a Actin Gαi3 WT Gαi3 WT Gαi3 WT b b Gαi3 b Actin Gαi3 KO Gαi3 KO Gαi3 KO # # Figure S1 Loss of protein

More information

FSC-W FSC-H CD4 CD62-L

FSC-W FSC-H CD4 CD62-L Supplementary Fig. 1 a SSC-A FSC-A FSC-W FSC-H SSC-W SSC-H CD4 CD62-L b SSC-A FSC-A FSC-W FSC-A FSC-A 7-AAD FSC-A CD4 IL-9 CD4 c SSC-A FSC-A FSC-W FSC-H SSC-W SSC-H 7-AAD KI67 Annexin-V 7-AAD d I L -5

More information

Supporting Information

Supporting Information Supporting Information Cao et al. 10.1073/pnas.1306220110 Gram - bacteria Hemolymph Cytoplasm PGRP-LC TAK1 signalosome Imd dfadd Dredd Dnr1 Ikk signalosome P Relish Nucleus AMP and effector genes Fig.

More information

Supplementary Figure 1. Markedly decreased numbers of marginal zone B cells in DOCK8 mutant mice Supplementary Figure 2.

Supplementary Figure 1. Markedly decreased numbers of marginal zone B cells in DOCK8 mutant mice Supplementary Figure 2. Supplementary Figure 1. Markedly decreased numbers of marginal zone B cells in DOCK8 mutant mice. Percentage of marginal zone B cells in the spleen of wild-type mice (+/+), mice homozygous for cpm or pri

More information

Salmonella Promotes ASC Oligomerization-dependent Caspase-1 Activation

Salmonella Promotes ASC Oligomerization-dependent Caspase-1 Activation http://dx.doi.org/10.4110/in.2012.12.6.284 pissn 1598-2629 eissn 2092-6685 BRIEF COMMUNICATION Salmonella Promotes ASC Oligomerization-dependent Caspase-1 Activation Inhwa Hwang 1,2, Sangjun Park 1,2,

More information

TNFα 18hr. Control. CHX 18hr. TNFα+ CHX 18hr. TNFα: 18 18hr (KDa) PARP. Cleaved. Cleaved. Cleaved. Caspase3. Pellino3 shrna. Control shrna.

TNFα 18hr. Control. CHX 18hr. TNFα+ CHX 18hr. TNFα: 18 18hr (KDa) PARP. Cleaved. Cleaved. Cleaved. Caspase3. Pellino3 shrna. Control shrna. Survival ( %) a. TNFα 18hr b. Control sirna Pellino3 sirna TNFα: 18 18hr c. Control shrna Pellino3 shrna Caspase3 Actin Control d. Control shrna Pellino3 shrna *** 100 80 60 CHX 18hr 40 TNFα+ CHX 18hr

More information

Linear ubiquitination of cytosolic Salmonella Typhimurium activates NF-κB and restricts

Linear ubiquitination of cytosolic Salmonella Typhimurium activates NF-κB and restricts In the format provided by the authors and unedited. SUPPLEMENTARY INFORMATION VOLUME: 2 ARTICLE NUMBER: 17066 Linear ubiquitination of cytosolic Salmonella Typhimurium activates NF-κB and restricts bacterial

More information

Activation of caspase-1 by the NLRP3 inflammasome regulates the NADPH oxidase NOX2 to control phagosome function

Activation of caspase-1 by the NLRP3 inflammasome regulates the NADPH oxidase NOX2 to control phagosome function Activation of caspase-1 by the NLRP3 inflammasome regulates the NADPH oxidase NOX2 to control phagosome function The Harvard community has made this article openly available. Please share how this access

More information

Supplementary Information

Supplementary Information Supplementary Information MAP2/Hoechst Hyp.-AP ph 6.5 Hyp.-SD ph 7.2 Norm.-SD ph 7.2 Supplementary Figure 1. Mitochondrial elongation in cortical neurons by acidosis. Representative images of neuronal

More information

In Macrophages, Caspase-1 Activation by SopE and the Type III Secretion System-1 of S. Typhimurium Can Proceed in the Absence of Flagellin

In Macrophages, Caspase-1 Activation by SopE and the Type III Secretion System-1 of S. Typhimurium Can Proceed in the Absence of Flagellin In Macrophages, Caspase-1 Activation by SopE and the Type III Secretion System-1 of S. Typhimurium Can Proceed in the Absence of Flagellin Claudia Hoffmann 1, Marlies Galle 2,3, Sabrina Dilling 1, Rina

More information

Under the Radar Screen: How Bugs Trick Our Immune Defenses

Under the Radar Screen: How Bugs Trick Our Immune Defenses Under the Radar Screen: How Bugs Trick Our Immune Defenses Session 2: Phagocytosis Marie-Eve Paquet and Gijsbert Grotenbreg Whitehead Institute for Biomedical Research Salmonella Gram negative bacteria

