Design of topological proteins based on concatenated coiled-coil modules Roman Jerala

Size: px
Start display at page:

Download "Design of topological proteins based on concatenated coiled-coil modules Roman Jerala"

Transcription

1 Design of topological proteins based on concatenated coiled-coil modules Roman Jerala Department of biotechnology National institute of chemistry Ljubljana, Slovenia

2 Topofolds Concept of modular topological polypeptide folds Designed single polypeptide chain tetrahedon DNA as the prototyping material to design the folding pathway

3 Natural molecular machines

4 Natural biopolymers with designable structure To a first approximation All nucleic acids are the same and All proteins are diferent. Biochemistry 101

5 Natural protein origami

6 Natural protein folds

7 Long range modular interactions in designed DNA nanostructures

8 Designed DNA nanostructures He et al., Nature, 2008

9 Evolved and designed bionanostructures DNA Protein Evolved compact fold Modular fold

10 Nucleic acids and polypeptides as building blocks DNA contains 4 nucleotides with similar properties - can fold into defined 3D structures +/- used to store information in nature prepared mainly by synthesis +/- - easy to program (W-C base pairs) + proteins contains 20 AA with different chemical properties + can fold into defined 3D structures + builds structures and functional devices in nature + produced by cell factories at low cost + structure-encoding information is complex - intro

11 Construction of buildings Artisanal ad hoc, unique Engineered - modular

12 Coiled-coils as building blocks Length: 3 - > 50 nm (hundreds of residues) 1C1G 1 nm

13 Coiled-coil design rules We used the principles governing the selectivity and stability of CC segments to design and experimentally test a set of peptides Stabilization Heptad repeat-specific pattern Destabilization hydrophobic residues at positions a and d opposite charged residues at positions e and g positions b, c and f can be chemically modified to introduce desired function into the coiled-coil assembly Negative design motif based on burial of polar Asn residues maximize the difference between designed (target) and unwanted combinations of residues

14 Orthogonality of the native coiled-coil dimers Analysis of pairwise interactions between 55 natural bzip CC segments Reinke et al. (Keating lab), JACS 2011

15 Design of orthogonal coiled-coil dimers

16 Orthogonality of designed coiled-coil peptides Molar ellipticity (10 3 deg cm 2 dmol -1 ) Peptide + non-partner P3-P7 P3-P8 P4-P7 P4-P Wavelength (nm) Molar ellipticity (10 3 deg cm 2 dmol -1 ) Peptide + designed partner P1-P2 P3-P4 P5-P6 P7-P Wavelength (nm) Peptide + non-partner P7 P4 Peptide + its partner P4 P3 - P4 P4 P7 P3 Gradišar and Jerala, J.Pept.Sc., 2011

17 Linking of coiled-coil forming segments Building block = 2 coiled-coil-forming segments a b Two linked coiled-coil-forming segments can only form fibrils (nearest neighbor interactions)

18 Flexible linker connecting interacting elements

19 Flexible linker connecting interacting elements

20 Deconstructing shape into modules Božič-Abram et al., Cur.Op.Chem.Biol. 2013

21 Construction of the tetrahedron Can the tetrahedral edges be traversed exactly twice, forming coiled-coils at each edge?

22

23 Topological solutions for a tetrahedron Two types of vertices of the degree of 3 (6).

24 Topological solutions for a tetrahedron Two possible types of vertices of the degree of 3 (6). Three possible topologies to construct a tetrahedron but could be realized by 28 different combinations of segments.

25 Design of a tetrahedron-forming polypeptide APH P3 BCR GCNsh APH P7 GCNsh P4 P5 P8 BCR P6 4 parallel dimers 2 antiparallel dimers TET12 His6 flexible tetrapeptide linker SGPG

26 Polypeptide production, isolation and self-assembly Production in E.coli SDS-PAGE In vitro self-assembly Dialysis at low polypeptide concentration Protein purification Affinity chromatography HPLC-RP Molar ellipticity (10 3 deg cm 2 dmol -1 ) Wavelength (nm)

27 Characterization of hydrodynamic size by DLS Denatured TET12 Self-assembled TET12

28 TEM and AFM imaging 5 nm Gradišar et al., Nature Chem. Biol. 2013

29 Detection of the N-terminal end of TET12 Ni NTA Ni NTA Ni NTA Ni NTA Ni NTA HHHHHH Negative staining Nanogold 1.8 nm + Negative staining

