RNA Folding Algorithms. Michal Ziv-Ukelson Ben Gurion University of the Negev
|
|
- Denis Booth
- 6 years ago
- Views:
Transcription
1 RNA Folding Algorithms Michal Ziv-Ukelson Ben Gurion University of the Negev
2 The RNA Folding Problem: Given an RNA sequence, predict its energetically most stable structure (minimal free energy). AUCCCCGUAUCGAUC AAAAUCCAUGGGUAC CCUAGUGAAAGUGUA UAUACGUGCUCUGAU UCUUUACUGAGGAGU CAGUGAACGAACUGA
3 RNA structure prediction by basepair maximization Input: Output: a string over A,C,G,U A pairs with U, C pairs with G a subset of possible base-pairs of maximal size such that no two base-pairs intersect.
4 Sequence Alignment as a method to determine structure Bases pair in order to form backbones and determine the secondary structure Aligning bases based on their ability to pair with each other gives an algorithmic approach to determining the optimal structure Problem: number of potential structures grows exponentially with the number, n, of bases
5 RNA secondary structure prediction algorithms cont d We must distinguish the biologically correct structure from all the incorrect structures. We need both a function that assigns the highest score to the correct structure, and an algorithm for evaluating the scores of all possible structures דצמבר 15
6 RNA secondary structure prediction algorithms cont d One approach might be to find the structure with the most base pairs. Nussinov introduced an efficient dynamic programming algorithm for this problem in Although this criterion is too simplistic, the mechanics of this algorithm are the same as those of more sophisticated energy minimization folding algorithms
7 Ruth Nussinov Professor in the Department of Human Genetics, School of Medicine, Tel Aviv University. Proposed the first dynamic programming algorithm for RNA secondary structure prediction, by maximizing the number of base pairs (1978).
8 Folding an RNA Sequence of length n. 1. Classical, O(n 3 ), [Nussinov et. Al. 1978, 1980] [Waterman and Smith 1978] [Zuker and Stiegler 1981] MFOLD: Vienna RNA Package: 2. Complex worst case speedup based on Fast Matrix Multiplication: O(n 3 * log 3 logn /(log 2 n) [Akutsu 1999] Based on Four Russians: O(n 3 /(logn) [Frid&Gusfield] O(n 3 /(log 2 n) [Pinhas*, Zakov*, Tsur and Ziv-Ukelson 2013] 3. Sparsification: Practical speed up: O(nZ) where Z is in [n, n 2 ] [Wexler, Zilberstein, Ziv-Ukelson 2007] [Backofen, Tsur, Zakov, Ziv-Ukelson 2009] 9
9 Assumptions of the RNA secondary structure prediction algorithm, based on MFE: 1. The most likely structure of the RNA molecule is identical or similar to the energetically most stable structure. 2. The energy associated with any position in the structure is only influenced by local sequence structure. 3. The structure is assumed to be formed by folding of the chain back on itself in a manner that does not produce any pseudoknots. i i j j i Legal structural elements Illegal structural elements
10 (Simplified) Problem Definition An RNA molecule is a sequence of length n over the alphabet {A, C, G, U}. Each base (= letter) in the sequence may form a bond with at most one other base, where A can pair only with U, and C only with G. The base-pairs are nested: Why can this problem be solved by dynamic programming? AAAGUUUCGUCCGGG (((.)))((.)(.)) A set of nested base-pairs is called a secondary structure, or a folding of the sequence. Goal: for a given RNA sequence, compute a folding with a maximum number of base-pairs 12
11 Co-terminus foldings: A U C A U G G C A U Partitionable foldings: 13
12 Co-terminus foldings: A U C A U G G C A U Partitionable foldings: 14
13 Co-terminus foldings: A U C A U G G C A U Partitionable foldings: 15
14 Co-terminus foldings: A U C A U G G C A U Partitionable foldings: 16
15 Co-terminus foldings: A U C A U G G C A U Partitionable foldings: 17
16 Co-terminus foldings: A U C A U G G C A U Partitionable foldings: 18
17 Co-terminus foldings: A U C A U G G C A U Partitionable foldings: 19
18 Co-terminus foldings: A U C A U G G C A U Partitionable foldings: 20
19 A recursive solution Co-terminus foldings: Partitionable foldings: L c (i,j) the maximum cardinality of a co-terminus folding of S i,j A U C A U G G C A U A U C A U G G C A U L p (i,j) the maximum cardinality of a partitionable folding of S i,j L(i,j) the maximum cardinality of a folding of S i,j (the objective function) - i<q j q-1 q 21
