Sequence Alignment (chapter 6)
|
|
- Hilary Marsh
- 5 years ago
- Views:
Transcription
1 Sequence lignment (chapter 6) he biological problem lobal alignment Local alignment Multiple alignment Introduction to bioinformatics, utumn 6
2 Background: comparative genomics Basic question in biology: what properties are shared among organisms? enome sequencing allows comparison of organisms at DN and protein levels Comparisons can be used to Find evolutionary relationships between organisms Identify functionally conserved sequences Identify corresponding genes in human and model organisms: develop models for human diseases Introduction to bioinformatics, utumn 6 3
3 Homologs wo genes or characters g B and g C evolved from the same ancestor g are called homologs Homologs usually exhibit conserved functions g = agtgtccgttaagtgcgttc g B = agtgccgttaaagttgtacgtc g C = ctgactgtttgtggttc Close evolutionary relationship => expect a high number of homologs Introduction to bioinformatics, utumn 6 4
4 Sequence similarity Intuitively, similarity of two sequences refers to the degree of match between corresponding positions in sequence agtgccgttaaagttgtacgtc ctgactgtttgtggttc What about sequences that differ in length? Introduction to bioinformatics, utumn 6 5
5 Similarity vs homology Sequence similarity is not sequence homology If the two sequences g B and g C have accumulated enough mutations, the similarity between them is likely to be low #mutations agtgtccgttaagtgcgttc agtgtccgttatagtgcgttc agtgtccgcttatagtgcgttc 4 agtgtccgcttaagggcgttc 8 agtgtccgcttcaaggggcgt 6 gggccgttcatgggggt 3 gcagggcgtcactgagggct #mutations 64 acagtccgttcgggctattg 8 cagagcactaccgc 56 cacgagtaagatatagct 5 taatcgtgata 4 acccttatctacttcctggagtt 48 agcgacctgcccaa 496 caaac Homology is more difficult to detect over greater evolutionary distances. Introduction to bioinformatics, utumn 6 6
6 Similarity vs homology () Sequence similarity can occur by chance Similarity does not imply homology Similarity is an expected consequence of homology Introduction to bioinformatics, utumn 6 7
7 Orthologs and paralogs We distinguish between two types of homology Orthologs: homologs from two different species Paralogs: homologs within a species Organism g g g g ene is copied within organism g B Organism B g C Organism C g B g C Introduction to bioinformatics, utumn 6 8
8 Orthologs and paralogs () Orthologs typically retain the original function In paralogs, one copy is free to mutate and acquire new function (no selective pressure) g Organism g g g ene is copied within organism g B Organism B g C Organism C g B g C Introduction to bioinformatics, utumn 6 9
9 Sequence alignment lignment specifies which positions in two sequences match acgtctag actctag acgtctag actctag acgtctag actctag matches 5 mismatches not aligned 5 matches mismatches not aligned 7 matches mismatches not aligned Introduction to bioinformatics, utumn 6 3
10 Mutations: Insertions, deletions and substitutions Indel: insertion or deletion of a base with respect to the ancestor sequence acgtctag actctag Mismatch: substitution (point mutation) of a single base Insertions and/or deletions are called indels We can t tell whether the ancestor sequence had a base or not at indel position Introduction to bioinformatics, utumn 6 3
11 Problems What sorts of alignments should be considered? How to score alignments? How to find optimal or good scoring alignments? How to evaluate the statistical significance of scores? In this course, we discuss the first three problems. Course Biological sequence analysis tackles all four indepth. Introduction to bioinformatics, utumn 6 3
12 Sequence lignment (chapter 6) he biological problem lobal alignment Local alignment Multiple alignment Introduction to bioinformatics, utumn 6 33
13 lobal alignment Problem: find optimal scoring alignment between two sequences (Needleman & Wunsch 97) We give score for each position in alignment Identity (match) + Substitution (mismatch) µ Indel WH WHY S(WH/WHY) = + µ Introduction to bioinformatics, utumn 6 34