30 Termini of the tetrahedral path coincide

31 Coincidence of termini by YFP reconstitution Fluorescence intensity TET11 splityfp TET 12 splityfp TET12 TET splityfp 11 splityfp Wavelength (nm) In vitro reconstitution No fluorescence in producing bacteria TET12 splityfp Fluorescence is reconstituted only in TET12 splityfp but not for TET11 splityfp Gradišar et al., Nature Chem. Biol. 2013

32 Correct order of segments defines the structure Number distribution (%) TET ± 0.4 nm Diameter (nm) Number distribution (%) TETScr 15.6 ± 2.3 nm Diameter (nm) Number distribution (%) ± 1.1 nm Diameter (nm) TET11

33 Next steps - Increasing the complexity of topological folds - Establishing the foundations: - Expand the toolbox of building blocks - Selection of loop sequences - In vivo folding?

34 DNA as the prototyping material Square pyramid from a single DNA chain Only 2 circular paths to fold single chain antiparallel square pyramid

35 Selection of the folding pathway Optimal arrangement Kineticaly hindered arrangement

36 Single chain DNA pyramid

37 Kinetics of folding depending on the topology a) favorable b) unfavorable folding topology c) DNA pyramid

38 Natural and topological protein fold NATIVE PROTEIN FOLD TOPOLOGICAL PROTEIN FOLD Compact and continuous hydrophobic core joining secondary structure elements Hydrophobic core limited to within each building block Topology defines the fold!

39 Fold definition by long-range interactions

40 Summary Concatenated coiled-coil-based modules can be used to design new type of a topological protein fold based on similar principles as DNA nanostructures Tetrahedral fold not been found in nature has been designed and succesfully folded The arrangement of interacting segments according to stability allows define teh folding pathway

41 Acknowledgements Helena Gradišar Iva Hafner Bratkovič Sabina Božič Tibor Doles Slovenian igem 2009 team Tomaž Pisanski Nino Bašić Sandi Klavžar Sabina Božič, Nika Debeljak, Tibor Doles, Urška Jelerčič, Anja Lukan, Špela Miklavič, Marko Verce

A dynamic programming approach to generation of strong traces

A dynamic programming approach to generation of strong traces A dynamic programming approach to generation of strong traces Nino Bašić Faculty of Mathematics, Natural Sciences and Information Technologies University of Primorska 32 nd TBI Winterseminar Bled, 16 February

More information

Nanobiotechnology. Place: IOP 1 st Meeting Room Time: 9:30-12:00. Reference: Review Papers. Grade: 40% midterm, 60% final report (oral + written)

Nanobiotechnology. Place: IOP 1 st Meeting Room Time: 9:30-12:00. Reference: Review Papers. Grade: 40% midterm, 60% final report (oral + written) Nanobiotechnology Place: IOP 1 st Meeting Room Time: 9:30-12:00 Reference: Review Papers Grade: 40% midterm, 60% final report (oral + written) Midterm: 5/18 Oral Presentation 1. 20 minutes each person

More information

Protein Structure. W. M. Grogan, Ph.D. OBJECTIVES

Protein Structure. W. M. Grogan, Ph.D. OBJECTIVES Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate

More information

Supersecondary Structures (structural motifs)

Supersecondary Structures (structural motifs) Supersecondary Structures (structural motifs) Various Sources Slide 1 Supersecondary Structures (Motifs) Supersecondary Structures (Motifs): : Combinations of secondary structures in specific geometric

More information

Homologous proteins have similar structures and structural superposition means to rotate and translate the structures so that corresponding atoms are

Homologous proteins have similar structures and structural superposition means to rotate and translate the structures so that corresponding atoms are 1 Homologous proteins have similar structures and structural superposition means to rotate and translate the structures so that corresponding atoms are as close to each other as possible. Structural similarity

More information

Exam I Answer Key: Summer 2006, Semester C

Exam I Answer Key: Summer 2006, Semester C 1. Which of the following tripeptides would migrate most rapidly towards the negative electrode if electrophoresis is carried out at ph 3.0? a. gly-gly-gly b. glu-glu-asp c. lys-glu-lys d. val-asn-lys

More information

Physiochemical Properties of Residues

Physiochemical Properties of Residues Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)

More information

Protein Folding & Stability. Lecture 11: Margaret A. Daugherty. Fall How do we go from an unfolded polypeptide chain to a

Protein Folding & Stability. Lecture 11: Margaret A. Daugherty. Fall How do we go from an unfolded polypeptide chain to a Lecture 11: Protein Folding & Stability Margaret A. Daugherty Fall 2004 How do we go from an unfolded polypeptide chain to a compact folded protein? (Folding of thioredoxin, F. Richards) Structure - Function