More information

The Salmonella SPI2 Effector SseI Mediates Long-Term Systemic Infection by Modulating Host Cell Migration

The Salmonella SPI2 Effector SseI Mediates Long-Term Systemic Infection by Modulating Host Cell Migration The Salmonella SPI2 Effector SseI Mediates Long-Term Systemic Infection by Modulating Host Cell Migration The Harvard community has made this article openly available. Please share how this access benefits

More information

CELL REPLICATION. Fluorescent light microscopy showing mitosis, especially immunolabelled cytoskeleton and tubulin

CELL REPLICATION. Fluorescent light microscopy showing mitosis, especially immunolabelled cytoskeleton and tubulin CELL REPLICATION Fluorescent light microscopy showing mitosis, especially immunolabelled cytoskeleton and tubulin Cell REPLICATION PROLIFERATION MUTIPLICATION DIVISION CELL REPLICATION Fluorescent light

More information

Novel fluorescent reporters for studying host-pathogen interactions

Novel fluorescent reporters for studying host-pathogen interactions The Essentials of Life Science Research Globally Delivered Novel fluorescent reporters for studying host-pathogen interactions Mariette Barbier, Ph.D.¹, ², Dev Mittar, Ph.D.² ¹University of Virginia, Charlottesville,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature12791 Supplementary Figure 1 (1/3) WWW.NATURE.COM/NATURE 1 RESEARCH SUPPLEMENTARY INFORMATION Supplementary Figure 1 (2/3) 2 WWW.NATURE.COM/NATURE SUPPLEMENTARY

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature09414 Supplementary Figure 1 FACS-isolated 8c hepatocytes are highly pure. a, Gating strategy for identifying hepatocyte populations based on DNA content. b, Detection of mchry and mchr9

More information

Waithe et al Supplementary Figures

Waithe et al Supplementary Figures Waithe et al Supplementary Figures Supplementary Figure 1 Expression and properties of WT and W391A mutant YFP- Ca V 2.2. A Immunoblot using Ca V 2.2 Ab for untransfected cells (UT, lane 1), YFP-Ca V 2.2

More information

ydci GTC TGT TTG AAC GCG GGC GAC TGG GCG CGC AAT TAA CGG TGT GTA GGC TGG AGC TGC TTC

ydci GTC TGT TTG AAC GCG GGC GAC TGG GCG CGC AAT TAA CGG TGT GTA GGC TGG AGC TGC TTC Table S1. DNA primers used in this study. Name ydci P1ydcIkd3 Sequence GTC TGT TTG AAC GCG GGC GAC TGG GCG CGC AAT TAA CGG TGT GTA GGC TGG AGC TGC TTC Kd3ydcIp2 lacz fusion YdcIendP1 YdcItrgP2 GAC AGC

More information

Supplementary Figure 1.

Supplementary Figure 1. Supplementary Figure 1. Characterisation of IHG-1 overexpressing and knockdown cell lines. (A) Total cellular RNA was prepared from HeLa cells stably overexpressing IHG-1 or mts-ihg-1. IHG-1 mrna was quantified

More information

Murein Lipoprotein Is a Critical Outer Membrane Component Involved in Salmonella enterica Serovar Typhimurium Systemic Infection

Murein Lipoprotein Is a Critical Outer Membrane Component Involved in Salmonella enterica Serovar Typhimurium Systemic Infection INFECTION AND IMMUNITY, Feb. 2005, p. 1081 1096 Vol. 73, No. 2 0019-9567/05/$08.00 0 doi:10.1128/iai.73.2.1081 1096.2005 Copyright 2005, American Society for Microbiology. All Rights Reserved. Murein Lipoprotein

More information

FINAL REPORT For Japan-Korea Joint Research Project AREA

FINAL REPORT For Japan-Korea Joint Research Project AREA (Form4-2) FINAL REPORT For Japan-Korea Joint Research Project AREA 1. Mathematics & Physics 2. Chemistry & Material Science 3. Biology 4. Informatics & Mechatronics 5. Geo-Science & Space Science 6. Medical

More information

Shigella flexneri Phagosomal Escape Is Independent of Invasion

Shigella flexneri Phagosomal Escape Is Independent of Invasion INFECTION AND IMMUNITY, Oct. 2007, p. 4826 4830 Vol. 75, No. 10 0019-9567/07/$08.00 0 doi:10.1128/iai.00454-07 Copyright 2007, American Society for Microbiology. All Rights Reserved. Shigella flexneri

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION ARTICLE NUMBER: 16025 DOI: 10.1038/NMICROBIOL.2016.25 Intermediate filaments enable pathogen docking to trigger type 3 effector translocation Brian C. Russo, Luisa M. Stamm, Matthijs Raaben, Caleb M. Kim,

More information

Supplementary Figure 1 Analysis of beige fat and cells and characteristics of exosome release, related to Figure 1