14 Representing alignments and scores WH W H WHY W X H X X Y X Introduction to bioinformatics, utumn 6 35
15 Representing alignments and scores WH W H WHY W lobal alignment score S 3,4 = µ H Y µ Introduction to bioinformatics, utumn 6 36
16 Dynamic programming How to find the optimal alignment? We use previous solutions for optimal alignments of smaller subsequences his general approach is known as dynamic programming Introduction to bioinformatics, utumn 6 37
17 Filling the alignment matrix W H Y W Case Case 3 H Case Consider the alignment process at shaded square. Case. lign H against H (match or substitution). Case. lign H in WHY against (indel) in WH. Case 3. lign H in WH against (indel) in WHY. Introduction to bioinformatics, utumn 6 38
18 Filling the alignment matrix () W H Scoring the alternatives. Case. S, = S, + s(, ) Case. S, = S, W H Y Case Case 3 Case Case 3. S, = S, s(i, j) = for matching positions, s(i, j) = µ for substitutions. Choose the case (path) that yields the maximum score. Keep track of path choices. Introduction to bioinformatics, utumn 6 39
19 lobal alignment: formal development = a a a 3 a n, 3 4 B = b b b 3 b m b b b 3 b 4 b b b 3 b 4 a a a 3 ny alignment can be written as a unique path through the matrix Score for aligning and B up to positions i and j: S i,j = S(a a a 3 a i, b b b 3 b j ) 3 a a a 3 Introduction to bioinformatics, utumn 6 4
20 Scoring partial alignments lignment of = a a a 3 a n with B = b b b 3 b m can end in three ways Case : (a a a i ) a i (b b b j ) b j Case : (a a a i ) a i (b b b j ) Case 3: (a a a i ) (b b b j ) b j Introduction to bioinformatics, utumn 6 4
21 Scoring alignments Scores for each case: Case : (a a a i ) a i (b b b j ) b j Case : (a a a i ) a i s(a i, b j ) = + ifa { i = b j µ otherwise (b b b j ) Case 3: (a a a i ) s(a i, ) = s(, b j ) = (b b b j ) b j Introduction to bioinformatics, utumn 6 4
22 Scoring alignments () First row and first column correspond to initial alignment against indels: S(i, ) = i b b 3 b 3 4 b 4 S(, j) = j 3 4 Optimal global alignment score S(, B) = S n,m a a 3 a 3 3 Introduction to bioinformatics, utumn 6 43
23 lgorithm for global alignment Input sequences, B, n =, m = B Set S i, := i for all i Set S,j := j for all j for i := to n for j := to m S i,j := max{s i,j, S i,j + s(a i,b j ), S i,j } end end lgorithm takes O(nm) time and space. Introduction to bioinformatics, utumn 6 44
24 lobal alignment: example µ = = 4 C 6 8? Introduction to bioinformatics, utumn 6 45
25 lobal alignment: example () µ = = C C Introduction to bioinformatics, utumn 6 46
26 Sequence lignment (chapter 6) he biological problem lobal alignment Local alignment Multiple alignment Introduction to bioinformatics, utumn 6 47
27 Local alignment: rationale Otherwise dissimilar proteins may have local regions of similarity > Proteins may share a function Human bone morphogenic protein receptor type II precursor (left) has a 3 aa region that resembles 9 aa region in F receptor (right). he shared function here is protein kinase. Introduction to bioinformatics, utumn 6 48
28 Local alignment: rationale B Regions of similarity lobal alignment would be inadequate Problem: find the highest scoring local alignment between two sequences Previous algorithm with minor modifications solves this problem (Smith & Waterman 98) Introduction to bioinformatics, utumn 6 49
29 From global to local alignment Modifications to the global alignment algorithm Look for the highestscoring path in the alignment matrix (not necessarily through the matrix) llow preceding and trailing indels without penalty Introduction to bioinformatics, utumn 6 5
30 Scoring local alignments = a a a 3 a n, B = b b b 3 b m Let I and J be intervals (substrings) of and B, respectively:, Best local alignment score: where S(I, J) is the score for substrings I and J. Introduction to bioinformatics, utumn 6 5
