Lecture 4: September 19

Size: px
Start display at page:

Download "Lecture 4: September 19"

Transcription

1 CSCI1810: Computational Molecular Biology Fall 2017 Lecture 4: September 19 Lecturer: Sorin Istrail Scribe: Cyrus Cousins Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes have not been subjected to the usual scrutiny reserved for formal publications. They may be distributed outside this class only with the permission of the Instructor. 4.1 Time Complexity of Global lignment In complexity analysis, the question we are asking is, how long does it take to run an algorithm? Four our purposes, assignment, comparisons, and arithmetic all take one unit of time. The time complexity of the Needleman-Wunsch algorithm is a function of the input sequences x and y. In this case, the same number of operations are required for any input sequences, so long as they are held constant, so all that matter are the lengths of these sequences, m and n. In the end, we will be performing asymptotic complexity analysis, which eliminates constant factors, so we re not too concerned with getting the exact number of each operation correct. Instead, we re concerned with how the number of operations changes as a function of m and n. Recall from the previous lecture, the pseudocode for the Needleman-Wunsch algorithm is as follows: 1: function Global lignment(x Σ m, y Σ n 2: S 0,0 0 3: for i {1, 2,..., m} do 4: S i,0 S i 1,0 + δ(x i,- 5: end for 6: for j {1, 2,..., n} do 7: S 0,j S 0,j 1 + δ(-, y i 8: for i {1, 2,..., m} do S i 1,j 1 + δ(x i, y i 9: S i,j max S i 1,j + δ(x i,- S i,j 1 + δ(-, y i 10: end for 11: end for 12: return S m,n 13: end function Line 2 requires 1 operation. Line 4 requires 3 operations, and is repeated m times. Line 7 requires 3 operations, and is repeated n times. Line 9 requires 9 operations, and is repeated mn times. Line 12 is a single operation. In order to simplify the analysis of this expression, we use what is called asymptotic notation, wherein constant factors do not matter. Specifically, we will use big-oh notation, which is used to take an upper 4-1

2 4-2 Lecture 4: September 19 bound on the asymptotic performance of an algorithm. By asymptotic performance, we mean that we we want to describe how an algorithm performs as the size of the input tends to infinity. Formally, we say that if m lim f(n, n,m g(n, m < then f(n, m O(n, m. Informally, this means that as the problem size increases (in our case, x and y get larger, the ratio between f(n, m and g(n, m converges to a constant. So in the end, we get that the time complexity of global alignment is as follows: 9mn + 3m + 3n + 2 O(9mn + 3n m = O(mn Usually, we can simply drop all but the highest order terms in an expression to obtain the simplest form of the big-oh complexity class. More formally, we can show this as follows: 9mn + 3n m lim n,m mn ( = lim 9 n,m = lim n,m m + 3 n + 1 mn ( ( lim + lim n,m m n,m n + ( lim n,m 1 mn = 9 Because this limit exists and is finite, we may conclude that 9mn + 3n m O(mn. 4.2 Local lignment Defining Local lignment So far, we have examined the problem of calculating the optimal alignment between strings x and y. We now study a related problem; that of local alignment. What if we have 2 strings, and we know that the majority of these strings differ greatly, but we want to identify the sections of each string that most strongly align to one another. motivating biological example would be if we had 2 distantly related genomes, and we wanted to identify genes that were highly conserved between the two. In this case, we can t expect the strings to align well globally, but if we can find two regions that are highly conserved between the strings, then we can expect these regions to align well. Before formalizing the above intuition and defining local alignment, we need a few definitions. prefix a of a string b is a string that may be obtained by removing characters from the end of b. Similarly, a suffix c of a string b may be obtained by removing characters from the beginning of b. Then, a substring

3 Lecture 4: September Prefixes, Suffixes, and Substrings of CTG: Prefixes: C CT CTG CTG Suffixes: G TG CTG CTG CTG Substrings: CTG CTG CT C CTG CT C CTG CT C TG T G Figure 4.1: Prefixes, Suffixes, and Subsequences or subsequence 1 a of a string b may be obtained by removing characters from either end of b (but not from the middle. See Figure 4.1 for some examples of prefixes, suffixes, and substrings. t this time, you should convince yourself that the set of all suffixes of prefixes of x is equivalent to the set of all prefixes of suffixes of x, and both are equivalent to the set of all substrings of x. We are now ready to define local alignment. The optimal local alignment of two strings x and y is simply the optimal global alignment of any x, y such that x is a substring of x and y is a substring of y. This definition is deceptively simple. Note that it encapsulates our intuition, allowing us to identify regions of two strings that align well, even when the remainder of the strings aligns poorly. Furthermore, we shall soon see an efficient algorithm (Smith-Waterman exists to calculate optimal local alignments that is asymptotically equivalent to the Needleman-Wunsch algorithm for global alignment Naïvely Computing Optimal Local lignments With the definition provided above, we have all the tools we need to calculate local alignments. We simply enumerate over all pairs of substrings of x and y, and evaluate the global alignment score of each, and in the end take the maximum over all such scores. So we could just apply our global alignment algorithm for every pair of subsequences. But how many pairs of subsequences are there, and how long would this take? simple counting argument 2 tells us that there are no more than ( ( n unique subsequences of a string of length n, and thus n+1 ( m pairs of substrings of x and y. Enumerating them, and running a O(nm algorithm on each pair thus runs in O(n 3 m 3 time. This is asymptotically inferior to the Smith-Waterman algorithm, and is prohibitively expensive for aligning long sequences. In the next section, we come up with a more sophisticated algorithm that efficiently computes local alignments. 1 Note that some authors define subsequence such that characters to be removed from the middle of a sequence; This definition is not of interest to us in this context. The term substring is generally less ambiguous. 2 Either we may select the empty subsequence, or we may select two distinct values a, b in {0, 1,..., n}, and take the substring x a, x a+1,..., x b.