Supplementary Figure 1 Analysis of beige fat and cells and characteristics of exosome release, related to Figure 1 Supplementary Figure 1 Analysis of beige fat and cells and characteristics of exosome release, related to Figure 1 (a) Fold-change in UCP-1 mrna abundance in white adipocytes upon β-adrenergic stimulation

More information

Supplemental material

Supplemental material Supplemental material THE JOURNAL OF CELL BIOLOGY Mourier et al., http://www.jcb.org/cgi/content/full/jcb.201411100/dc1 Figure S1. Size and mitochondrial content in Mfn1 and Mfn2 knockout hearts. (A) Body

More information

Si Ming Man and Thirumala-Devi Kanneganti

Si Ming Man and Thirumala-Devi Kanneganti Converging roles of caspases in inflammasome activation, cell death and innate immunity Si Ming Man and Thirumala-Devi Kanneganti Abstract Inflammatory and apoptotic caspases are central players in inflammation

More information

A Multi-scale Extensive Petri Net Model of Bacterialmacrophage

A Multi-scale Extensive Petri Net Model of Bacterialmacrophage A Multi-scale Extensive Petri Net Model of Bacterialmacrophage Interaction Rafael V. Carvalho Imaging & BioInformatics, Leiden Institute of Advanced Computer Science Introduction - Mycobacterial infection

More information

Nature Neuroscience: doi: /nn.2717

Nature Neuroscience: doi: /nn.2717 Supplementary Fig. 1. Dendrite length is not secondary to body length. Dendrite growth proceeds independently of the rate of body growth and decreases in rate in adults. n 20 on dendrite measurement, n

More information

Transcription of the SsrAB Regulon Is Repressed by Alkaline ph and Is Independent of PhoPQ and Magnesium Concentration

Transcription of the SsrAB Regulon Is Repressed by Alkaline ph and Is Independent of PhoPQ and Magnesium Concentration JOURNAL OF BACTERIOLOGY, Mar. 2002, p. 1493 1497 Vol. 184, No. 5 0021-9193/02/$04.00 0 DOI: 10.1128/JB.184.5.1493 1497.2002 Copyright 2002, American Society for Microbiology. All Rights Reserved. Transcription

More information

Host Transmission of Salmonella enterica Serovar Typhimurium Is Controlled by Virulence Factors and Indigenous Intestinal Microbiota

Host Transmission of Salmonella enterica Serovar Typhimurium Is Controlled by Virulence Factors and Indigenous Intestinal Microbiota INFECTION AND IMMUNITY, Jan. 2008, p. 403 416 Vol. 76, No. 1 0019-9567/08/$08.00 0 doi:10.1128/iai.01189-07 Copyright 2008, American Society for Microbiology. All Rights Reserved. Host Transmission of

More information

Virulent Salmonella enterica Serovar Typhimurium Evades Adaptive Immunity by Preventing Dendritic Cells from Activating T Cells

Virulent Salmonella enterica Serovar Typhimurium Evades Adaptive Immunity by Preventing Dendritic Cells from Activating T Cells INFECTION AND IMMUNITY, Nov. 2006, p. 6438 6448 Vol. 74, No. 11 0019-9567/06/$08.00 0 doi:10.1128/iai.00063-06 Copyright 2006, American Society for Microbiology. All Rights Reserved. Virulent Salmonella

More information

Life in an unusual intracellular niche a bacterial symbiont infecting the nucleus of amoebae

Life in an unusual intracellular niche a bacterial symbiont infecting the nucleus of amoebae Life in an unusual intracellular niche a bacterial symbiont infecting the nucleus of amoebae Frederik Schulz, Ilias Lagkouvardos, Florian Wascher, Karin Aistleitner, Rok Kostanjšek, Matthias Horn Supplementary

More information

The innate immune system recognizes microorganisms via pattern-recognition

The innate immune system recognizes microorganisms via pattern-recognition Pseudomonas aeruginosa activates caspase 1 through Ipaf Edward A. Miao*, Robert K. Ernst, Monica Dors*, Dat P. Mao*, and Alan Aderem* *Institute for Systems Biology, Seattle, WA 98103; and Department of

More information

Toll-Like Receptor 5-Deficient Mice Have Dysregulated Intestinal Gene Expression and Nonspecific Resistance to Salmonella-Induced Typhoid-Like Disease

Toll-Like Receptor 5-Deficient Mice Have Dysregulated Intestinal Gene Expression and Nonspecific Resistance to Salmonella-Induced Typhoid-Like Disease INFECTION AND IMMUNITY, Mar. 2008, p. 1276 1281 Vol. 76, No. 3 0019-9567/08/$08.00 0 doi:10.1128/iai.01491-07 Copyright 2008, American Society for Microbiology. All Rights Reserved. Toll-Like Receptor