31 llowing preceding and trailing indels First row and column initialised to zero: M i, = M,j = b b 3 b 3 4 b 4 a b b b3 a a 3 a 3 Introduction to bioinformatics, utumn 6 5
32 Introduction to bioinformatics, utumn 6 53 Recursion for local alignment M i,j = max { M i,j + s(a i, b i ), M i,j, M i,j, } C
33 Introduction to bioinformatics, utumn 6 54 Finding best local alignment Optimal score is the highest value in the matrix = max i,j M i,j Best local alignment can be found by backtracking from the highest value in M C
34 Introduction to bioinformatics, utumn 6 55 Local alignment: example C 3 C C C C
35 Introduction to bioinformatics, utumn 6 56 Local alignment: example C 3 C C C C Scoring Match: + Mismatch: Indel: C C C
36 Nonuniform mismatch penalties We used uniform penalty for mismatches: s(, C ) = s(, ) = = s(, ) = µ ransition mutations (>, >, C>, >C) are approximately twice as frequent than transversions ( >, >, >C, >) use nonuniform mismatch C penalties C Introduction to bioinformatics, utumn 6 57
37 aps in alignment ap is a succession of indels in alignment C C C C Previous model scored a length k gap as w(k) = k Replication processes may produce longer stretches of insertions or deletions In coding regions, insertions or deletions of codons may preserve functionality Introduction to bioinformatics, utumn 6 58
38 ap open and extension penalties () We can design a score that allows the penalty opening gap to be larger than extending the gap: w(k) = (k ) ap open cost, ap extension cost Our previous algorithm can be extended to use w(k) (not discussed on this course) Introduction to bioinformatics, utumn 6 59
39 Sequence lignment (chapter 6) he biological problem lobal alignment Local alignment Multiple alignment Introduction to bioinformatics, utumn 6 6
40 Multiple alignment Consider a set of n sequences on the right Orthologous sequences from different organisms Paralogs from multiple duplications How can we study relationships between these sequences? aggcgagctgcgagtgcta cgttagattgacgctgac ttccggctgcgac gacacggcgaacgga agtgtgcccgacgagcgaggac gcgggctgtgagcgcta aagcggcctgtgtgcccta atgctgctgccagtgta agtcgagccccgagtgc agtccgagtcc actcggtgc Introduction to bioinformatics, utumn 6 6
41 Optimal alignment of three sequences lignment of = a a a i and B = b b b j can end either in (, b j ), (a i, b j ) or (a i, ) = 3 alternatives lignment of, B and C = c c c k can end in 3 ways: (a i,, ), (, b j, ), (,, c k ), (, b j, c k ), (a i,, c k ), (a i, b j, ) or (a i, b j, c k ) Solve the recursion using threedimensional dynamic programming matrix: O(n 3 ) time and space eneralizes to n sequences but impractical with moderate number of sequences Introduction to bioinformatics, utumn 6 6
42 Multiple alignment in practice In practice, realworld multiple alignment problems are usually solved with heuristics Progressive multiple alignment Choose two sequences and align them Choose third sequence w.r.t. two previous sequences and align the third against them Repeat until all sequences have been aligned Different options how to choose sequences and score alignments Introduction to bioinformatics, utumn 6 63
43 Multiple alignment in practice Profilebased progressive multiple alignment: CLUSLW Construct a distance matrix of all pairs of sequences using dynamic programming Progressively align pairs in order of decreasing similarity CLUSLW uses various heuristics to contribute to accuracy Introduction to bioinformatics, utumn 6 64
44 dditional material R. Durbin, S. Eddy,. Krogh,. Mitchison: Biological sequence analysis Course Biological sequence analysis in Spring 7 Introduction to bioinformatics, utumn 6 65
Background: comparative genomics. Sequence similarity. Homologs. Similarity vs homology (2) Similarity vs homology. Sequence Alignment (chapter 6)
Sequence lignment (chapter ) he biological problem lobal alignment Local alignment Multiple alignment Background: comparative genomics Basic question in biology: what properties are shared among organisms?