4 4-4 Lecture 4: September Computing Optimal Local lignments Recall that the optimal substructure property of global alignment ensures that S i,j is the score of the optimal alignment of the first i characters of x and the first j characters of y. In other words, by taking the maximum over S, we can calculate the optimal alignment score over all prefixes of x and y. Recall that substrings are suffixes of prefixes, and note that we re already halfway to a solution. In order to handle suffixes, we introduce another trick. s we align the strings x and y, we need to consider that we can start the alignment at any character of x and any character of y, as this is equivalent to choosing suffixes. Now, suppose we have suffixes x b, y b such that x = x a x b and y = y a y b, where denotes concatenation. If the alignment score of x b and y b can be improved by extending the suffixes, then we should do so, but if it can not, then we should not. We can represent this resetting by adding a 0 term to the maximum in our recurrence relationship. By doing this, we ensure that we start a new prefix when doing so yields a higher alignment score than not doing so. Combining these two techniques, by adding a 0 term to the maximum of the recurrence relationship, and identifying the highest scoring cell in the entire matrix, we identify the optimal suffix of the optimal prefix, or equivalently the optimal substring. Recall that the recurrence relationship for local alignment is as follows: V 0,0 = 0 0 V V i,j = max i 1,j 1 + δ(x i, y j V i 1,j + δ(x i, - V i,j 1 + δ(-, y i We now translate this recurrence into pseudocode to calculate the optimal local alignment score between strings x and y. Local Pairwise lignment Given: 1. Sequence x Σ m. 2. Sequence y Σ n. 3. Similarity matrix δ. Produce: The optimal global alignment similarity score over any strings x, y where x is a substring of x and y a substring of y. 1: function Local lignment(x Σ m, y Σ n 2: for i {0, 1, 2,..., m} do 3: V i,0 0 4: end for 5: for j {1, 2,..., n} do 6: V 0,j 0 7: end for 8: for j {1, 2,..., n} do

5 Lecture 4: September : for i {1, 2,..., m} do 0 V 10: V i,j max i 1,j 1 + δ(x i, y i V i 1,j + δ(x i, V i,j 1 + δ(, y i 11: end for 12: end for 13: return max V i,j i {0, 1,..., m} j {0, 1,..., n} 14: end function Note that this algorithm differs from local alignment in only a few ways. V i,0 and V 0,j are now initialized to 0 (this follows from the assumption that δ(x,- and δ(-, x are negative, which is a bit simpler, the maximum on line now includes a 0, requiring one additional comparison, and on line 13, we need to take the maximum score over the entire matrix, rather than just returning V m,n Local lignment and Scoring Functions So far, when discussing global alignment we have mostly been considering the unit cost function. In global alignment, the actual cost values of a scoring matrix can be adjusted by adding a to each match/mismatch and a 2 to each gap (you should convince yourself that any alignment over x, y of lengths m, n changes score by exactly a(m+n 2, and thus that the relative scores between alignments don t change. In local alignment, this is not the case: notably, if all entries of δ are positive, the optimal local alignment will be the optimal global alignment (as the 0 term of the maximum is never taken, and scores increase monotonically as i, j increase, thus the maximum score will occur at cell V i,j, and if all entries of δ are negative, the optimal local alignment will be the empty alignment. Furthermore, we also require that gap costs are nonpositive, otherwise the initialization as given above is incorrect. reasonable way to handle this situation is to set δ i,j = 1 for all gaps and mismatches, and 1 for matches.

Lecture 5: September Time Complexity Analysis of Local Alignment

Lecture 5: September Time Complexity Analysis of Local Alignment CSCI1810: Computational Molecular Biology Fall 2017 Lecture 5: September 21 Lecturer: Sorin Istrail Scribe: Cyrus Cousins Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes

More information

Analysis and Design of Algorithms Dynamic Programming

Analysis and Design of Algorithms Dynamic Programming Analysis and Design of Algorithms Dynamic Programming Lecture Notes by Dr. Wang, Rui Fall 2008 Department of Computer Science Ocean University of China November 6, 2009 Introduction 2 Introduction..................................................................