More information

Outline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins

Outline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2004 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets

More information

Basics of protein structure

Basics of protein structure Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu

More information

Table 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2

Table 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2 Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell

More information

BBS501 Section 1 9:00 am 10:00 am Monday thru Friday LRC 105 A & B

BBS501 Section 1 9:00 am 10:00 am Monday thru Friday LRC 105 A & B BBS501 Section 1 9:00 am 10:00 am Monday thru Friday LRC 105 A & B Lecturers: Dr. Yie-Hwa Chang Room M130 Phone: #79263 E-mail:changy@slu.edu Dr. Tomasz Heyduk Room M99 Phone: #79238 E-mail: heydukt@slu.edu

More information

Supplementary Figure 1. SDS-PAGE analysis of GFP oligomer variants with different linkers. Oligomer mixtures were applied to a PAGE gel containing

Supplementary Figure 1. SDS-PAGE analysis of GFP oligomer variants with different linkers. Oligomer mixtures were applied to a PAGE gel containing Supplementary Figure 1. SDS-PAGE analysis of GFP oligomer variants with different linkers. Oligomer mixtures were applied to a PAGE gel containing 0.1% SDS without boiling. The gel was analyzed by a fluorescent

More information

4 Proteins: Structure, Function, Folding W. H. Freeman and Company

4 Proteins: Structure, Function, Folding W. H. Freeman and Company 4 Proteins: Structure, Function, Folding 2013 W. H. Freeman and Company CHAPTER 4 Proteins: Structure, Function, Folding Learning goals: Structure and properties of the peptide bond Structural hierarchy

More information

Outline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins

Outline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2003 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets

More information

Presenter: She Zhang

Presenter: She Zhang Presenter: She Zhang Introduction Dr. David Baker Introduction Why design proteins de novo? It is not clear how non-covalent interactions favor one specific native structure over many other non-native

More information

Scale in the biological world

Scale in the biological world Scale in the biological world 2 A cell seen by TEM 3 4 From living cells to atoms 5 Compartmentalisation in the cell: internal membranes and the cytosol 6 The Origin of mitochondria: The endosymbion hypothesis

More information

Protein Structure Prediction, Engineering & Design CHEM 430

Protein Structure Prediction, Engineering & Design CHEM 430 Protein Structure Prediction, Engineering & Design CHEM 430 Eero Saarinen The free energy surface of a protein Protein Structure Prediction & Design Full Protein Structure from Sequence - High Alignment

More information

Protein Structure Basics

Protein Structure Basics Protein Structure Basics Presented by Alison Fraser, Christine Lee, Pradhuman Jhala, Corban Rivera Importance of Proteins Muscle structure depends on protein-protein interactions Transport across membranes

More information

Chapter 9 DNA recognition by eukaryotic transcription factors

Chapter 9 DNA recognition by eukaryotic transcription factors Chapter 9 DNA recognition by eukaryotic transcription factors TRANSCRIPTION 101 Eukaryotic RNA polymerases RNA polymerase RNA polymerase I RNA polymerase II RNA polymerase III RNA polymerase IV Function

More information

Dana Alsulaibi. Jaleel G.Sweis. Mamoon Ahram

Dana Alsulaibi. Jaleel G.Sweis. Mamoon Ahram 15 Dana Alsulaibi Jaleel G.Sweis Mamoon Ahram Revision of last lectures: Proteins have four levels of structures. Primary,secondary, tertiary and quaternary. Primary structure is the order of amino acids

More information

Synthetic polypetides for materials science and biosensing. Professor Bo Liedberg, Molecular Physics, Linköping University, Sweden

Synthetic polypetides for materials science and biosensing. Professor Bo Liedberg, Molecular Physics, Linköping University, Sweden bolie@ifm.liu.se www.ifm.liu.se/applphys/sensor Synthetic polypetides for materials science and biosensing Professor Bo Liedberg, Molecular Physics, Linköping University, Sweden 436 th Heraeus Seminar,

More information

Principles of Physical Biochemistry

Principles of Physical Biochemistry Principles of Physical Biochemistry Kensal E. van Hold e W. Curtis Johnso n P. Shing Ho Preface x i PART 1 MACROMOLECULAR STRUCTURE AND DYNAMICS 1 1 Biological Macromolecules 2 1.1 General Principles

More information

Gene regulation II Biochemistry 302. February 27, 2006

Gene regulation II Biochemistry 302. February 27, 2006 Gene regulation II Biochemistry 302 February 27, 2006 Molecular basis of inhibition of RNAP by Lac repressor 35 promoter site 10 promoter site CRP/DNA complex 60 Lewis, M. et al. (1996) Science 271:1247

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature10955 Supplementary Figures Supplementary Figure 1. Electron-density maps and crystallographic dimer structures of the motor domain. (a f) Stereo views of the final electron-density maps

More information

Outline. The ensemble folding kinetics of protein G from an all-atom Monte Carlo simulation. Unfolded Folded. What is protein folding?