20 A recursive solution
21 The Nussinov-Jacobson Algorithm A DP algorithm which performs a bottom-up computation of the recurrence. Uses a table M which stores solutions for subsequences: M[i,j] = L(i,j). Upon reaching M[i,j], all entries which are needed for the computation of L(i,j) have already been computed and stored in M. 23 i 1 A C A G U U G C A 0 0 j
22 The Nussinov-Jacobson Algorithm 1 A ? 2 C A G U U G C A
23 The Nussinov-Jacobson Algorithm - 1 A C A G U U G C A
24 The Nussinov-Jacobson Algorithm i < q j q-1 q 1 A C A G U U G C A
25 The Nussinov-Jacobson Algorithm i < q j q-1 q q = 2 1 A C A G U U G C A
26 The Nussinov-Jacobson Algorithm i < q j q-1 q q = 3 1 A C A G U U G C A
27 The Nussinov-Jacobson Algorithm i < q j q-1 q q = 4 1 A C A G U U G C A
28 The Nussinov-Jacobson Algorithm i < q j q-1 q q = 5 1 A C A G U U G C A
29 The Nussinov-Jacobson Algorithm i < q j q-1 q q = 6 1 A C A G U U G C A
30 The Nussinov-Jacobson Algorithm i < q j q-1 q q = 7 1 A C A G U U G C A
31 The Nussinov-Jacobson Algorithm i < q j q-1 q q = 8 1 A C A G U U G C A
32 The Nussinov-Jacobson Algorithm i < q j q-1 q q = 9 1 A C A G U U G C A
33 The Nussinov-Jacobson Algorithm i < q j q-1 q Space complexity: O(n 2 ) Time complexity: O(n 3 ) 1 A C A G U U G C A
34 The Nussinov-Jacobson Algorithm i < q j q-1 q Sparsification: Do we really need to consider all O(n) sums of pairs? Space complexity: O(n 2 ) Time complexity: O(n 3 ) 1 A C A G U U G C A
RNA Folding Algorithms. Michal Ziv-Ukelson Ben Gurion University of the Negev
RNA Folding Algorithms Michal Ziv-Ukelson Ben Gurion University of the Negev The RNA Folding Problem: Given an RNA sequence, predict its energetically most stable structure (minimal free energy). AUCCCCGUAUCGAUC
More informationRNA Secondary Structure Prediction: taking conservation into account
RNA Secondary Structure Prediction: taking conservation into account 1 Assumptions of the RNA secondary structure prediction algorithm, based on MFE: 1. The most likely structure of the RNA molecule is
More informationSparse RNA Folding: Time and Space Efficient Algorithms
Sparse RNA Folding: Time and Space Efficient Algorithms Rolf Backofen 1, Dekel Tsur 2, Shay Zakov 2, and Michal Ziv-Ukelson 2 1 Albert Ludwigs University, Freiburg, Germany backofen@informatik.uni-freiburg.de
More informationRNA Secondary Structure Prediction: taking conservation into account
RNA Secondary Structure Prediction: taking conservation into account 1 13 June 2006 2 Main approaches to RNA secondary structure prediction Energy minimization (Single-strand Folding) does not require
More informationREDUCING THE WORST CASE RUNNING TIMES OF A FAMILY OF RNA AND CFG PROBLEMS, USING VALIANT S APPROACH
REDUCING THE WORST CASE RUNNING TIMES OF A FAMILY OF RNA AND CFG PROBLEMS, USING VALIANT S APPROACH SHAY ZAKOV, DEKEL TSUR, AND MICHAL ZIV-UKELSON Abstract. We study Valiant s classical algorithm for Context
More informationThis article appeared in a journal published by Elsevier. The attached copy is furnished to the author for internal non-commercial research and
This article appeared in a journal published by Elsevier. The attached copy is furnished to the author for internal non-commercial research and education use, including for instruction at the authors institution
More informationCS681: Advanced Topics in Computational Biology
CS681: Advanced Topics in Computational Biology Can Alkan EA224 calkan@cs.bilkent.edu.tr Week 10 Lecture 1 http://www.cs.bilkent.edu.tr/~calkan/teaching/cs681/ RNA folding Prediction of secondary structure
More informationSparse RNA Folding Revisited: Space-Efficient Minimum Free Energy Prediction
Sparse RNA Folding Revisited: Space-Efficient Minimum Free Energy Prediction Sebastian Will 1 and Hosna Jabbari 2 1 Bioinformatics/IZBI, University Leipzig, swill@csail.mit.edu 2 Ingenuity Lab, National
More informationSA-REPC - Sequence Alignment with a Regular Expression Path Constraint
SA-REPC - Sequence Alignment with a Regular Expression Path Constraint Nimrod Milo Tamar Pinhas Michal Ziv-Ukelson Ben-Gurion University of the Negev, Be er Sheva, Israel Graduate Seminar, BGU 2010 Milo,