More information

Lecture 1: September 25

Lecture 1: September 25 0-725: Optimization Fall 202 Lecture : September 25 Lecturer: Geoff Gordon/Ryan Tibshirani Scribes: Subhodeep Moitra Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes have

More information

CMPSCI 311: Introduction to Algorithms Second Midterm Exam

CMPSCI 311: Introduction to Algorithms Second Midterm Exam CMPSCI 311: Introduction to Algorithms Second Midterm Exam April 11, 2018. Name: ID: Instructions: Answer the questions directly on the exam pages. Show all your work for each question. Providing more

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of omputer Science San José State University San José, alifornia, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Pairwise Sequence Alignment Homology

More information

10-704: Information Processing and Learning Fall Lecture 9: Sept 28

10-704: Information Processing and Learning Fall Lecture 9: Sept 28 10-704: Information Processing and Learning Fall 2016 Lecturer: Siheng Chen Lecture 9: Sept 28 Note: These notes are based on scribed notes from Spring15 offering of this course. LaTeX template courtesy

More information

Pairwise alignment, Gunnar Klau, November 9, 2005, 16:

Pairwise alignment, Gunnar Klau, November 9, 2005, 16: Pairwise alignment, Gunnar Klau, November 9, 2005, 16:36 2012 2.1 Growth rates For biological sequence analysis, we prefer algorithms that have time and space requirements that are linear in the length

More information

10-704: Information Processing and Learning Fall Lecture 10: Oct 3

10-704: Information Processing and Learning Fall Lecture 10: Oct 3 0-704: Information Processing and Learning Fall 206 Lecturer: Aarti Singh Lecture 0: Oct 3 Note: These notes are based on scribed notes from Spring5 offering of this course. LaTeX template courtesy of

More information

Sequence analysis and Genomics

Sequence analysis and Genomics Sequence analysis and Genomics October 12 th November 23 rd 2 PM 5 PM Prof. Peter Stadler Dr. Katja Nowick Katja: group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute

More information

Sequence Alignment (chapter 6)

Sequence Alignment (chapter 6) Sequence lignment (chapter 6) he biological problem lobal alignment Local alignment Multiple alignment Introduction to bioinformatics, utumn 6 Background: comparative genomics Basic question in biology:

More information

Lecture 2: Pairwise Alignment. CG Ron Shamir

Lecture 2: Pairwise Alignment. CG Ron Shamir Lecture 2: Pairwise Alignment 1 Main source 2 Why compare sequences? Human hexosaminidase A vs Mouse hexosaminidase A 3 www.mathworks.com/.../jan04/bio_genome.html Sequence Alignment עימוד רצפים The problem:

More information

Lecture 14: October 11

Lecture 14: October 11 10-725: Optimization Fall 2012 Lecture 14: October 11 Lecturer: Geoff Gordon/Ryan Tibshirani Scribes: Zitao Liu Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes have not

More information

CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I)

CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) Contents Alignment algorithms Needleman-Wunsch (global alignment) Smith-Waterman (local alignment) Heuristic algorithms FASTA BLAST

More information

Computational Molecular Biology

Computational Molecular Biology Computational Molecular Biology Shivam Nadimpalli Last updated: December 6, 2018 Hello! These are notes for CS 181 Computational Molecular Biology at Brown University, taught by Professor Sorin Istrail

More information

Pair Hidden Markov Models

Pair Hidden Markov Models Pair Hidden Markov Models Scribe: Rishi Bedi Lecturer: Serafim Batzoglou January 29, 2015 1 Recap of HMMs alphabet: Σ = {b 1,...b M } set of states: Q = {1,..., K} transition probabilities: A = [a ij ]

More information

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot

More information

Bio nformatics. Lecture 3. Saad Mneimneh

Bio nformatics. Lecture 3. Saad Mneimneh Bio nformatics Lecture 3 Sequencing As before, DNA is cut into small ( 0.4KB) fragments and a clone library is formed. Biological experiments allow to read a certain number of these short fragments per

More information

Lecture 5: September 12

Lecture 5: September 12 10-725/36-725: Convex Optimization Fall 2015 Lecture 5: September 12 Lecturer: Lecturer: Ryan Tibshirani Scribes: Scribes: Barun Patra and Tyler Vuong Note: LaTeX template courtesy of UC Berkeley EECS

More information

/633 Introduction to Algorithms Lecturer: Michael Dinitz Topic: Dynamic Programming II Date: 10/12/17

/633 Introduction to Algorithms Lecturer: Michael Dinitz Topic: Dynamic Programming II Date: 10/12/17 601.433/633 Introduction to Algorithms Lecturer: Michael Dinitz Topic: Dynamic Programming II Date: 10/12/17 12.1 Introduction Today we re going to do a couple more examples of dynamic programming. While

More information

Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment

Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value

More information

Lecture 17: Primal-dual interior-point methods part II

Lecture 17: Primal-dual interior-point methods part II 10-725/36-725: Convex Optimization Spring 2015 Lecture 17: Primal-dual interior-point methods part II Lecturer: Javier Pena Scribes: Pinchao Zhang, Wei Ma Note: LaTeX template courtesy of UC Berkeley EECS