More information

Supplementary Figure 1: To test the role of mir-17~92 in orthologous genetic model of ADPKD, we generated Ksp/Cre;Pkd1 F/F (Pkd1-KO) and Ksp/Cre;Pkd1

Supplementary Figure 1: To test the role of mir-17~92 in orthologous genetic model of ADPKD, we generated Ksp/Cre;Pkd1 F/F (Pkd1-KO) and Ksp/Cre;Pkd1 Supplementary Figure 1: To test the role of mir-17~92 in orthologous genetic model of ADPKD, we generated Ksp/Cre;Pkd1 F/F (Pkd1-KO) and Ksp/Cre;Pkd1 F/F ;mir-17~92 F/F (Pkd1-miR-17~92KO) mice. (A) Q-PCR

More information

Edinburgh Research Explorer

Edinburgh Research Explorer Edinburgh Research Explorer Caspase-3-dependent phagocyte death during systemic Salmonella enterica serovar Typhimurium infection of mice Citation for published version: Grant, AJ, Sheppard, M, Deardon,

More information

Role of Mitochondrial Remodeling in Programmed Cell Death in

Role of Mitochondrial Remodeling in Programmed Cell Death in Developmental Cell, Vol. 12 Supplementary Data Role of Mitochondrial Remodeling in Programmed Cell Death in Drosophila melanogaster Gaurav Goyal, Brennan Fell, Apurva Sarin, Richard J. Youle, V. Sriram.

More information

Supplementary Information

Supplementary Information Supplementary Information Supplementary figures % Occupancy 90 80 70 60 50 40 30 20 Wt tol-1(nr2033) Figure S1. Avoidance behavior to S. enterica was not observed in wild-type or tol-1(nr2033) mutant nematodes.

More information

RANK. Alternative names. Discovery. Structure. William J. Boyle* SUMMARY BACKGROUND

RANK. Alternative names. Discovery. Structure. William J. Boyle* SUMMARY BACKGROUND RANK William J. Boyle* Department of Cell Biology, Amgen, Inc., One Amgen Center Drive, Thousand Oaks, CA 91320-1799, USA * corresponding author tel: 805-447-4304, fax: 805-447-1982, e-mail: bboyle@amgen.com

More information

SUPPLEMENTARY FIGURES AND TABLES AND THEIR LEGENDS. Transient infection of the zebrafish notochord triggers chronic inflammation

SUPPLEMENTARY FIGURES AND TABLES AND THEIR LEGENDS. Transient infection of the zebrafish notochord triggers chronic inflammation SUPPLEMENTARY FIGURES AND TABLES AND THEIR LEGENDS Transient infection of the zebrafish notochord triggers chronic inflammation Mai Nguyen-Chi 1,2,5, Quang Tien Phan 1,2,5, Catherine Gonzalez 1,2, Jean-François

More information

Ab1 (57-68) Ab2 ( ) Ab3 ( ) Ab4 ( ) GBP-N domain GBP-C domain CARD domain

Ab1 (57-68) Ab2 ( ) Ab3 ( ) Ab4 ( ) GBP-N domain GBP-C domain CARD domain MDKPVCLIDTGSDGKLCVQQAALQVLQQIQQPVVVVAVVGLYRTGKSFLMNRLAG 55 KRTGFALSSNIKPKTEGIWMWCVPHPTKAGTSLVLLDTKGLGDVEKGDSKRDTYI 110 FSLTVLLSSTLVYNSRGVIDNKAMEELQYVTELIEHIKVTPDEDADDCTAFAKFF 165 PHFIWCLRDFTLELKLDGKDLTEDEYLEFALKLRPGTLKKVMMYNLPRECIQKFF

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 Single-cell RNA sequencing reveals unique sets of neuropeptides, transcription factors and receptors in specific types of sympathetic neurons (a) Dissection of paravertebral SGs

More information

Supplementary Information for. Single-cell dynamics of the chromosome replication and cell division cycles in mycobacteria

Supplementary Information for. Single-cell dynamics of the chromosome replication and cell division cycles in mycobacteria Supplementary Information for Single-cell dynamics of the chromosome replication and cell division cycles in mycobacteria Isabella Santi 1 *, Neeraj Dhar 1, Djenet Bousbaine 1, Yuichi Wakamoto, John D.

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb3267 Supplementary Figure 1 A group of genes required for formation or orientation of annular F-actin bundles and aecm ridges: RNAi phenotypes and their validation by standard mutations.