More informationA Simple, Practical and Complete O( n3
A Simple, Practical and Complete O( n3 log n )-Time Algorithm for RNA Folding Using the Four-Russians Speedup Yelena Frid and Dan Gusfield Department of Computer Science, U.C. Davis Abstract. The problem
More informationSparse RNA folding revisited: space efficient minimum free energy structure prediction
DOI 10.1186/s13015-016-0071-y Algorithms for Molecular Biology RESEARCH ARTICLE Sparse RNA folding revisited: space efficient minimum free energy structure prediction Sebastian Will 1* and Hosna Jabbari
More informationReducing the worst case running times of a family of RNA and CFG problems, using Valiant s approach
RESEARCH Open Access Reducing the worst case running times of a family of RNA and CFG problems, using Valiant s approach Shay Zakov, Dekel Tsur and Michal Ziv-Ukelson * Abstract Background: RNA secondary
More informationRNA secondary structure prediction. Farhat Habib
RNA secondary structure prediction Farhat Habib RNA RNA is similar to DNA chemically. It is usually only a single strand. T(hyamine) is replaced by U(racil) Some forms of RNA can form secondary structures
More informationA faster algorithm for RNA co-folding
A faster algorithm for RNA co-folding Michal Ziv-Ukelson 1, Irit Gat-Viks 2, Ydo Wexler 3, and Ron Shamir 4 1 Computer Science Department, Ben Gurion University of the Negev, Beer-Sheva. 2 Computational
More informationRNA Structure Prediction and Comparison. RNA folding
RNA Structure Prediction and Comparison Session 3 RNA folding Faculty of Technology robert@techfak.uni-bielefeld.de Bielefeld, WS 2013/2014 Base Pair Maximization This was the first structure prediction
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri RNA Structure Prediction Secondary
More informationJournal of Discrete Algorithms
Journal of Discrete Algorithms 9 (2011) 2 11 Contents lists available at ScienceDirect Journal of Discrete Algorithms www.elsevier.com/locate/da Fast RNA structure alignment for crossing input structures
More information98 Algorithms in Bioinformatics I, WS 06, ZBIT, D. Huson, December 6, 2006
98 Algorithms in Bioinformatics I, WS 06, ZBIT, D. Huson, December 6, 2006 8.3.1 Simple energy minimization Maximizing the number of base pairs as described above does not lead to good structure predictions.
More informationCombinatorial approaches to RNA folding Part II: Energy minimization via dynamic programming
ombinatorial approaches to RNA folding Part II: Energy minimization via dynamic programming Matthew Macauley Department of Mathematical Sciences lemson niversity http://www.math.clemson.edu/~macaule/ Math
More informationRNA Basics. RNA bases A,C,G,U Canonical Base Pairs A-U G-C G-U. Bases can only pair with one other base. wobble pairing. 23 Hydrogen Bonds more stable
RNA STRUCTURE RNA Basics RNA bases A,C,G,U Canonical Base Pairs A-U G-C G-U wobble pairing Bases can only pair with one other base. 23 Hydrogen Bonds more stable RNA Basics transfer RNA (trna) messenger
More informationproteins are the basic building blocks and active players in the cell, and
12 RN Secondary Structure Sources for this lecture: R. Durbin, S. Eddy,. Krogh und. Mitchison, Biological sequence analysis, ambridge, 1998 J. Setubal & J. Meidanis, Introduction to computational molecular
More informationRNA-Strukturvorhersage Strukturelle Bioinformatik WS16/17
RNA-Strukturvorhersage Strukturelle Bioinformatik WS16/17 Dr. Stefan Simm, 01.11.2016 simm@bio.uni-frankfurt.de RNA secondary structures a. hairpin loop b. stem c. bulge loop d. interior loop e. multi
More informationRNA Secondary Structure Prediction
RNA Secondary Structure Prediction 1 RNA structure prediction methods Base-Pair Maximization Context-Free Grammar Parsing. Free Energy Methods Covariance Models 2 The Nussinov-Jacobson Algorithm q = 9
More information13 Comparative RNA analysis
13 Comparative RNA analysis Sources for this lecture: R. Durbin, S. Eddy, A. Krogh und G. Mitchison, Biological sequence analysis, Cambridge, 1998 D.W. Mount. Bioinformatics: Sequences and Genome analysis,
More informationCombinatorial approaches to RNA folding Part I: Basics
Combinatorial approaches to RNA folding Part I: Basics Matthew Macauley Department of Mathematical Sciences Clemson University http://www.math.clemson.edu/~macaule/ Math 4500, Spring 2015 M. Macauley (Clemson)