Outline. The ensemble folding kinetics of protein G from an all-atom Monte Carlo simulation. Unfolded Folded. What is protein folding? The ensemble folding kinetics of protein G from an all-atom Monte Carlo simulation By Jun Shimada and Eugine Shaknovich Bill Hawse Dr. Bahar Elisa Sandvik and Mehrdad Safavian Outline Background on protein

More information

Announcements. Primary (1 ) Structure. Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure

Announcements. Primary (1 ) Structure. Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure Announcements TA Office Hours: Brian Eckenroth Monday 3-4 pm Thursday 11 am-12 pm Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure Margaret Daugherty Fall 2003 Homework II posted

More information

Lecture 11: Protein Folding & Stability

Lecture 11: Protein Folding & Stability Structure - Function Protein Folding: What we know Lecture 11: Protein Folding & Stability 1). Amino acid sequence dictates structure. 2). The native structure represents the lowest energy state for a

More information

Protein Folding & Stability. Lecture 11: Margaret A. Daugherty. Fall Protein Folding: What we know. Protein Folding

Protein Folding & Stability. Lecture 11: Margaret A. Daugherty. Fall Protein Folding: What we know. Protein Folding Lecture 11: Protein Folding & Stability Margaret A. Daugherty Fall 2003 Structure - Function Protein Folding: What we know 1). Amino acid sequence dictates structure. 2). The native structure represents

More information

Many proteins spontaneously refold into native form in vitro with high fidelity and high speed.

Many proteins spontaneously refold into native form in vitro with high fidelity and high speed. Macromolecular Processes 20. Protein Folding Composed of 50 500 amino acids linked in 1D sequence by the polypeptide backbone The amino acid physical and chemical properties of the 20 amino acids dictate

More information

D Dobbs ISU - BCB 444/544X 1

D Dobbs ISU - BCB 444/544X 1 11/7/05 Protein Structure: Classification, Databases, Visualization Announcements BCB 544 Projects - Important Dates: Nov 2 Wed noon - Project proposals due to David/Drena Nov 4 Fri PM - Approvals/responses

More information

Lecture 26: Polymers: DNA Packing and Protein folding 26.1 Problem Set 4 due today. Reading for Lectures 22 24: PKT Chapter 8 [ ].

Lecture 26: Polymers: DNA Packing and Protein folding 26.1 Problem Set 4 due today. Reading for Lectures 22 24: PKT Chapter 8 [ ]. Lecture 26: Polymers: DA Packing and Protein folding 26.1 Problem Set 4 due today. eading for Lectures 22 24: PKT hapter 8 DA Packing for Eukaryotes: The packing problem for the larger eukaryotic genomes

More information

Translation Part 2 of Protein Synthesis

Translation Part 2 of Protein Synthesis Translation Part 2 of Protein Synthesis IN: How is transcription like making a jello mold? (be specific) What process does this diagram represent? A. Mutation B. Replication C.Transcription D.Translation

More information

Lattice protein models

Lattice protein models Lattice protein models Marc R. Roussel epartment of Chemistry and Biochemistry University of Lethbridge March 5, 2009 1 Model and assumptions The ideas developed in the last few lectures can be applied

More information

BME 5742 Biosystems Modeling and Control

BME 5742 Biosystems Modeling and Control BME 5742 Biosystems Modeling and Control Lecture 24 Unregulated Gene Expression Model Dr. Zvi Roth (FAU) 1 The genetic material inside a cell, encoded in its DNA, governs the response of a cell to various

More information

Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1.

Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. PDZK1 constru cts Amino acids MW [kda] KD [μm] PEPT2-CT- FITC KD [μm] NHE3-CT- FITC KD [μm] PDZK1-CT-

More information

Biomolecules. Energetics in biology. Biomolecules inside the cell

Biomolecules. Energetics in biology. Biomolecules inside the cell Biomolecules Energetics in biology Biomolecules inside the cell Energetics in biology The production of energy, its storage, and its use are central to the economy of the cell. Energy may be defined as

More information

Denaturation and renaturation of proteins

Denaturation and renaturation of proteins Denaturation and renaturation of proteins Higher levels of protein structure are formed without covalent bonds. Therefore, they are not as stable as peptide covalent bonds which make protein primary structure

More information

Structure of the α-helix

Structure of the α-helix Structure of the α-helix Structure of the β Sheet Protein Dynamics Basics of Quenching HDX Hydrogen exchange of amide protons is catalyzed by H 2 O, OH -, and H 3 O +, but it s most dominated by base

More information

What binds to Hb in addition to O 2?

What binds to Hb in addition to O 2? Reading: Ch5; 158-169, 162-166, 169-174 Problems: Ch5 (text); 3,7,8,10 Ch5 (study guide-facts); 1,2,3,4,5,8 Ch5 (study guide-apply); 2,3 Remember Today at 5:30 in CAS-522 is the second chance for the MB

More information

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748 CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr

More information

SECOND PUBLIC EXAMINATION. Honour School of Physics Part C: 4 Year Course. Honour School of Physics and Philosophy Part C C7: BIOLOGICAL PHYSICS

SECOND PUBLIC EXAMINATION. Honour School of Physics Part C: 4 Year Course. Honour School of Physics and Philosophy Part C C7: BIOLOGICAL PHYSICS 2757 SECOND PUBLIC EXAMINATION Honour School of Physics Part C: 4 Year Course Honour School of Physics and Philosophy Part C C7: BIOLOGICAL PHYSICS TRINITY TERM 2013 Monday, 17 June, 2.30 pm 5.45 pm 15

More information

Homology models of the tetramerization domain of six eukaryotic voltage-gated potassium channels Kv1.1-Kv1.6

Homology models of the tetramerization domain of six eukaryotic voltage-gated potassium channels Kv1.1-Kv1.6 Homology models of the tetramerization domain of six eukaryotic voltage-gated potassium channels Kv1.1-Kv1.6 Hsuan-Liang Liu* and Chin-Wen Chen Department of Chemical Engineering and Graduate Institute

More information

Lesson Overview The Structure of DNA

Lesson Overview The Structure of DNA 12.2 THINK ABOUT IT The DNA molecule must somehow specify how to assemble proteins, which are needed to regulate the various functions of each cell. What kind of structure could serve this purpose without

More information

Biomolecules: lecture 10

Biomolecules: lecture 10 Biomolecules: lecture 10 - understanding in detail how protein 3D structures form - realize that protein molecules are not static wire models but instead dynamic, where in principle every atom moves (yet

More information

Protein synthesis I Biochemistry 302. February 17, 2006

Protein synthesis I Biochemistry 302. February 17, 2006 Protein synthesis I Biochemistry 302 February 17, 2006 Key features and components involved in protein biosynthesis High energy cost (essential metabolic activity of cell Consumes 90% of the chemical energy

More information

Introduction to" Protein Structure

Introduction to Protein Structure Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.

More information

Major Types of Association of Proteins with Cell Membranes. From Alberts et al

Major Types of Association of Proteins with Cell Membranes. From Alberts et al Major Types of Association of Proteins with Cell Membranes From Alberts et al Proteins Are Polymers of Amino Acids Peptide Bond Formation Amino Acid central carbon atom to which are attached amino group

More information

BIOCHEMISTRY GUIDED NOTES - AP BIOLOGY-

BIOCHEMISTRY GUIDED NOTES - AP BIOLOGY- BIOCHEMISTRY GUIDED NOTES - AP BIOLOGY- ELEMENTS AND COMPOUNDS - anything that has mass and takes up space. - cannot be broken down to other substances. - substance containing two or more different elements

More information

Protein Folding In Vitro*

Protein Folding In Vitro* Protein Folding In Vitro* Biochemistry 412 February 29, 2008 [*Note: includes computational (in silico) studies] Fersht & Daggett (2002) Cell 108, 573. Some folding-related facts about proteins: Many small,

More information

Protein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds

Protein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds Protein Structure Hierarchy of Protein Structure 2 3 Structural element Primary structure Secondary structure Super-secondary structure Domain Tertiary structure Quaternary structure Description amino

More information

Local Interactions Dominate Folding in a Simple Protein Model

Local Interactions Dominate Folding in a Simple Protein Model J. Mol. Biol. (1996) 259, 988 994 Local Interactions Dominate Folding in a Simple Protein Model Ron Unger 1,2 * and John Moult 2 1 Department of Life Sciences Bar-Ilan University Ramat-Gan, 52900, Israel