More information

Pairwise Alignment. Guan-Shieng Huang. Dept. of CSIE, NCNU. Pairwise Alignment p.1/55

Pairwise Alignment. Guan-Shieng Huang. Dept. of CSIE, NCNU. Pairwise Alignment p.1/55 Pairwise Alignment Guan-Shieng Huang shieng@ncnu.edu.tw Dept. of CSIE, NCNU Pairwise Alignment p.1/55 Approach 1. Problem definition 2. Computational method (algorithms) 3. Complexity and performance Pairwise

More information

First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences

First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences 140.638 where do sequences come from? DNA is not hard to extract (getting DNA from a

More information

Sara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)

Sara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) Bioinformática Sequence Alignment Pairwise Sequence Alignment Universidade da Beira Interior (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) 1 16/3/29 & 23/3/29 27/4/29 Outline

More information

Lecture 6: September 12

Lecture 6: September 12 10-725: Optimization Fall 2013 Lecture 6: September 12 Lecturer: Ryan Tibshirani Scribes: Micol Marchetti-Bowick Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes have not

More information

Lecture 6: September 19

Lecture 6: September 19 36-755: Advanced Statistical Theory I Fall 2016 Lecture 6: September 19 Lecturer: Alessandro Rinaldo Scribe: YJ Choe Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes have

More information

Bioinformatics and BLAST

Bioinformatics and BLAST Bioinformatics and BLAST Overview Recap of last time Similarity discussion Algorithms: Needleman-Wunsch Smith-Waterman BLAST Implementation issues and current research Recap from Last Time Genome consists

More information

Lecture 6: September 17

Lecture 6: September 17 10-725/36-725: Convex Optimization Fall 2015 Lecturer: Ryan Tibshirani Lecture 6: September 17 Scribes: Scribes: Wenjun Wang, Satwik Kottur, Zhiding Yu Note: LaTeX template courtesy of UC Berkeley EECS

More information

Lecture 9: September 28

Lecture 9: September 28 0-725/36-725: Convex Optimization Fall 206 Lecturer: Ryan Tibshirani Lecture 9: September 28 Scribes: Yiming Wu, Ye Yuan, Zhihao Li Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These

More information

String Matching Problem

String Matching Problem String Matching Problem Pattern P Text T Set of Locations L 9/2/23 CAP/CGS 5991: Lecture 2 Computer Science Fundamentals Specify an input-output description of the problem. Design a conceptual algorithm

More information

Lecture 5,6 Local sequence alignment

Lecture 5,6 Local sequence alignment Lecture 5,6 Local sequence alignment Chapter 6 in Jones and Pevzner Fall 2018 September 4,6, 2018 Evolution as a tool for biological insight Nothing in biology makes sense except in the light of evolution

More information

20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, Global and local alignment of two sequences using dynamic programming

20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, Global and local alignment of two sequences using dynamic programming 20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, 2008 4 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance 4. Global and local alignment

More information

Computational Biology Lecture 5: Time speedup, General gap penalty function Saad Mneimneh

Computational Biology Lecture 5: Time speedup, General gap penalty function Saad Mneimneh Computational Biology Lecture 5: ime speedup, General gap penalty function Saad Mneimneh We saw earlier that it is possible to compute optimal global alignments in linear space (it can also be done for

More information

Background: comparative genomics. Sequence similarity. Homologs. Similarity vs homology (2) Similarity vs homology. Sequence Alignment (chapter 6)

Background: comparative genomics. Sequence similarity. Homologs. Similarity vs homology (2) Similarity vs homology. Sequence Alignment (chapter 6) Sequence lignment (chapter ) he biological problem lobal alignment Local alignment Multiple alignment Background: comparative genomics Basic question in biology: what properties are shared among organisms?

More information

Implementing Approximate Regularities

Implementing Approximate Regularities Implementing Approximate Regularities Manolis Christodoulakis Costas S. Iliopoulos Department of Computer Science King s College London Kunsoo Park School of Computer Science and Engineering, Seoul National

More information

Lecture 4: January 26

Lecture 4: January 26 10-725/36-725: Conve Optimization Spring 2015 Lecturer: Javier Pena Lecture 4: January 26 Scribes: Vipul Singh, Shinjini Kundu, Chia-Yin Tsai Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer:

More information

5 + 9(10) + 3(100) + 0(1000) + 2(10000) =

5 + 9(10) + 3(100) + 0(1000) + 2(10000) = Chapter 5 Analyzing Algorithms So far we have been proving statements about databases, mathematics and arithmetic, or sequences of numbers. Though these types of statements are common in computer science,

More information

Lecture 5: September 15

Lecture 5: September 15 10-725/36-725: Convex Optimization Fall 2015 Lecture 5: September 15 Lecturer: Lecturer: Ryan Tibshirani Scribes: Scribes: Di Jin, Mengdi Wang, Bin Deng Note: LaTeX template courtesy of UC Berkeley EECS