More informationRNA$2 nd $structure$predic0on
RNA$2 nd $structure$predic0on Recall Nucleic Acids - RNA and DNA The carrier of genetic information - The blueprints of proteins Nucleotides Bases Adenine (A) Guanine (G) Cytosine(C) Thymine(T) Uracil
More informationSyddansk Universitet. A phase transition in energy-filtered RNA secondary structures. Han, Hillary Siwei; Reidys, Christian
Syddansk Universitet A phase transition in energy-filtered RNA secondary structures Han, Hillary Siwei; Reidys, Christian Published in: Journal of Computational Biology DOI: 10.1089/cmb.2012.0151 Publication
More informationDNA/RNA Structure Prediction
C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Master Course DNA/Protein Structurefunction Analysis and Prediction Lecture 12 DNA/RNA Structure Prediction Epigenectics Epigenomics:
More informationRNA Secondary Structure Prediction
RN Secondary Structure Prediction Perry Hooker S 531: dvanced lgorithms Prof. Mike Rosulek University of Montana December 10, 2010 Introduction Ribonucleic acid (RN) is a macromolecule that is essential
More informationStructure-Based Comparison of Biomolecules
Structure-Based Comparison of Biomolecules Benedikt Christoph Wolters Seminar Bioinformatics Algorithms RWTH AACHEN 07/17/2015 Outline 1 Introduction and Motivation Protein Structure Hierarchy Protein
More informationComputational Approaches for determination of Most Probable RNA Secondary Structure Using Different Thermodynamics Parameters
Computational Approaches for determination of Most Probable RNA Secondary Structure Using Different Thermodynamics Parameters 1 Binod Kumar, Assistant Professor, Computer Sc. Dept, ISTAR, Vallabh Vidyanagar,
More informationBIOINF 4120 Bioinforma2cs 2 - Structures and Systems -
BIOINF 4120 Bioinforma2cs 2 - Structures and Systems - Oliver Kohlbacher Summer 2014 3. RNA Structure Part II Overview RNA Folding Free energy as a criterion Folding free energy of RNA Zuker- SCegler algorithm
More informationDynamic Programming 1
Dynamic Programming 1 lgorithmic Paradigms Divide-and-conquer. Break up a problem into two sub-problems, solve each sub-problem independently, and combine solution to sub-problems to form solution to original
More informationSparsification of RNA structure prediction including pseudoknots
SEARCH Sparsification of RNA structure prediction including pseudoknots Mathias Möhl 1, Raheleh Salari 2, Sebastian ill 1,3, Rolf Backofen 1,4*, S Cenk Sahinalp 2* Open Access Abstract Background: Although
More informationA tutorial on RNA folding methods and resources
A tutorial on RNA folding methods and resources Alain Denise, LRI/IGM, Université Paris-Sud with invaluable help from Yann Ponty, CNRS/Ecole Polytechnique 1 Master BIBS 2014-2015 Goals To help your work
More informationOn low energy barrier folding pathways for nucleic acid sequences
On low energy barrier folding pathways for nucleic acid sequences Leigh-Anne Mathieson and Anne Condon U. British Columbia, Department of Computer Science, Vancouver, BC, Canada Abstract. Secondary structure
More informationMolecular Modelling. part of Bioinformatik von RNA- und Proteinstrukturen. Sonja Prohaska. Leipzig, SS Computational EvoDevo University Leipzig
part of Bioinformatik von RNA- und Proteinstrukturen Computational EvoDevo University Leipzig Leipzig, SS 2011 Protein Structure levels or organization Primary structure: sequence of amino acids (from
More informationCSE 202 Dynamic Programming II
CSE 202 Dynamic Programming II Chapter 6 Dynamic Programming Slides by Kevin Wayne. Copyright 2005 Pearson-Addison Wesley. All rights reserved. 1 Algorithmic Paradigms Greed. Build up a solution incrementally,
More informationStatistical process control of the stochastic complexity of discrete processes
UDC 59.84 59.876. S p e c i a l G u e s t I s s u e CDQM, Volume 8, umber, 5, pp. 55-6 COMMUICATIOS I DEPEDABILITY AD QUALITY MAAGEMET An International Journal Statistical process control of the stochastic
More informationPairwise RNA Edit Distance
Pairwise RNA Edit Distance In the foowing: Sequences S 1 and S 2 associated structures P 1 and P 2 scoring of aignment: different edit operations arc atering arc removing 1) ACGUUGACUGACAACAC..(((...)))...