More informationIntroduction to Bioinformatics
Introduction to Bioinformatics Lecture : p he biological problem p lobal alignment p Local alignment p Multiple alignment 6 Background: comparative genomics p Basic question in biology: what properties
More informationPairwise & Multiple sequence alignments
Pairwise & Multiple sequence alignments Urmila Kulkarni-Kale Bioinformatics Centre 411 007 urmila@bioinfo.ernet.in Basis for Sequence comparison Theory of evolution: gene sequences have evolved/derived
More informationAlgorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot
More informationModule: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment
Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Introduction to Bioinformatics online course : IBT Jonathan Kayondo Learning Objectives Understand
More informationSequence analysis and Genomics
Sequence analysis and Genomics October 12 th November 23 rd 2 PM 5 PM Prof. Peter Stadler Dr. Katja Nowick Katja: group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute
More information3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT
3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode
More informationBiochemistry 324 Bioinformatics. Pairwise sequence alignment
Biochemistry 324 Bioinformatics Pairwise sequence alignment How do we compare genes/proteins? When we have sequenced a genome, we try and identify the function of unknown genes by finding a similar gene
More informationSara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)
Bioinformática Sequence Alignment Pairwise Sequence Alignment Universidade da Beira Interior (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) 1 16/3/29 & 23/3/29 27/4/29 Outline
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of omputer Science San José State University San José, alifornia, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Pairwise Sequence Alignment Homology
More informationAn Introduction to Sequence Similarity ( Homology ) Searching
An Introduction to Sequence Similarity ( Homology ) Searching Gary D. Stormo 1 UNIT 3.1 1 Washington University, School of Medicine, St. Louis, Missouri ABSTRACT Homologous sequences usually have the same,
More informationCISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I)
CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) Contents Alignment algorithms Needleman-Wunsch (global alignment) Smith-Waterman (local alignment) Heuristic algorithms FASTA BLAST
More informationB I O I N F O R M A T I C S
B I O I N F O R M A T I C S Kristel Van Steen, PhD 2 Montefiore Institute - Systems and Modeling GIGA - Bioinformatics ULg kristel.vansteen@ulg.ac.be K Van Steen CH4 : 1 CHAPTER 4: SEQUENCE COMPARISON
More informationSequence alignment methods. Pairwise alignment. The universe of biological sequence analysis
he universe of biological sequence analysis Word/pattern recognition- Identification of restriction enzyme cleavage sites Sequence alignment methods PstI he universe of biological sequence analysis - prediction
More informationPractical considerations of working with sequencing data
Practical considerations of working with sequencing data File Types Fastq ->aligner -> reference(genome) coordinates Coordinate files SAM/BAM most complete, contains all of the info in fastq and more!
More informationIntroduction to sequence alignment. Local alignment the Smith-Waterman algorithm
Lecture 2, 12/3/2003: Introduction to sequence alignment The Needleman-Wunsch algorithm for global sequence alignment: description and properties Local alignment the Smith-Waterman algorithm 1 Computational
More informationMotivating the need for optimal sequence alignments...