More information

10-704: Information Processing and Learning Fall Lecture 24: Dec 7

10-704: Information Processing and Learning Fall Lecture 24: Dec 7 0-704: Information Processing and Learning Fall 206 Lecturer: Aarti Singh Lecture 24: Dec 7 Note: These notes are based on scribed notes from Spring5 offering of this course. LaTeX template courtesy of

More information

Algorithm Design and Analysis

Algorithm Design and Analysis Algorithm Design and Analysis LECTURE 18 Dynamic Programming (Segmented LS recap) Longest Common Subsequence Adam Smith Segmented Least Squares Least squares. Foundational problem in statistic and numerical

More information

Lecture 15: October 15

Lecture 15: October 15 10-725: Optimization Fall 2012 Lecturer: Barnabas Poczos Lecture 15: October 15 Scribes: Christian Kroer, Fanyi Xiao Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes have

More information

Math 304 (Spring 2010) - Lecture 2

Math 304 (Spring 2010) - Lecture 2 Math 304 (Spring 010) - Lecture Emre Mengi Department of Mathematics Koç University emengi@ku.edu.tr Lecture - Floating Point Operation Count p.1/10 Efficiency of an algorithm is determined by the total

More information

Lecture 14: October 17

Lecture 14: October 17 1-725/36-725: Convex Optimization Fall 218 Lecture 14: October 17 Lecturer: Lecturer: Ryan Tibshirani Scribes: Pengsheng Guo, Xian Zhou Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer:

More information

Evolution. CT Amemiya et al. Nature 496, (2013) doi: /nature12027

Evolution. CT Amemiya et al. Nature 496, (2013) doi: /nature12027 Sequence Alignment Evolution CT Amemiya et al. Nature 496, 311-316 (2013) doi:10.1038/nature12027 Evolutionary Rates next generation OK OK OK X X Still OK? Sequence conservation implies function Alignment

More information

COMP 355 Advanced Algorithms

COMP 355 Advanced Algorithms COMP 355 Advanced Algorithms Algorithm Design Review: Mathematical Background 1 Polynomial Running Time Brute force. For many non-trivial problems, there is a natural brute force search algorithm that

More information

Lecture 24: August 28

Lecture 24: August 28 10-725: Optimization Fall 2012 Lecture 24: August 28 Lecturer: Geoff Gordon/Ryan Tibshirani Scribes: Jiaji Zhou,Tinghui Zhou,Kawa Cheung Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer:

More information

Pairwise sequence alignment

Pairwise sequence alignment Department of Evolutionary Biology Example Alignment between very similar human alpha- and beta globins: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL G+ +VK+HGKKV A+++++AH+D++ +++++LS+LH KL GNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKL

More information

Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics Lecture : p he biological problem p lobal alignment p Local alignment p Multiple alignment 6 Background: comparative genomics p Basic question in biology: what properties

More information

Streaming and communication complexity of Hamming distance

Streaming and communication complexity of Hamming distance Streaming and communication complexity of Hamming distance Tatiana Starikovskaya IRIF, Université Paris-Diderot (Joint work with Raphaël Clifford, ICALP 16) Approximate pattern matching Problem Pattern

More information

Pattern Matching (Exact Matching) Overview

Pattern Matching (Exact Matching) Overview CSI/BINF 5330 Pattern Matching (Exact Matching) Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Pattern Matching Exhaustive Search DFA Algorithm KMP Algorithm

More information

COMP 355 Advanced Algorithms Algorithm Design Review: Mathematical Background

COMP 355 Advanced Algorithms Algorithm Design Review: Mathematical Background COMP 355 Advanced Algorithms Algorithm Design Review: Mathematical Background 1 Polynomial Time Brute force. For many non-trivial problems, there is a natural brute force search algorithm that checks every

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 05: Index-based alignment algorithms Slides adapted from Dr. Shaojie Zhang (University of Central Florida) Real applications of alignment Database search

More information

Lecture 17: October 27

Lecture 17: October 27 0-725/36-725: Convex Optimiation Fall 205 Lecturer: Ryan Tibshirani Lecture 7: October 27 Scribes: Brandon Amos, Gines Hidalgo Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These

More information

11.3 Decoding Algorithm

11.3 Decoding Algorithm 11.3 Decoding Algorithm 393 For convenience, we have introduced π 0 and π n+1 as the fictitious initial and terminal states begin and end. This model defines the probability P(x π) for a given sequence

More information

Lecture 16: October 22

Lecture 16: October 22 0-725/36-725: Conve Optimization Fall 208 Lecturer: Ryan Tibshirani Lecture 6: October 22 Scribes: Nic Dalmasso, Alan Mishler, Benja LeRoy Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer:

More information

Lecture 26: April 22nd

Lecture 26: April 22nd 10-725/36-725: Conve Optimization Spring 2015 Lecture 26: April 22nd Lecturer: Ryan Tibshirani Scribes: Eric Wong, Jerzy Wieczorek, Pengcheng Zhou Note: LaTeX template courtesy of UC Berkeley EECS dept.