More informationRNA Folding and Interaction Prediction: A Survey
RNA Folding and Interaction Prediction: A Survey Syed Ali Ahmed Graduate Center, City University of New York New York, NY November 19, 2015 Abstract The problem of computationally predicting the structure
More informationRapid Dynamic Programming Algorithms for RNA Secondary Structure
ADVANCES IN APPLIED MATHEMATICS 7,455-464 I f Rapid Dynamic Programming Algorithms for RNA Secondary Structure MICHAEL S. WATERMAN* Depurtments of Muthemutics und of Biologicul Sciences, Universitk of
More informationLocal Alignment of RNA Sequences with Arbitrary Scoring Schemes
Local Alignment of RNA Sequences with Arbitrary Scoring Schemes Rolf Backofen 1, Danny Hermelin 2, ad M. Landau 2,3, and Oren Weimann 4 1 Institute of omputer Science, Albert-Ludwigs niversität Freiburg,
More informationClassified Dynamic Programming
Bled, Feb. 2009 Motivation Our topic: Programming methodology A trade-off in dynamic programming between search space design and evaluation of candidates A trade-off between modifying your code and adding
More informationLecture 12. DNA/RNA Structure Prediction. Epigenectics Epigenomics: Gene Expression
C N F O N G A V B O N F O M A C S V U Master Course DNA/Protein Structurefunction Analysis and Prediction Lecture 12 DNA/NA Structure Prediction pigenectics pigenomics: Gene xpression ranscription factors
More informationA Structure-Based Flexible Search Method for Motifs in RNA
JOURNAL OF COMPUTATIONAL BIOLOGY Volume 14, Number 7, 2007 Mary Ann Liebert, Inc. Pp. 908 926 DOI: 10.1089/cmb.2007.0061 A Structure-Based Flexible Search Method for Motifs in RNA ISANA VEKSLER-LUBLINSKY,
More informationRecitaLon CB Lecture #10 RNA Secondary Structure
RecitaLon 3-19 CB Lecture #10 RNA Secondary Structure 1 Announcements 2 Exam 1 grades and answer key will be posted Friday a=ernoon We will try to make exams available for pickup Friday a=ernoon (probably
More informationThe Ensemble of RNA Structures Example: some good structures of the RNA sequence
The Ensemble of RNA Structures Example: some good structures of the RNA sequence GGGGGUAUAGCUCAGGGGUAGAGCAUUUGACUGCAGAUCAAGAGGUCCCUGGUUCAAAUCCAGGUGCCCCCU free energy in kcal/mol (((((((..((((...))))...((((...))))(((((...)))))))))))).
More informationMotivating the need for optimal sequence alignments...
1 Motivating the need for optimal sequence alignments... 2 3 Note that this actually combines two objectives of optimal sequence alignments: (i) use the score of the alignment o infer homology; (ii) use
More informationBIOINFORMATICS. Fast evaluation of internal loops in RNA secondary structure prediction. Abstract. Introduction
BIOINFORMATICS Fast evaluation of internal loops in RNA secondary structure prediction Abstract Motivation: Though not as abundant in known biological processes as proteins, RNA molecules serve as more
More informationA Method for Aligning RNA Secondary Structures
Method for ligning RN Secondary Structures Jason T. L. Wang New Jersey Institute of Technology J Liu, JTL Wang, J Hu and B Tian, BM Bioinformatics, 2005 1 Outline Introduction Structural alignment of RN
More informationSequence analysis and Genomics
Sequence analysis and Genomics October 12 th November 23 rd 2 PM 5 PM Prof. Peter Stadler Dr. Katja Nowick Katja: group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute
More informationAlgorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot
More informationRegular expression constrained sequence alignment revisited
Regular expression constrained sequence alignment revisited Gregory Kucherov, Tamar Pinhas, Michal Ziv-Ukelson To cite this version: Gregory Kucherov, Tamar Pinhas, Michal Ziv-Ukelson. Regular expression
More informationTandem Mass Spectrometry: Generating function, alignment and assembly
Tandem Mass Spectrometry: Generating function, alignment and assembly With slides from Sangtae Kim and from Jones & Pevzner 2004 Determining reliability of identifications Can we use Target/Decoy to estimate