1 Motivating the need for optimal sequence alignments... 2 3 Note that this actually combines two objectives of optimal sequence alignments: (i) use the score of the alignment o infer homology; (ii) use
More informationLecture 4: September 19
CSCI1810: Computational Molecular Biology Fall 2017 Lecture 4: September 19 Lecturer: Sorin Istrail Scribe: Cyrus Cousins Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes
More informationCONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018
CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of
More informationBioinformatics. Part 8. Sequence Analysis An introduction. Mahdi Vasighi
Bioinformatics Sequence Analysis An introduction Part 8 Mahdi Vasighi Sequence analysis Some of the earliest problems in genomics concerned how to measure similarity of DNA and protein sequences, either
More informationLecture 2: Pairwise Alignment. CG Ron Shamir
Lecture 2: Pairwise Alignment 1 Main source 2 Why compare sequences? Human hexosaminidase A vs Mouse hexosaminidase A 3 www.mathworks.com/.../jan04/bio_genome.html Sequence Alignment עימוד רצפים The problem:
More informationSequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University
Sequence Alignment: A General Overview COMP 571 - Fall 2010 Luay Nakhleh, Rice University Life through Evolution All living organisms are related to each other through evolution This means: any pair of
More informationPairwise Alignment. Guan-Shieng Huang. Dept. of CSIE, NCNU. Pairwise Alignment p.1/55
Pairwise Alignment Guan-Shieng Huang shieng@ncnu.edu.tw Dept. of CSIE, NCNU Pairwise Alignment p.1/55 Approach 1. Problem definition 2. Computational method (algorithms) 3. Complexity and performance Pairwise
More informationMATHEMATICAL MODELS - Vol. III - Mathematical Modeling and the Human Genome - Hilary S. Booth MATHEMATICAL MODELING AND THE HUMAN GENOME
MATHEMATICAL MODELING AND THE HUMAN GENOME Hilary S. Booth Australian National University, Australia Keywords: Human genome, DNA, bioinformatics, sequence analysis, evolution. Contents 1. Introduction:
More informationBioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment
Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value
More informationPairwise sequence alignment
Department of Evolutionary Biology Example Alignment between very similar human alpha- and beta globins: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL G+ +VK+HGKKV A+++++AH+D++ +++++LS+LH KL GNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKL
More information20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, Global and local alignment of two sequences using dynamic programming
20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, 2008 4 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance 4. Global and local alignment
More informationMultiple Alignment. Slides revised and adapted to Bioinformática IST Ana Teresa Freitas
n Introduction to Bioinformatics lgorithms Multiple lignment Slides revised and adapted to Bioinformática IS 2005 na eresa Freitas n Introduction to Bioinformatics lgorithms Outline Dynamic Programming
More informationSequence Alignment. Johannes Starlinger
Sequence Alignment Johannes Starlinger his Lecture Approximate String Matching Edit distance and alignment Computing global alignments Local alignment Johannes Starlinger: Bioinformatics, Summer Semester
More informationIn-Depth Assessment of Local Sequence Alignment
2012 International Conference on Environment Science and Engieering IPCBEE vol.3 2(2012) (2012)IACSIT Press, Singapoore In-Depth Assessment of Local Sequence Alignment Atoosa Ghahremani and Mahmood A.
More informationSingle alignment: Substitution Matrix. 16 march 2017
Single alignment: Substitution Matrix 16 march 2017 BLOSUM Matrix BLOSUM Matrix [2] (Blocks Amino Acid Substitution Matrices ) It is based on the amino acids substitutions observed in ~2000 conserved block
More informationInDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 07: profile Hidden Markov Model http://bibiserv.techfak.uni-bielefeld.de/sadr2/databasesearch/hmmer/profilehmm.gif Slides adapted from Dr. Shaojie Zhang
More informationGlobal alignments - review
Global alignments - review Take two sequences: X[j] and Y[j] M[i-1, j-1] ± 1 M[i, j] = max M[i, j-1] 2 M[i-1, j] 2 The best alignment for X[1 i] and Y[1 j] is called M[i, j] X[j] Initiation: M[,]= pply
More informationBioinformatics and BLAST
Bioinformatics and BLAST Overview Recap of last time Similarity discussion Algorithms: Needleman-Wunsch Smith-Waterman BLAST Implementation issues and current research Recap from Last Time Genome consists
More informationAnalysis and Design of Algorithms Dynamic Programming
Analysis and Design of Algorithms Dynamic Programming Lecture Notes by Dr. Wang, Rui Fall 2008 Department of Computer Science Ocean University of China November 6, 2009 Introduction 2 Introduction..................................................................