More information

BSc and MSc Degree Examinations

BSc and MSc Degree Examinations Examination Candidate Number: Desk Number: BSc and MSc Degree Examinations 2018-9 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes Marking

More information

Effect of the Single and Double Chain Surfactant Cobalt(III) Complexes on Their Hydrophobicity, Micelle Formation,

Effect of the Single and Double Chain Surfactant Cobalt(III) Complexes on Their Hydrophobicity, Micelle Formation, Electronic Supplementary Material (ESI) for Inorganic Chemistry Frontiers. This journal is the Partner Organisations 2014 Supplementary Information Effect of the Single and Double Chain Surfactant Cobalt(III)

More information

Protein synthesis I Biochemistry 302. Bob Kelm February 23, 2004

Protein synthesis I Biochemistry 302. Bob Kelm February 23, 2004 Protein synthesis I Biochemistry 302 Bob Kelm February 23, 2004 Key features of protein synthesis Energy glutton Essential metabolic activity of the cell. Consumes 90% of the chemical energy (ATP,GTP).

More information

Lecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability

Lecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability Lecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability Part I. Review of forces Covalent bonds Non-covalent Interactions: Van der Waals Interactions

More information

Supplementary Information. Structural basis for precursor protein-directed ribosomal peptide macrocyclization

Supplementary Information. Structural basis for precursor protein-directed ribosomal peptide macrocyclization Supplementary Information Structural basis for precursor protein-directed ribosomal peptide macrocyclization Kunhua Li 1,3, Heather L. Condurso 1,3, Gengnan Li 1, Yousong Ding 2 and Steven D. Bruner 1*

More information

Supplementary Figures

Supplementary Figures Supplementary Figures Supplementary Figure 1. The asymmetric unit in para-iodio-phenylalanine crystal. The 50% probability ellipsoid representation was prepared using the Mercury Software. Colors are as

More information

EXAM I COURSE TFY4310 MOLECULAR BIOPHYSICS December Suggested resolution

EXAM I COURSE TFY4310 MOLECULAR BIOPHYSICS December Suggested resolution page 1 of 7 EXAM I COURSE TFY4310 MOLECULAR BIOPHYSICS December 2013 Suggested resolution Exercise 1. [total: 25 p] a) [t: 5 p] Describe the bonding [1.5 p] and the molecular orbitals [1.5 p] of the ethylene

More information

RNA & PROTEIN SYNTHESIS. Making Proteins Using Directions From DNA

RNA & PROTEIN SYNTHESIS. Making Proteins Using Directions From DNA RNA & PROTEIN SYNTHESIS Making Proteins Using Directions From DNA RNA & Protein Synthesis v Nitrogenous bases in DNA contain information that directs protein synthesis v DNA remains in nucleus v in order

More information

Organic Chemistry Option II: Chemical Biology

Organic Chemistry Option II: Chemical Biology Organic Chemistry Option II: Chemical Biology Recommended books: Dr Stuart Conway Department of Chemistry, Chemistry Research Laboratory, University of Oxford email: stuart.conway@chem.ox.ac.uk Teaching

More information

Secondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure

Secondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure Bioch/BIMS 503 Lecture 2 Structure and Function of Proteins August 28, 2008 Robert Nakamoto rkn3c@virginia.edu 2-0279 Secondary Structure Φ Ψ angles determine protein structure Φ Ψ angles are restricted

More information

BIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) PROTEINS

BIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) PROTEINS BIOLOGY BIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) NAME NAME PERIOD PROTEINS GENERAL CHARACTERISTICS AND IMPORTANCES: Polymers of amino acids Each has unique 3-D shape Vary in sequence of amino

More information

From Amino Acids to Proteins - in 4 Easy Steps

From Amino Acids to Proteins - in 4 Easy Steps From Amino Acids to Proteins - in 4 Easy Steps Although protein structure appears to be overwhelmingly complex, you can provide your students with a basic understanding of how proteins fold by focusing

More information

CHEM 3653 Exam # 1 (03/07/13)

CHEM 3653 Exam # 1 (03/07/13) 1. Using phylogeny all living organisms can be divided into the following domains: A. Bacteria, Eukarya, and Vertebrate B. Archaea and Eukarya C. Bacteria, Eukarya, and Archaea D. Eukarya and Bacteria

More information

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK

More information

NMR Characterization of Partially Folded and Unfolded Conformational Ensembles of Proteins