More informationLecture 4: September 19
CSCI1810: Computational Molecular Biology Fall 2017 Lecture 4: September 19 Lecturer: Sorin Istrail Scribe: Cyrus Cousins Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes
More informationImpact Of The Energy Model On The Complexity Of RNA Folding With Pseudoknots
Impact Of The Energy Model On The omplexity Of RN Folding With Pseudoknots Saad Sheikh, Rolf Backofen Yann Ponty, niversity of Florida, ainesville, S lbert Ludwigs niversity, Freiburg, ermany LIX, NRS/Ecole
More informationPredicting RNA Secondary Structure
7.91 / 7.36 / BE.490 Lecture #6 Mar. 11, 2004 Predicting RNA Secondary Structure Chris Burge Review of Markov Models & DNA Evolution CpG Island HMM The Viterbi Algorithm Real World HMMs Markov Models for
More informationBio nformatics. Lecture 23. Saad Mneimneh
Bio nformatics Lecture 23 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely
More informationDANNY BARASH ABSTRACT
JOURNAL OF COMPUTATIONAL BIOLOGY Volume 11, Number 6, 2004 Mary Ann Liebert, Inc. Pp. 1169 1174 Spectral Decomposition for the Search and Analysis of RNA Secondary Structure DANNY BARASH ABSTRACT Scales
More informationMaximum sum contiguous subsequence Longest common subsequence Matrix chain multiplication All pair shortest path Kna. Dynamic Programming
Dynamic Programming Arijit Bishnu arijit@isical.ac.in Indian Statistical Institute, India. August 31, 2015 Outline 1 Maximum sum contiguous subsequence 2 Longest common subsequence 3 Matrix chain multiplication
More informationEfficient Cache-oblivious String Algorithms for Bioinformatics
Efficient Cache-oblivious String Algorithms for ioinformatics Rezaul Alam Chowdhury Hai-Son Le Vijaya Ramachandran UTCS Technical Report TR-07-03 February 5, 2007 Abstract We present theoretical and experimental
More informationSequence and Structure Alignment Z. Luthey-Schulten, UIUC Pittsburgh, 2006 VMD 1.8.5
Sequence and Structure Alignment Z. Luthey-Schulten, UIUC Pittsburgh, 2006 VMD 1.8.5 Why Look at More Than One Sequence? 1. Multiple Sequence Alignment shows patterns of conservation 2. What and how many
More informationToday s Outline. CS 362, Lecture 13. Matrix Chain Multiplication. Paranthesizing Matrices. Matrix Multiplication. Jared Saia University of New Mexico
Today s Outline CS 362, Lecture 13 Jared Saia University of New Mexico Matrix Multiplication 1 Matrix Chain Multiplication Paranthesizing Matrices Problem: We are given a sequence of n matrices, A 1, A
More informationProtein folding. α-helix. Lecture 21. An α-helix is a simple helix having on average 10 residues (3 turns of the helix)
Computat onal Biology Lecture 21 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely
More information6. DYNAMIC PROGRAMMING I
6. DYNAMIC PRORAMMIN I weighted interval scheduling segmented least squares knapsack problem RNA secondary structure Lecture slides by Kevin Wayne Copyright 2005 Pearson-Addison Wesley http://www.cs.princeton.edu/~wayne/kleinberg-tardos
More informationAlgorithmic Aspects of RNA Secondary Structures
Algorithmic Aspects of RNA Secondary Structures Stéphane Vialette CNRS & LIGM, Université Paris-Est Marne-la-Vallée, France 214-115 S. Vialette (CNRS & LIGM) RNA Secondary Structures 214-215 1 / 124 Introduction
More informationCONTRAfold: RNA Secondary Structure Prediction without Physics-Based Models
Supplementary Material for CONTRAfold: RNA Secondary Structure Prediction without Physics-Based Models Chuong B Do, Daniel A Woods, and Serafim Batzoglou Stanford University, Stanford, CA 94305, USA, {chuongdo,danwoods,serafim}@csstanfordedu,
More informationPairwise Alignment. Guan-Shieng Huang. Dept. of CSIE, NCNU. Pairwise Alignment p.1/55
Pairwise Alignment Guan-Shieng Huang shieng@ncnu.edu.tw Dept. of CSIE, NCNU Pairwise Alignment p.1/55 Approach 1. Problem definition 2. Computational method (algorithms) 3. Complexity and performance Pairwise
More informationCSCE 222 Discrete Structures for Computing. Dr. Hyunyoung Lee