More informationPairwise sequence alignments
Pairwise sequence alignments Volker Flegel VI, October 2003 Page 1 Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs VI, October
More informationNetwork Alignment 858L
Network Alignment 858L Terms & Questions A homologous h Interolog = B h Species 1 Species 2 Are there conserved pathways? What is the minimum set of pathways required for life? Can we compare networks
More informationTHEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
More informationPairwise sequence alignments. Vassilios Ioannidis (From Volker Flegel )
Pairwise sequence alignments Vassilios Ioannidis (From Volker Flegel ) Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs Importance
More informationC E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 5 G R A T I V. Pair-wise Sequence Alignment
C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Introduction to bioinformatics 2007 Lecture 5 Pair-wise Sequence Alignment Bioinformatics Nothing in Biology makes sense except in
More informationCollected Works of Charles Dickens
Collected Works of Charles Dickens A Random Dickens Quote If there were no bad people, there would be no good lawyers. Original Sentence It was a dark and stormy night; the night was dark except at sunny
More informationLecture 1, 31/10/2001: Introduction to sequence alignment. The Needleman-Wunsch algorithm for global sequence alignment: description and properties
Lecture 1, 31/10/2001: Introduction to sequence alignment The Needleman-Wunsch algorithm for global sequence alignment: description and properties 1 Computational sequence-analysis The major goal of computational
More informationLocal Alignment: Smith-Waterman algorithm
Local Alignment: Smith-Waterman algorithm Example: a shared common domain of two protein sequences; extended sections of genomic DNA sequence. Sensitive to detect similarity in highly diverged sequences.
More information1.5 Sequence alignment
1.5 Sequence alignment The dramatic increase in the number of sequenced genomes and proteomes has lead to development of various bioinformatic methods and algorithms for extracting information (data mining)
More informationTools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2013 Week3: Blast Algorithm, theory and practice Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and Systems Biology
More informationComputational Biology
Computational Biology Lecture 6 31 October 2004 1 Overview Scoring matrices (Thanks to Shannon McWeeney) BLAST algorithm Start sequence alignment 2 1 What is a homologous sequence? A homologous sequence,
More informationBioinformatics Exercises
Bioinformatics Exercises AP Biology Teachers Workshop Susan Cates, Ph.D. Evolution of Species Phylogenetic Trees show the relatedness of organisms Common Ancestor (Root of the tree) 1 Rooted vs. Unrooted
More informationFirst generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences
First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences 140.638 where do sequences come from? DNA is not hard to extract (getting DNA from a
More informationLecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm. Alignment scoring schemes and theory: substitution matrices and gap models
Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm Alignment scoring schemes and theory: substitution matrices and gap models 1 Local sequence alignments Local sequence alignments are necessary
More informationTools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2015 Week-4 BLAST Algorithm Continued Multiple Sequence Alignment Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and
More informationBioinformatics for Computer Scientists (Part 2 Sequence Alignment) Sepp Hochreiter
Bioinformatics for Computer Scientists (Part 2 Sequence Alignment) Institute of Bioinformatics Johannes Kepler University, Linz, Austria Sequence Alignment 2. Sequence Alignment Sequence Alignment 2.1
More informationPage 1. Evolutionary Trees. Why build evolutionary tree? Outline
Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny
More information17 Non-collinear alignment Motivation A B C A B C A B C A B C D A C. This exposition is based on:
17 Non-collinear alignment This exposition is based on: 1. Darling, A.E., Mau, B., Perna, N.T. (2010) progressivemauve: multiple genome alignment with gene gain, loss and rearrangement. PLoS One 5(6):e11147.
More informationQuantifying sequence similarity
Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity
More informationPage 1. References. Hidden Markov models and multiple sequence alignment. Markov chains. Probability review. Example. Markovian sequence
Page Hidden Markov models and multiple sequence alignment Russ B Altman BMI 4 CS 74 Some slides borrowed from Scott C Schmidler (BMI graduate student) References Bioinformatics Classic: Krogh et al (994)
More information... and searches for related sequences probably make up the vast bulk of bioinformatics activities.
1 2 ... and searches for related sequences probably make up the vast bulk of bioinformatics activities. 3 The terms homology and similarity are often confused and used incorrectly. Homology is a quality.