NMR Characterization of Partially Folded and Unfolded Conformational Ensembles of Proteins Elisar Barbar Department of Chemistry and Biochemistry, Ohio University, Athens, OH 45701 NMR Characterization of Partially Folded and Unfolded Conformational Ensembles of Proteins Abstract: Studies of

More information

CAP 5510 Lecture 3 Protein Structures

CAP 5510 Lecture 3 Protein Structures CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity

More information

Translation. Genetic code

Translation. Genetic code Translation Genetic code If genes are segments of DNA and if DNA is just a string of nucleotide pairs, then how does the sequence of nucleotide pairs dictate the sequence of amino acids in proteins? Simple

More information

Introduction to Polymer Physics

Introduction to Polymer Physics Introduction to Polymer Physics Enrico Carlon, KU Leuven, Belgium February-May, 2016 Enrico Carlon, KU Leuven, Belgium Introduction to Polymer Physics February-May, 2016 1 / 28 Polymers in Chemistry and

More information

MBLG lecture 5. The EGG! Visualising Molecules. Dr. Dale Hancock Lab 715

MBLG lecture 5. The EGG! Visualising Molecules. Dr. Dale Hancock Lab 715 MBLG lecture 5 Dr. Dale Hancock D.Hancock@mmb.usyd.edu.au Lab 715 The EGG! Visualising Molecules In molecular biology and biochemistry it is better to view molecules as killer pythons rather than smarties.

More information

Signal Transduction Phosphorylation Protein kinases. Misfolding diseases. Protein Engineering Lysozyme variants

Signal Transduction Phosphorylation Protein kinases. Misfolding diseases. Protein Engineering Lysozyme variants Signal Transduction Phosphorylation Protein kinases Misfolding diseases Protein Engineering Lysozyme variants Cells and Signals Regulation The cell must be able to respond to stimuli Cellular activities

More information

Amino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1

Amino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings

More information

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL

More information

Gene regulation I Biochemistry 302. Bob Kelm February 25, 2005

Gene regulation I Biochemistry 302. Bob Kelm February 25, 2005 Gene regulation I Biochemistry 302 Bob Kelm February 25, 2005 Principles of gene regulation (cellular versus molecular level) Extracellular signals Chemical (e.g. hormones, growth factors) Environmental

More information

Biological Macromolecules

Biological Macromolecules Introduction for Chem 493 Chemistry of Biological Macromolecules Dr. L. Luyt January 2008 Dr. L. Luyt Chem 493-2008 1 Biological macromolecules are the molecules of life allow for organization serve a

More information

1. What is an ångstrom unit, and why is it used to describe molecular structures?

1. What is an ångstrom unit, and why is it used to describe molecular structures? 1. What is an ångstrom unit, and why is it used to describe molecular structures? The ångstrom unit is a unit of distance suitable for measuring atomic scale objects. 1 ångstrom (Å) = 1 10-10 m. The diameter

More information

Structure Determination by NMR Spectroscopy #3-1

Structure Determination by NMR Spectroscopy #3-1 Structure Determination by NMR Spectroscopy #3-1 3. Computational methods in NMR-spectroscopy 3.1 Nomenclature of proteins and nucleic acids 3.1.1. Classification of structural relationships between molecules

More information

Biotechnology of Proteins. The Source of Stability in Proteins (III) Fall 2015

Biotechnology of Proteins. The Source of Stability in Proteins (III) Fall 2015 Biotechnology of Proteins The Source of Stability in Proteins (III) Fall 2015 Conformational Entropy of Unfolding It is The factor that makes the greatest contribution to stabilization of the unfolded

More information

Biochemistry Quiz Review 1I. 1. Of the 20 standard amino acids, only is not optically active. The reason is that its side chain.

Biochemistry Quiz Review 1I. 1. Of the 20 standard amino acids, only is not optically active. The reason is that its side chain. Biochemistry Quiz Review 1I A general note: Short answer questions are just that, short. Writing a paragraph filled with every term you can remember from class won t improve your answer just answer clearly,

More information

Biochemistry: Concepts and Connections

Biochemistry: Concepts and Connections Biochemistry: Concepts and Connections Dean R. Appling Spencer J. Anthony-Cahill Christopher K. Mathews Chapter 6 The Three Dimensional Structure of Proteins Cartoon representation of myoglobin, showing

More information

Interdisciplinary Nanoscience Center University of Aarhus, Denmark. Design and Imaging. Assistant Professor.