More information

Invasion and Replication of Salmonella typhimurium in Animal Cells

Invasion and Replication of Salmonella typhimurium in Animal Cells INFECTION AND IMMUNITY, Feb. 1990, p. 443-448 0019-9567/90/020443-06$02.00/0 Copyright 1990, American Society for Microbiology Vol. 58, No. 2 Invasion and Replication of Salmonella typhimurium in Animal

More information

Apoptosis & Autophagy

Apoptosis & Autophagy SPETSAI SUMMER SCHOOL 2010 Host Microbe Interactions Cellular Response to Infection: Apoptosis & Autophagy Christoph Dehio There are many ways to die Apoptosis: Historical perspective Process of programmed

More information

Functional analysis of a zebrafish myd88 mutant identifies key transcriptional components of the innate immune system

Functional analysis of a zebrafish myd88 mutant identifies key transcriptional components of the innate immune system Disease Models & Mechanisms 6, 841-854 (2013) doi:10.1242/dmm.010843 RESOURCE ARTICLE Functional analysis of a zebrafish myd88 mutant identifies key transcriptional components of the innate immune system

More information

Nature Methods: doi: /nmeth Supplementary Figure 1. In vitro screening of recombinant R-CaMP2 variants.

Nature Methods: doi: /nmeth Supplementary Figure 1. In vitro screening of recombinant R-CaMP2 variants. Supplementary Figure 1 In vitro screening of recombinant R-CaMP2 variants. Baseline fluorescence compared to R-CaMP1.07 at nominally zero calcium plotted versus dynamic range ( F/F) for 150 recombinant

More information

Brain Neurosecretory Cytokines. Immune Response and Neuronal Survival

Brain Neurosecretory Cytokines. Immune Response and Neuronal Survival Brain Neurosecretory Cytokines Immune Response and Neuronal Survival Library ofcongress Cataloging-in-Publication Data Brain neurosecretory cytokines : immune response and neuronal survival / edited by

More information

Salmonella Typhimurium Type III Secretion Effectors Stimulate Innate Immune Responses in Cultured Epithelial Cells

Salmonella Typhimurium Type III Secretion Effectors Stimulate Innate Immune Responses in Cultured Epithelial Cells Salmonella Typhimurium Type III Secretion Effectors Stimulate Innate Immune Responses in Cultured Epithelial Cells Vincent M. Bruno 1, Sebastian Hannemann 1, María Lara-Tejero 1, Richard A. Flavell 2,

More information

Apoptosis in Mammalian Cells

Apoptosis in Mammalian Cells Apoptosis in Mammalian Cells 7.16 2-10-05 Apoptosis is an important factor in many human diseases Cancer malignant cells evade death by suppressing apoptosis (too little apoptosis) Stroke damaged neurons

More information

Received 10 July 2003/Returned for modification 8 September 2003/Accepted 12 November 2003

Received 10 July 2003/Returned for modification 8 September 2003/Accepted 12 November 2003 INFECTION AND IMMUNITY, Feb. 2004, p. 795 809 Vol. 72, No. 2 0019-9567/04/$08.00 0 DOI: 10.1128/IAI.72.2.795 809.2004 Copyright 2004, American Society for Microbiology. All Rights Reserved. Role of the

More information

Lung-residing myeloid-derived suppressors display dual functionality in murine. pulmonary tuberculosis

Lung-residing myeloid-derived suppressors display dual functionality in murine. pulmonary tuberculosis Lung-residing myeloid-derived suppressors display dual functionality in murine pulmonary tuberculosis Julia K. Knaul, Sabine Jörg, Dagmar Oberbeck-Mueller, Ellen Heinemann, Lisa Scheuermann, Volker Brinkmann,

More information

AMouseModel of Salmonella Typhi Infection

AMouseModel of Salmonella Typhi Infection AMouseModel of Salmonella Typhi Infection Ramkumar Mathur, 1 Hyunju Oh, 1 Dekai Zhang, 3,5 Sung-Gyoo Park, 1,6 Jin Seo, 1 Alicia Koblansky, 1 Matthew S. Hayden, 1,2,4 and Sankar Ghosh 1,4, * 1 Department

More information

Growth and killing of a Salmonella enterica serovar Typhimurium sifa mutant strain in the cytosol of different host cell lines

Growth and killing of a Salmonella enterica serovar Typhimurium sifa mutant strain in the cytosol of different host cell lines Microbiology (02), 148, 2705 2715 Printed in Great Britain Growth and killing of a Salmonella enterica serovar Typhimurium mutant strain in the cytosol of different host cell lines Carmen R. Beuzo n, Suzana

More information

Nature Medicine: doi: /nm.3776

Nature Medicine: doi: /nm.3776 C terminal Hsp90 inhibitors restore glucocorticoid sensitivity and relieve a mouse allograft model of Cushing s disease Mathias Riebold, Christian Kozany, Lee Freiburger, Michael Sattler, Michael Buchfelder,

More information

Table S1. Sequence of primers used in RT-qPCR

Table S1. Sequence of primers used in RT-qPCR Table S1. Sequence of primers used in RT-qPCR Primer Name P16Ink4a-F P16Ink4a-R P15Ink4b-F P15Ink4b-R P19Arf-F P19Arf-R P53-F P53-R P21cip1-F P21cip1-R P27kip1-F P27kip1-R P18Ink4c-F P18Ink4c-R P19Ink4d-F