More informationLecture 5,6 Local sequence alignment
Lecture 5,6 Local sequence alignment Chapter 6 in Jones and Pevzner Fall 2018 September 4,6, 2018 Evolution as a tool for biological insight Nothing in biology makes sense except in the light of evolution
More informationChapter 5. Proteomics and the analysis of protein sequence Ⅱ
Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Head, Biocomputing Whitehead Institute Bioinformatics Definitions The use of computational
More informationThanks to Paul Lewis, Jeff Thorne, and Joe Felsenstein for the use of slides
hanks to Paul Lewis, Jeff horne, and Joe Felsenstein for the use of slides Hennigian logic reconstructs the tree if we know polarity of characters and there is no homoplasy UPM infers a tree from a distance
More informationCopyright 2000 N. AYDIN. All rights reserved. 1
Introduction to Bioinformatics Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Multiple Sequence Alignment Outline Multiple sequence alignment introduction to msa methods of msa progressive global alignment
More informationPhylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?
Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species
More informationSequence Comparison. mouse human
Sequence Comparison Sequence Comparison mouse human Why Compare Sequences? The first fact of biological sequence analysis In biomolecular sequences (DNA, RNA, or amino acid sequences), high sequence similarity
More informationSequence analysis and comparison
The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species
More informationCHAPTERS 24-25: Evidence for Evolution and Phylogeny
CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology
More informationSimilarity or Identity? When are molecules similar?
Similarity or Identity? When are molecules similar? Mapping Identity A -> A T -> T G -> G C -> C or Leu -> Leu Pro -> Pro Arg -> Arg Phe -> Phe etc If we map similarity using identity, how similar are
More informationComparative genomics: Overview & Tools + MUMmer algorithm
Comparative genomics: Overview & Tools + MUMmer algorithm Urmila Kulkarni-Kale Bioinformatics Centre University of Pune, Pune 411 007. urmila@bioinfo.ernet.in Genome sequence: Fact file 1995: The first
More informationEffects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
More informationEvolution. CT Amemiya et al. Nature 496, (2013) doi: /nature12027
Sequence Alignment Evolution CT Amemiya et al. Nature 496, 311-316 (2013) doi:10.1038/nature12027 Evolutionary Rates next generation OK OK OK X X Still OK? Sequence conservation implies function Alignment
More information8 Grundlagen der Bioinformatik, SS 09, D. Huson, April 28, 2009
8 Grundlagen der Bioinformatik, SS 09, D. Huson, April 28, 2009 2 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance and alignment 4. The number
More informationDr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
More informationExample of Function Prediction
Find similar genes Example of Function Prediction Suggesting functions of newly identified genes It was known that mutations of NF1 are associated with inherited disease neurofibromatosis 1; but little
More information9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
More informationPhylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
More informationAlignment principles and homology searching using (PSI-)BLAST. Jaap Heringa Centre for Integrative Bioinformatics VU (IBIVU)
Alignment principles and homology searching using (PSI-)BLAST Jaap Heringa Centre for Integrative Bioinformatics VU (IBIVU) http://ibivu.cs.vu.nl Bioinformatics Nothing in Biology makes sense except in
More informationproteins are the basic building blocks and active players in the cell, and
12 RN Secondary Structure Sources for this lecture: R. Durbin, S. Eddy,. Krogh und. Mitchison, Biological sequence analysis, ambridge, 1998 J. Setubal & J. Meidanis, Introduction to computational molecular
More informationLecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM)
Bioinformatics II Probability and Statistics Universität Zürich and ETH Zürich Spring Semester 2009 Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Dr Fraser Daly adapted from
More informationStudy and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis
Study and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis Kumud Joseph Kujur, Sumit Pal Singh, O.P. Vyas, Ruchir Bhatia, Varun Singh* Indian Institute of Information
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 05: Index-based alignment algorithms Slides adapted from Dr. Shaojie Zhang (University of Central Florida) Real applications of alignment Database search