CSCE 222 Discrete Structures for Computing Sequences and Summations Dr. Hyunyoung Lee Based on slides by Andreas Klappenecker 1 Sequences 2 Sequences A sequence is a function from a subset of the set of
More informationComputational approaches for RNA energy parameter estimation
omputational approaches for RNA energy parameter estimation by Mirela Ştefania Andronescu M.Sc., The University of British olumbia, 2003 B.Sc., Bucharest Academy of Economic Studies, 1999 A THESIS SUBMITTED
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of omputer Science San José State University San José, alifornia, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Pairwise Sequence Alignment Homology
More informationComputational Biology Lecture 5: Time speedup, General gap penalty function Saad Mneimneh
Computational Biology Lecture 5: ime speedup, General gap penalty function Saad Mneimneh We saw earlier that it is possible to compute optimal global alignments in linear space (it can also be done for
More informationRNA-RNA interaction is NP-complete and some approximation algorithms
RNA-RNA interaction is NP-complete and some approximation algorithms Saad Mneimneh Visiting Professor, Computer Science, Hunter College of CUNY 695 Park Avenue, New York, NY 10021 saad@alum.mit.edu dedicated
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 03: Edit distance and sequence alignment Slides adapted from Dr. Shaojie Zhang (University of Central Florida) KUMC visit How many of you would like to attend
More information6. DYNAMIC PROGRAMMING I
6. DYNAMIC PROGRAMMING I weighted interval scheduling segmented least squares knapsack problem RNA secondary structure Lecture slides by Kevin Wayne Copyright 2005 Pearson-Addison Wesley Copyright 2013
More informationGrand Plan. RNA very basic structure 3D structure Secondary structure / predictions The RNA world
Grand Plan RNA very basic structure 3D structure Secondary structure / predictions The RNA world very quick Andrew Torda, April 2017 Andrew Torda 10/04/2017 [ 1 ] Roles of molecules RNA DNA proteins genetic
More informationarxiv: v3 [math.co] 17 Jan 2018
An infinite class of unsaturated rooted trees corresponding to designable RNA secondary structures arxiv:1709.08088v3 [math.co] 17 Jan 2018 Jonathan Jedwab Tara Petrie Samuel Simon 23 September 2017 (revised
More informationDAA Unit- II Greedy and Dynamic Programming. By Mrs. B.A. Khivsara Asst. Professor Department of Computer Engineering SNJB s KBJ COE, Chandwad
DAA Unit- II Greedy and Dynamic Programming By Mrs. B.A. Khivsara Asst. Professor Department of Computer Engineering SNJB s KBJ COE, Chandwad 1 Greedy Method 2 Greedy Method Greedy Principal: are typically
More informationRNA Abstract Shape Analysis
ourse: iegerich RN bstract nalysis omplete shape iegerich enter of Biotechnology Bielefeld niversity robert@techfak.ni-bielefeld.de ourse on omputational RN Biology, Tübingen, March 2006 iegerich ourse:
More informationComputing the Optimal Global Alignment Value. B = n. Score of = 1 Score of = a a c g a c g a. A = n. Classical Dynamic Programming: O(n )
Alignment Grph Alignment Mtrix Computing the Optiml Globl Alignment Vlue An Introduction to Bioinformtics Algorithms A = n c t 2 3 c c 4 g 5 g 6 7 8 9 B = n 0 c g c g 2 3 4 5 6 7 8 t 9 0 2 3 4 5 6 7 8
More informationChapter 6. Dynamic Programming. Slides by Kevin Wayne. Copyright 2005 Pearson-Addison Wesley. All rights reserved.
Chapter 6 Dynamic Programming Slides by Kevin Wayne. Copyright 2005 Pearson-Addison Wesley. All rights reserved. 1 Algorithmic Paradigms Greed. Build up a solution incrementally, myopically optimizing
More information/633 Introduction to Algorithms Lecturer: Michael Dinitz Topic: Dynamic Programming II Date: 10/12/17
601.433/633 Introduction to Algorithms Lecturer: Michael Dinitz Topic: Dynamic Programming II Date: 10/12/17 12.1 Introduction Today we re going to do a couple more examples of dynamic programming. While
More informationDynamic Programming. Shuang Zhao. Microsoft Research Asia September 5, Dynamic Programming. Shuang Zhao. Outline. Introduction.