More information

Supplementary Materials for

Supplementary Materials for www.advances.sciencemag.org/cgi/content/full/1/5/e1500358/dc1 Supplementary Materials for Transplantability of a circadian clock to a noncircadian organism Anna H. Chen, David Lubkowicz, Vivian Yeong,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Metal nanoparticles in the presence of lipopolysaccharides trigger the onset of metal allergy in mice Toshiro Hirai, Yasuo Yoshioka, Natsumi Izumi, Ko-ichi Ichihashi, Takayuki Handa, Nobuo Nishijima, Eiichiro

More information

Mitochondrial Dynamics Is a Distinguishing Feature of Skeletal Muscle Fiber Types and Regulates Organellar Compartmentalization

Mitochondrial Dynamics Is a Distinguishing Feature of Skeletal Muscle Fiber Types and Regulates Organellar Compartmentalization Cell Metabolism Supplemental Information Mitochondrial Dynamics Is a Distinguishing Feature of Skeletal Muscle Fiber Types and Regulates Organellar Compartmentalization Prashant Mishra, Grigor Varuzhanyan,

More information

Receptor-Mediated Sorting of Typhoid Toxin during Its Export from Salmonella Typhi-Infected Cells

Receptor-Mediated Sorting of Typhoid Toxin during Its Export from Salmonella Typhi-Infected Cells Short Article Receptor-Mediated Sorting of Typhoid Toxin during Its Export from Salmonella Typhi-Infected Cells Graphical Abstract Authors Shu-Jung Chang, Jeongmin Song, Jorge E. Galán Correspondence jorge.galan@yale.edu

More information

Nature Neuroscience: doi: /nn.2662

Nature Neuroscience: doi: /nn.2662 Supplementary Figure 1 Atlastin phylogeny and homology. (a) Maximum likelihood phylogenetic tree based on 18 Atlastin-1 sequences using the program Quicktree. Numbers at internal nodes correspond to bootstrap

More information

downstream (0.8 kb) homologous sequences to the genomic locus of DIC. A DIC mutant strain (ro- 6

downstream (0.8 kb) homologous sequences to the genomic locus of DIC. A DIC mutant strain (ro- 6 A B C D ts Figure S1 Generation of DIC- mcherry expressing N.crassa strain. A. N. crassa colony morphology. When a cot1 (top, left panel) strain is grown at permissive temperature (25 C), it exhibits straight

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/6/301/ra98/dc1 Supplementary Materials for Regulation of Epithelial Morphogenesis by the G Protein Coupled Receptor Mist and Its Ligand Fog Alyssa J. Manning,

More information

Supplementary Figure 1. Nature Genetics: doi: /ng.3848

Supplementary Figure 1. Nature Genetics: doi: /ng.3848 Supplementary Figure 1 Phenotypes and epigenetic properties of Fab2L flies. A- Phenotypic classification based on eye pigment levels in Fab2L male (orange bars) and female (yellow bars) flies (n>150).

More information

Supporting Information

Supporting Information Supporting Information Sana et al. 10.1073/pnas.1608858113 Fig. S1. Representation of the SPI-6 type VI secretion system. (A) Representation of the SPI-6 genetic locus starting at STM0266 and ending at

More information

The cytoskeleton in cell-autonomous immunity: structural determinants of host defence

The cytoskeleton in cell-autonomous immunity: structural determinants of host defence The cytoskeleton in cell-autonomous immunity: structural determinants of host defence Serge Mostowy and Avinash R. Shenoy Medical Research Council Centre of Molecular Bacteriology and Infection (CMBI),

More information

targets. clustering show that different complex pathway

targets. clustering show that different complex pathway Supplementary Figure 1. CLICR allows clustering and activation of cytoplasmic protein targets. (a, b) Upon light activation, the Cry2 (red) and LRP6c (green) components co-cluster due to the heterodimeric

More information

Studies on Pathogenesis and Immunity to Turkey Clostridial Dermatitis. K.V. Nagaraja and Anil Thachil

Studies on Pathogenesis and Immunity to Turkey Clostridial Dermatitis. K.V. Nagaraja and Anil Thachil Studies on Pathogenesis and Immunity to Turkey Clostridial Dermatitis K.V. Nagaraja and Anil Thachil Department of Veterinary and Biomedical Sciences, University of Minnesota, 1971 Commonwealth Ave, St.

More information

Flagella and Chemotaxis Are Required for Efficient Induction of Salmonella enterica Serovar Typhimurium Colitis in Streptomycin-Pretreated Mice

Flagella and Chemotaxis Are Required for Efficient Induction of Salmonella enterica Serovar Typhimurium Colitis in Streptomycin-Pretreated Mice INFECTION AND IMMUNITY, July 2004, p. 4138 4150 Vol. 72, No. 7 0019-9567/04/$08.00 0 DOI: 10.1128/IAI.72.7.4138 4150.2004 Copyright 2004, American Society for Microbiology. All Rights Reserved. Flagella

More information

Copyright 2010 American Association for the Advancement of Science.