More informationAmira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
More informationPairwise Sequence Alignment
Introduction to Bioinformatics Pairwise Sequence Alignment Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Outline Introduction to sequence alignment pair wise sequence alignment The Dot Matrix Scoring
More informationBLAST Database Searching. BME 110: CompBio Tools Todd Lowe April 8, 2010
BLAST Database Searching BME 110: CompBio Tools Todd Lowe April 8, 2010 Admin Reading: Read chapter 7, and the NCBI Blast Guide and tutorial http://www.ncbi.nlm.nih.gov/blast/why.shtml Read Chapter 8 for
More informationSequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013
Sequence Alignments Dynamic programming approaches, scoring, and significance Lucy Skrabanek ICB, WMC January 31, 213 Sequence alignment Compare two (or more) sequences to: Find regions of conservation
More informationPhylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches
Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell
More informationPractical Bioinformatics
5/2/2017 Dictionaries d i c t i o n a r y = { A : T, T : A, G : C, C : G } d i c t i o n a r y [ G ] d i c t i o n a r y [ N ] = N d i c t i o n a r y. h a s k e y ( C ) Dictionaries g e n e t i c C o
More informationO 3 O 4 O 5. q 3. q 4. Transition
Hidden Markov Models Hidden Markov models (HMM) were developed in the early part of the 1970 s and at that time mostly applied in the area of computerized speech recognition. They are first described in
More information8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011
8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011 2 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance and alignment 4. The number
More informationBLAST. Varieties of BLAST
BLAST Basic Local Alignment Search Tool (1990) Altschul, Gish, Miller, Myers, & Lipman Uses short-cuts or heuristics to improve search speed Like speed-reading, does not examine every nucleotide of database
More informationMolecular Evolution & the Origin of Variation
Molecular Evolution & the Origin of Variation What Is Molecular Evolution? Molecular evolution differs from phenotypic evolution in that mutations and genetic drift are much more important determinants
More informationMolecular Evolution & the Origin of Variation
Molecular Evolution & the Origin of Variation What Is Molecular Evolution? Molecular evolution differs from phenotypic evolution in that mutations and genetic drift are much more important determinants
More informationNetwork alignment and querying
Network biology minicourse (part 4) Algorithmic challenges in genomics Network alignment and querying Roded Sharan School of Computer Science, Tel Aviv University Multiple Species PPI Data Rapid growth
More informationBio 1B Lecture Outline (please print and bring along) Fall, 2007
Bio 1B Lecture Outline (please print and bring along) Fall, 2007 B.D. Mishler, Dept. of Integrative Biology 2-6810, bmishler@berkeley.edu Evolution lecture #5 -- Molecular genetics and molecular evolution
More informationHomology Modeling. Roberto Lins EPFL - summer semester 2005
Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,
More informationPairwise alignment, Gunnar Klau, November 9, 2005, 16:
Pairwise alignment, Gunnar Klau, November 9, 2005, 16:36 2012 2.1 Growth rates For biological sequence analysis, we prefer algorithms that have time and space requirements that are linear in the length
More informationExploring Evolution & Bioinformatics
Chapter 6 Exploring Evolution & Bioinformatics Jane Goodall The human sequence (red) differs from the chimpanzee sequence (blue) in only one amino acid in a protein chain of 153 residues for myoglobin
More informationSequence Alignment Techniques and Their Uses
Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this
More informationResearch Proposal. Title: Multiple Sequence Alignment used to investigate the co-evolving positions in OxyR Protein family.
Research Proposal Title: Multiple Sequence Alignment used to investigate the co-evolving positions in OxyR Protein family. Name: Minjal Pancholi Howard University Washington, DC. June 19, 2009 Research
More informationBio nformatics. Lecture 3. Saad Mneimneh
Bio nformatics Lecture 3 Sequencing As before, DNA is cut into small ( 0.4KB) fragments and a clone library is formed. Biological experiments allow to read a certain number of these short fragments per
More informationBIOINFORMATICS: An Introduction
BIOINFORMATICS: An Introduction What is Bioinformatics? The term was first coined in 1988 by Dr. Hwa Lim The original definition was : a collective term for data compilation, organisation, analysis and
More information