More information

Lecture 9: Numerical Linear Algebra Primer (February 11st)

Lecture 9: Numerical Linear Algebra Primer (February 11st) 10-725/36-725: Convex Optimization Spring 2015 Lecture 9: Numerical Linear Algebra Primer (February 11st) Lecturer: Ryan Tibshirani Scribes: Avinash Siravuru, Guofan Wu, Maosheng Liu Note: LaTeX template

More information

Lecture 10: September 26

Lecture 10: September 26 0-725: Optimization Fall 202 Lecture 0: September 26 Lecturer: Barnabas Poczos/Ryan Tibshirani Scribes: Yipei Wang, Zhiguang Huo Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These

More information

10-725/36-725: Convex Optimization Spring Lecture 21: April 6

10-725/36-725: Convex Optimization Spring Lecture 21: April 6 10-725/36-725: Conve Optimization Spring 2015 Lecturer: Ryan Tibshirani Lecture 21: April 6 Scribes: Chiqun Zhang, Hanqi Cheng, Waleed Ammar Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer:

More information

Lecture 18: November Review on Primal-dual interior-poit methods

Lecture 18: November Review on Primal-dual interior-poit methods 10-725/36-725: Convex Optimization Fall 2016 Lecturer: Lecturer: Javier Pena Lecture 18: November 2 Scribes: Scribes: Yizhu Lin, Pan Liu Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer:

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 07: profile Hidden Markov Model http://bibiserv.techfak.uni-bielefeld.de/sadr2/databasesearch/hmmer/profilehmm.gif Slides adapted from Dr. Shaojie Zhang

More information

Algorithms in Bioinformatics: A Practical Introduction. Sequence Similarity

Algorithms in Bioinformatics: A Practical Introduction. Sequence Similarity Algorithms in Bioinformatics: A Practical Introduction Sequence Similarity Earliest Researches in Sequence Comparison Doolittle et al. (Science, July 1983) searched for platelet-derived growth factor (PDGF)

More information

1 Closest Pair of Points on the Plane

1 Closest Pair of Points on the Plane CS 31: Algorithms (Spring 2019): Lecture 5 Date: 4th April, 2019 Topic: Divide and Conquer 3: Closest Pair of Points on a Plane Disclaimer: These notes have not gone through scrutiny and in all probability

More information

6.6 Sequence Alignment

6.6 Sequence Alignment 6.6 Sequence Alignment String Similarity How similar are two strings? ocurrance o c u r r a n c e - occurrence First model the problem Q. How can we measure the distance? o c c u r r e n c e 6 mismatches,

More information

Searching Sear ( Sub- (Sub )Strings Ulf Leser

Searching Sear ( Sub- (Sub )Strings Ulf Leser Searching (Sub-)Strings Ulf Leser This Lecture Exact substring search Naïve Boyer-Moore Searching with profiles Sequence profiles Ungapped approximate search Statistical evaluation of search results Ulf

More information

Lecture 14 October 13

Lecture 14 October 13 STAT 383C: Statistical Modeling I Fall 2015 Lecture 14 October 13 Lecturer: Purnamrita Sarkar Scribe: Some one Disclaimer: These scribe notes have been slightly proofread and may have typos etc. Note:

More information

Formal Definition of Computation. August 28, 2013

Formal Definition of Computation. August 28, 2013 August 28, 2013 Computation model The model of computation considered so far is the work performed by a finite automaton Finite automata were described informally, using state diagrams, and formally, as

More information

Evolutionary Models. Evolutionary Models

Evolutionary Models. Evolutionary Models Edit Operators In standard pairwise alignment, what are the allowed edit operators that transform one sequence into the other? Describe how each of these edit operations are represented on a sequence alignment

More information

Computational Genomics and Molecular Biology, Fall

Computational Genomics and Molecular Biology, Fall Computational Genomics and Molecular Biology, Fall 2014 1 HMM Lecture Notes Dannie Durand and Rose Hoberman November 6th Introduction In the last few lectures, we have focused on three problems related

More information

Objec&ves. Review. Dynamic Programming. What is the knapsack problem? What is our solu&on? Ø Review Knapsack Ø Sequence Alignment 3/28/18

Objec&ves. Review. Dynamic Programming. What is the knapsack problem? What is our solu&on? Ø Review Knapsack Ø Sequence Alignment 3/28/18 /8/8 Objec&ves Dynamic Programming Ø Review Knapsack Ø Sequence Alignment Mar 8, 8 CSCI - Sprenkle Review What is the knapsack problem? What is our solu&on? Mar 8, 8 CSCI - Sprenkle /8/8 Dynamic Programming:

More information

10-704: Information Processing and Learning Fall Lecture 21: Nov 14. sup

10-704: Information Processing and Learning Fall Lecture 21: Nov 14. sup 0-704: Information Processing and Learning Fall 206 Lecturer: Aarti Singh Lecture 2: Nov 4 Note: hese notes are based on scribed notes from Spring5 offering of this course LaeX template courtesy of UC