Copyright 2010 American Association for the Advancement of Science. Srikanth, C.V., Wall, D.M., Maldonado-Contreras, A., Shi, H.N., Zhou, D.G., Demma, Z., Mumy, K.L., and Mccormick, B.A. (2010) Salmonella Pathogenesis and Processing of Secreted Effectors by Caspase-3.

More information

Caspase-11 Controls Interleukin-1b Release through Degradation of TRPC1

Caspase-11 Controls Interleukin-1b Release through Degradation of TRPC1 Cell Reports Article Caspase-11 Controls Interleukin-1b Release through Degradation of TRPC1 Bénédicte F. Py, 1,2 Mingzhi Jin, 1 Bimal N. Desai, 3,5 Anirudh Penumaka, 3 Hong Zhu, 1 Maike Kober, 1 Alexander

More information

Supplementary Information

Supplementary Information Supplementary Information Supplementary Figure 1. JAK/STAT in early wing development (a-f) Wing primordia of second instar larvae of the indicated genotypes labeled to visualize expression of upd mrna

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2647 Figure S1 Other Rab GTPases do not co-localize with the ER. a, Cos-7 cells cotransfected with an ER luminal marker (either KDEL-venus or mch-kdel) and mch-tagged human Rab5 (mch-rab5,

More information

The Harvard community has made this article openly available. Please share how this access benefits you. Your story matters.

The Harvard community has made this article openly available. Please share how this access benefits you. Your story matters. Caspase-11 Controls Interleukin-1β Release through Degradation of TRPC1 The Harvard community has made this article openly available. Please share how this access benefits you. Your story matters. Citation

More information

Introduction to Cellular Communication *

Introduction to Cellular Communication * OpenStax-CNX module: m53235 1 Introduction to Cellular Communication * Steven Telleen This work is produced by OpenStax-CNX and licensed under the Creative Commons Attribution License 4.0 1 Why Cells Communicate

More information

David K. O Brien and Stephen B. Melville* Department of Biology, Virginia Tech, Blacksburg, Virginia

David K. O Brien and Stephen B. Melville* Department of Biology, Virginia Tech, Blacksburg, Virginia INFECTION AND IMMUNITY, Sept. 2004, p. 5204 5215 Vol. 72, No. 9 0019-9567/04/$08.00 0 DOI: 10.1128/IAI.72.9.5204 5215.2004 Copyright 2004, American Society for Microbiology. All Rights Reserved. Effects

More information

Supplementary Figure 1. Real time in vivo imaging of SG secretion. (a) SGs from Drosophila third instar larvae that express Sgs3-GFP (green) and

Supplementary Figure 1. Real time in vivo imaging of SG secretion. (a) SGs from Drosophila third instar larvae that express Sgs3-GFP (green) and Supplementary Figure 1. Real time in vivo imaging of SG secretion. (a) SGs from Drosophila third instar larvae that express Sgs3-GFP (green) and Lifeact-Ruby (red) were imaged in vivo to visualize secretion

More information

Supplementary Figure 1. Phenotype of the HI strain.

Supplementary Figure 1. Phenotype of the HI strain. Supplementary Figure 1. Phenotype of the HI strain. (A) Phenotype of the HI and wild type plant after flowering (~1month). Wild type plant is tall with well elongated inflorescence. All four HI plants

More information

Photoreceptor Regulation of Constans Protein in Photoperiodic Flowering

Photoreceptor Regulation of Constans Protein in Photoperiodic Flowering Photoreceptor Regulation of Constans Protein in Photoperiodic Flowering by Valverde et. Al Published in Science 2004 Presented by Boyana Grigorova CBMG 688R Feb. 12, 2007 Circadian Rhythms: The Clock Within

More information

Chicken Cecum Immune Response to Salmonella enterica Serovars of Different Levels of Invasiveness

Chicken Cecum Immune Response to Salmonella enterica Serovars of Different Levels of Invasiveness INFECTION AND IMMUNITY, Dec. 2007, p. 5993 6007 Vol. 75, No. 12 0019-9567/07/$08.00 0 doi:10.1128/iai.00695-07 Copyright 2007, American Society for Microbiology. All Rights Reserved. Chicken Cecum Immune

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature10923 Supplementary Figure 1 Ten-a and Ten-m antibody and cell type specificities. a c, Representative single confocal sections of a Drosophila NMJ stained with antibodies to Ten-a (red),

More information

Nature Genetics: doi: /ng Supplementary Figure 1. The phenotypes of PI , BR121, and Harosoy under short-day conditions.

Nature Genetics: doi: /ng Supplementary Figure 1. The phenotypes of PI , BR121, and Harosoy under short-day conditions. Supplementary Figure 1 The phenotypes of PI 159925, BR121, and Harosoy under short-day conditions. (a) Plant height. (b) Number of branches. (c) Average internode length. (d) Number of nodes. (e) Pods

More information

4) Please cite Dagda et al J Biol Chem 284: , for any publications or presentations resulting from use or modification of the macro.