Microsoft Research Asia September 5, 2005 1 2 3 4 Section I What is? Definition is a technique for efficiently recurrence computing by storing partial results. In this slides, I will NOT use too many formal
More informationPairwise sequence alignment
Department of Evolutionary Biology Example Alignment between very similar human alpha- and beta globins: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL G+ +VK+HGKKV A+++++AH+D++ +++++LS+LH KL GNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKL
More informationGenetic Algorithms: Basic Principles and Applications
Genetic Algorithms: Basic Principles and Applications C. A. MURTHY MACHINE INTELLIGENCE UNIT INDIAN STATISTICAL INSTITUTE 203, B.T.ROAD KOLKATA-700108 e-mail: murthy@isical.ac.in Genetic algorithms (GAs)
More informationNewly made RNA is called primary transcript and is modified in three ways before leaving the nucleus:
m Eukaryotic mrna processing Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus: Cap structure a modified guanine base is added to the 5 end. Poly-A tail
More informationEnumerating Binary Strings
International Mathematical Forum, Vol. 7, 2012, no. 38, 1865-1876 Enumerating Binary Strings without r-runs of Ones M. A. Nyblom School of Mathematics and Geospatial Science RMIT University Melbourne,
More informationLexical Analysis. Reinhard Wilhelm, Sebastian Hack, Mooly Sagiv Saarland University, Tel Aviv University.
Lexical Analysis Reinhard Wilhelm, Sebastian Hack, Mooly Sagiv Saarland University, Tel Aviv University http://compilers.cs.uni-saarland.de Compiler Construction Core Course 2017 Saarland University Today
More informationPairwise alignment, Gunnar Klau, November 9, 2005, 16:
Pairwise alignment, Gunnar Klau, November 9, 2005, 16:36 2012 2.1 Growth rates For biological sequence analysis, we prefer algorithms that have time and space requirements that are linear in the length
More informationThe Double Helix. CSE 417: Algorithms and Computational Complexity! The Central Dogma of Molecular Biology! DNA! RNA! Protein! Protein!
The Double Helix SE 417: lgorithms and omputational omplexity! Winter 29! W. L. Ruzzo! Dynamic Programming, II" RN Folding! http://www.rcsb.org/pdb/explore.do?structureid=1t! Los lamos Science The entral
More informationDynamic Programming. Weighted Interval Scheduling. Algorithmic Paradigms. Dynamic Programming
lgorithmic Paradigms Dynamic Programming reed Build up a solution incrementally, myopically optimizing some local criterion Divide-and-conquer Break up a problem into two sub-problems, solve each sub-problem
More informationMath 8803/4803, Spring 2008: Discrete Mathematical Biology
Math 8803/4803, Spring 2008: Discrete Mathematical Biology Prof. hristine Heitsch School of Mathematics eorgia Institute of Technology Lecture 12 February 4, 2008 Levels of RN structure Selective base
More informationCSCI Final Project Report A Parallel Implementation of Viterbi s Decoding Algorithm
CSCI 1760 - Final Project Report A Parallel Implementation of Viterbi s Decoding Algorithm Shay Mozes Brown University shay@cs.brown.edu Abstract. This report describes parallel Java implementations of
More informationFinding Consensus Energy Folding Landscapes Between RNA Sequences
University of Central Florida Electronic Theses and Dissertations Masters Thesis (Open Access) Finding Consensus Energy Folding Landscapes Between RNA Sequences 2015 Joshua Burbridge University of Central
More informationComputational Biology: Basics & Interesting Problems
Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information
More informationComputing the partition function and sampling for saturated secondary structures of RNA, with respect to the Turner energy model
Computing the partition function and sampling for saturated secondary structures of RNA, with respect to the Turner energy model J. Waldispühl 1,3 P. Clote 1,2, 1 Department of Biology, Higgins 355, Boston
More information114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009
114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009 9 Protein tertiary structure Sources for this chapter, which are all recommended reading: D.W. Mount. Bioinformatics: Sequences and Genome
More informationAnalysis of tree edit distance algorithms
Analysis of tree edit distance algorithms Serge Dulucq 1 and Hélène Touzet 1 LaBRI - Universit Bordeaux I 33 0 Talence cedex, France Serge.Dulucq@labri.fr LIFL - Universit Lille 1 9 6 Villeneuve d Ascq
More informationRNA Search and! Motif Discovery" Genome 541! Intro to Computational! Molecular Biology"
RNA Search and! Motif Discovery" Genome 541! Intro to Computational! Molecular Biology" Day 1" Many biologically interesting roles for RNA" RNA secondary structure prediction" 3 4 Approaches to Structure
More information