More information

Unsupervised Vocabulary Induction

Unsupervised Vocabulary Induction Infant Language Acquisition Unsupervised Vocabulary Induction MIT (Saffran et al., 1997) 8 month-old babies exposed to stream of syllables Stream composed of synthetic words (pabikumalikiwabufa) After

More information

Pairwise & Multiple sequence alignments

Pairwise & Multiple sequence alignments Pairwise & Multiple sequence alignments Urmila Kulkarni-Kale Bioinformatics Centre 411 007 urmila@bioinfo.ernet.in Basis for Sequence comparison Theory of evolution: gene sequences have evolved/derived

More information

Biochemistry 324 Bioinformatics. Pairwise sequence alignment

Biochemistry 324 Bioinformatics. Pairwise sequence alignment Biochemistry 324 Bioinformatics Pairwise sequence alignment How do we compare genes/proteins? When we have sequenced a genome, we try and identify the function of unknown genes by finding a similar gene

More information

Using matrices to represent linear systems

Using matrices to represent linear systems Roberto s Notes on Linear Algebra Chapter 3: Linear systems and matrices Section 4 Using matrices to represent linear systems What you need to know already: What a linear system is. What elementary operations

More information

21.2 Example 1 : Non-parametric regression in Mean Integrated Square Error Density Estimation (L 2 2 risk)

21.2 Example 1 : Non-parametric regression in Mean Integrated Square Error Density Estimation (L 2 2 risk) 10-704: Information Processing and Learning Spring 2015 Lecture 21: Examples of Lower Bounds and Assouad s Method Lecturer: Akshay Krishnamurthy Scribes: Soumya Batra Note: LaTeX template courtesy of UC

More information

On the Monotonicity of the String Correction Factor for Words with Mismatches

On the Monotonicity of the String Correction Factor for Words with Mismatches On the Monotonicity of the String Correction Factor for Words with Mismatches (extended abstract) Alberto Apostolico Georgia Tech & Univ. of Padova Cinzia Pizzi Univ. of Padova & Univ. of Helsinki Abstract.

More information

Algorithms and Data S tructures Structures Complexity Complexit of Algorithms Ulf Leser

Algorithms and Data S tructures Structures Complexity Complexit of Algorithms Ulf Leser Algorithms and Data Structures Complexity of Algorithms Ulf Leser Content of this Lecture Efficiency of Algorithms Machine Model Complexity Examples Multiplication of two binary numbers (unit cost?) Exact

More information

Math 3012 Applied Combinatorics Lecture 5

Math 3012 Applied Combinatorics Lecture 5 September 1, 2015 Math 3012 Applied Combinatorics Lecture 5 William T. Trotter trotter@math.gatech.edu Test 1 and Homework Due Date Reminder Test 1, Thursday September 17, 2015. Taken here in MRDC 2404.

More information

Lecture 6: September 22

Lecture 6: September 22 CS294 Markov Chain Monte Carlo: Foundations & Applications Fall 2009 Lecture 6: September 22 Lecturer: Prof. Alistair Sinclair Scribes: Alistair Sinclair Disclaimer: These notes have not been subjected

More information

Dynamic Programming. Shuang Zhao. Microsoft Research Asia September 5, Dynamic Programming. Shuang Zhao. Outline. Introduction.

Dynamic Programming. Shuang Zhao. Microsoft Research Asia September 5, Dynamic Programming. Shuang Zhao. Outline. Introduction. Microsoft Research Asia September 5, 2005 1 2 3 4 Section I What is? Definition is a technique for efficiently recurrence computing by storing partial results. In this slides, I will NOT use too many formal

More information

8 Grundlagen der Bioinformatik, SS 09, D. Huson, April 28, 2009

8 Grundlagen der Bioinformatik, SS 09, D. Huson, April 28, 2009 8 Grundlagen der Bioinformatik, SS 09, D. Huson, April 28, 2009 2 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance and alignment 4. The number

More information

Lecture 2: Asymptotic Notation CSCI Algorithms I

Lecture 2: Asymptotic Notation CSCI Algorithms I Lecture 2: Asymptotic Notation CSCI 700 - Algorithms I Andrew Rosenberg September 2, 2010 Last Time Review Insertion Sort Analysis of Runtime Proof of Correctness Today Asymptotic Notation Its use in analyzing

More information

String Matching. Thanks to Piotr Indyk. String Matching. Simple Algorithm. for s 0 to n-m. Match 0. for j 1 to m if T[s+j] P[j] then

String Matching. Thanks to Piotr Indyk. String Matching. Simple Algorithm. for s 0 to n-m. Match 0. for j 1 to m if T[s+j] P[j] then String Matching Thanks to Piotr Indyk String Matching Input: Two strings T[1 n] and P[1 m], containing symbols from alphabet Σ Goal: find all shifts 0 s n-m such that T[s+1 s+m]=p Example: Σ={,a,b,,z}

More information

Recursion. Slides by Christopher M. Bourke Instructor: Berthe Y. Choueiry. Fall 2007