4) Please cite Dagda et al J Biol Chem 284: , for any publications or presentations resulting from use or modification of the macro. Supplement Figure S1. Algorithmic quantification of mitochondrial morphology in SH- SY5Y cells treated with known fission/fusion mediators. Parental SH-SY5Y cells were transiently transfected with an empty

More information

Nature Biotechnology: doi: /nbt Supplementary Figure 1. Generation of paraxial mesoderm from the H7 hesc line.

Nature Biotechnology: doi: /nbt Supplementary Figure 1. Generation of paraxial mesoderm from the H7 hesc line. Supplementary Figure 1 Generation of paraxial mesoderm from the H7 hesc line. H7 hescs were differentiated as shown in Figure 1a. (a) Flow cytometric analyses of the proportion of CD56+, PDGFRα+, and KDR+

More information

A Salmonella Virulence Factor Activates the NOD1/NOD2 Signaling Pathway

A Salmonella Virulence Factor Activates the NOD1/NOD2 Signaling Pathway RESEARCH ARTICLE A Salmonella Virulence Factor Activates the NOD1/NOD2 Signaling Pathway A. Marijke Keestra, Maria G. Winter, Daisy Klein-Douwel, Mariana N. Xavier, Sebastian E. Winter, Anita Kim, Renée

More information

Pannexin-1-Mediated Recognition of Bacterial Molecules Activates the Cryopyrin Inflammasome Independent of Toll-like Receptor Signaling

Pannexin-1-Mediated Recognition of Bacterial Molecules Activates the Cryopyrin Inflammasome Independent of Toll-like Receptor Signaling Article Pannexin-1-Mediated Recognition of Bacterial Molecules Activates the Cryopyrin Inflammasome Independent of Toll-like Receptor Signaling Thirumala-Devi Kanneganti, 1,4 Mohamed Lamkanfi, 1,4 Yun-Gi

More information

Nature Biotechnology: doi: /nbt Supplementary Figure 1. The inflammatory response in the mammalian gut leads to tetrathionate generation.

Nature Biotechnology: doi: /nbt Supplementary Figure 1. The inflammatory response in the mammalian gut leads to tetrathionate generation. Supplementary Figure 1 The inflammatory response in the mammalian gut leads to tetrathionate generation. Cytokine signaling following an inflammatory insult leads to, among other responses, release of

More information

Development and Evaluation of Visual Biosensors for Rapid Detection of Salmonella spp. and Listeria monocytogenes

Development and Evaluation of Visual Biosensors for Rapid Detection of Salmonella spp. and Listeria monocytogenes Development and Evaluation of Visual Biosensors for Rapid Detection of Salmonella spp. and Listeria monocytogenes Lawrence D. Goodridge Department of Animal Sciences Colorado State University Lawrence.Goodridge@colostate.edu

More information

Characterization of the Murine T-Lymphocyte Response to Salmonella enterica Serovar Typhimurium Infection

Characterization of the Murine T-Lymphocyte Response to Salmonella enterica Serovar Typhimurium Infection INFECTION AND IMMUNITY, Jan. 2002, p. 199 203 Vol. 70, No. 1 0019-9567/02/$04.00 0 DOI: 10.1128/IAI.70.1.199 203.2002 Copyright 2002, American Society for Microbiology. All Rights Reserved. Characterization

More information

Mesenteric Lymph Nodes Confine Dendritic Cell-Mediated Dissemination of Salmonella enterica Serovar Typhimurium and Limit Systemic Disease in Mice

Mesenteric Lymph Nodes Confine Dendritic Cell-Mediated Dissemination of Salmonella enterica Serovar Typhimurium and Limit Systemic Disease in Mice INFECTION AND IMMUNITY, Aug. 2009, p. 3170 3180 Vol. 77, No. 8 0019-9567/09/$08.00 0 doi:10.1128/iai.00272-09 Copyright 2009, American Society for Microbiology. All Rights Reserved. Mesenteric Lymph Nodes

More information

Plant and animal cells (eukaryotic cells) have a cell membrane, cytoplasm and genetic material enclosed in a nucleus.

Plant and animal cells (eukaryotic cells) have a cell membrane, cytoplasm and genetic material enclosed in a nucleus. 4.1 Cell biology Cells are the basic unit of all forms of life. In this section we explore how structural differences between types of cells enables them to perform specific functions within the organism.

More information

Emerging inflammasome effector mechanisms

Emerging inflammasome effector mechanisms Emerging inflammasome effector mechanisms Mohamed Lamkanfi Abstract Caspase 1 activation by inflammasome complexes in response to pathogenassociated molecular patterns (PAMPs) and damage-associated molecular

More information