Recursion. Slides by Christopher M. Bourke Instructor: Berthe Y. Choueiry. Fall 2007 Slides by Christopher M. Bourke Instructor: Berthe Y. Choueiry Fall 2007 1 / 47 Computer Science & Engineering 235 to Discrete Mathematics Sections 7.1-7.2 of Rosen Recursive Algorithms 2 / 47 A recursive

More information

CS294: Pseudorandomness and Combinatorial Constructions September 13, Notes for Lecture 5

CS294: Pseudorandomness and Combinatorial Constructions September 13, Notes for Lecture 5 UC Berkeley Handout N5 CS94: Pseudorandomness and Combinatorial Constructions September 3, 005 Professor Luca Trevisan Scribe: Gatis Midrijanis Notes for Lecture 5 In the few lectures we are going to look

More information

Dynamic Programming. Weighted Interval Scheduling. Algorithmic Paradigms. Dynamic Programming

Dynamic Programming. Weighted Interval Scheduling. Algorithmic Paradigms. Dynamic Programming lgorithmic Paradigms Dynamic Programming reed Build up a solution incrementally, myopically optimizing some local criterion Divide-and-conquer Break up a problem into two sub-problems, solve each sub-problem

More information

8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011

8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011 8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011 2 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance and alignment 4. The number

More information

Recursion: Introduction and Correctness

Recursion: Introduction and Correctness Recursion: Introduction and Correctness CSE21 Winter 2017, Day 7 (B00), Day 4-5 (A00) January 25, 2017 http://vlsicad.ucsd.edu/courses/cse21-w17 Today s Plan From last time: intersecting sorted lists and

More information

Measuring Goodness of an Algorithm. Asymptotic Analysis of Algorithms. Measuring Efficiency of an Algorithm. Algorithm and Data Structure

Measuring Goodness of an Algorithm. Asymptotic Analysis of Algorithms. Measuring Efficiency of an Algorithm. Algorithm and Data Structure Measuring Goodness of an Algorithm Asymptotic Analysis of Algorithms EECS2030 B: Advanced Object Oriented Programming Fall 2018 CHEN-WEI WANG 1. Correctness : Does the algorithm produce the expected output?

More information

Knuth-Morris-Pratt Algorithm

Knuth-Morris-Pratt Algorithm Knuth-Morris-Pratt Algorithm Jayadev Misra June 5, 2017 The Knuth-Morris-Pratt string matching algorithm (KMP) locates all occurrences of a pattern string in a text string in linear time (in the combined

More information

Introduction to sequence alignment. Local alignment the Smith-Waterman algorithm

Introduction to sequence alignment. Local alignment the Smith-Waterman algorithm Lecture 2, 12/3/2003: Introduction to sequence alignment The Needleman-Wunsch algorithm for global sequence alignment: description and properties Local alignment the Smith-Waterman algorithm 1 Computational

More information

Lecture 25: November 27

Lecture 25: November 27 10-725: Optimization Fall 2012 Lecture 25: November 27 Lecturer: Ryan Tibshirani Scribes: Matt Wytock, Supreeth Achar Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes have

More information

Menu. Lecture 2: Orders of Growth. Predicting Running Time. Order Notation. Predicting Program Properties

Menu. Lecture 2: Orders of Growth. Predicting Running Time. Order Notation. Predicting Program Properties CS216: Program and Data Representation University of Virginia Computer Science Spring 2006 David Evans Lecture 2: Orders of Growth Menu Predicting program properties Orders of Growth: O, Ω Course Survey

More information

Global alignments - review

Global alignments - review Global alignments - review Take two sequences: X[j] and Y[j] M[i-1, j-1] ± 1 M[i, j] = max M[i, j-1] 2 M[i-1, j] 2 The best alignment for X[1 i] and Y[1 j] is called M[i, j] X[j] Initiation: M[,]= pply

More information

Lecture 23: November 19

Lecture 23: November 19 10-725/36-725: Conve Optimization Fall 2018 Lecturer: Ryan Tibshirani Lecture 23: November 19 Scribes: Charvi Rastogi, George Stoica, Shuo Li Charvi Rastogi: 23.1-23.4.2, George Stoica: 23.4.3-23.8, Shuo

More information

BLAST: Target frequencies and information content Dannie Durand

BLAST: Target frequencies and information content Dannie Durand Computational Genomics and Molecular Biology, Fall 2016 1 BLAST: Target frequencies and information content Dannie Durand BLAST has two components: a fast heuristic for searching for similar sequences

More information

Lecture 23: Conditional Gradient Method

Lecture 23: Conditional Gradient Method 10-725/36-725: Conve Optimization Spring 2015 Lecture 23: Conditional Gradient Method Lecturer: Ryan Tibshirani Scribes: Shichao Yang,Diyi Yang,Zhanpeng Fang Note: LaTeX template courtesy of UC Berkeley

More information

Collected Works of Charles Dickens

Collected Works of Charles Dickens Collected Works of Charles Dickens A Random Dickens Quote If there were no bad people, there would be no good lawyers. Original Sentence It was a dark and stormy night; the night was dark except at sunny

More information