Interdisciplinary Nanoscience Center University of Aarhus, Denmark. Design and Imaging. Assistant Professor. Interdisciplinary Nanoscience Center University of Aarhus, Denmark Design and Imaging DNA Nanostructures Assistant Professor Wael Mamdouh wael@inano.dk Molecular Self-assembly Synthesis, SPM microscopy,

More information

Cell Division. OpenStax College. 1 Genomic DNA

Cell Division. OpenStax College. 1 Genomic DNA OpenStax-CNX module: m44459 1 Cell Division OpenStax College This work is produced by OpenStax-CNX and licensed under the Creative Commons Attribution License 3.0 By the end of this section, you will be

More information

Contents. xiii. Preface v

Contents. xiii. Preface v Contents Preface Chapter 1 Biological Macromolecules 1.1 General PrincipIes 1.1.1 Macrornolecules 1.2 1.1.2 Configuration and Conformation Molecular lnteractions in Macromolecular Structures 1.2.1 Weak

More information

Achievement of Protein Thermostability by Amino Acid Substitution. 2018/6/30 M1 Majima Sohei

Achievement of Protein Thermostability by Amino Acid Substitution. 2018/6/30 M1 Majima Sohei Achievement of Protein Thermostability by Amino Acid Substitution 2018/6/30 M1 Majima Sohei Contents of Today s seminar Introduction Study on hyperthermophilic enzymes to understand the origin of thermostability

More information

4 Examples of enzymes

4 Examples of enzymes Catalysis 1 4 Examples of enzymes Adding water to a substrate: Serine proteases. Carbonic anhydrase. Restrictions Endonuclease. Transfer of a Phosphoryl group from ATP to a nucleotide. Nucleoside monophosphate

More information

Paul Sigler et al, 1998.

Paul Sigler et al, 1998. Biological systems are necessarily metastable. They are created, modulated, and destroyed according to a temporal plan that meets the survival needs of the cell, organism, and species...clearly, no biological

More information

Biophysics Service at the MPIB Biochemistry Core Facility Stephan Uebel, Biochemistry Core Facility

Biophysics Service at the MPIB Biochemistry Core Facility Stephan Uebel, Biochemistry Core Facility Biophysics Service at the MPIB Biochemistry Core Facility 30.11.2015 Stephan Uebel, Biochemistry Core Facility uebel@biochem.mpg.de Overview Peptide Chemistry - Peptide synthesis -Amino acid analysis -

More information

THE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION

THE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION THE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION AND CALIBRATION Calculation of turn and beta intrinsic propensities. A statistical analysis of a protein structure

More information

BCHS 6229 Protein Structure and Function. Lecture 3 (October 18, 2011) Protein Folding: Forces, Mechanisms & Characterization

BCHS 6229 Protein Structure and Function. Lecture 3 (October 18, 2011) Protein Folding: Forces, Mechanisms & Characterization BCHS 6229 Protein Structure and Function Lecture 3 (October 18, 2011) Protein Folding: Forces, Mechanisms & Characterization 1 The folding problem One of the greatest unsolved problems of Science The folding

More information

BA, BSc, and MSc Degree Examinations

BA, BSc, and MSc Degree Examinations Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes

More information

Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India. 1 st November, 2013

Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India. 1 st November, 2013 Hydration of protein-rna recognition sites Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India 1 st November, 2013 Central Dogma of life DNA

More information

Multimedia : Fibronectin and Titin unfolding simulation movies.

Multimedia : Fibronectin and Titin unfolding simulation movies. I LECTURE 21: SINGLE CHAIN ELASTICITY OF BIOMACROMOLECULES: THE GIANT PROTEIN TITIN AND DNA Outline : REVIEW LECTURE #2 : EXTENSIBLE FJC AND WLC... 2 STRUCTURE OF MUSCLE AND TITIN... 3 SINGLE MOLECULE

More information

Protein Folding experiments and theory

Protein Folding experiments and theory Protein Folding experiments and theory 1, 2,and 3 Protein Structure Fig. 3-16 from Lehninger Biochemistry, 4 th ed. The 3D structure is not encoded at the single aa level Hydrogen Bonding Shared H atom

More information

titin, has 35,213 amino acid residues (the human version of titin is smaller, with only 34,350 residues in the full length protein).

titin, has 35,213 amino acid residues (the human version of titin is smaller, with only 34,350 residues in the full length protein). Introduction to Protein Structure Proteins are large heteropolymers usually comprised of 50 2500 monomer units, although larger proteins are observed 8. The monomer units of proteins are amino acids. Proteins

More information

Types of RNA. 1. Messenger RNA(mRNA): 1. Represents only 5% of the total RNA in the cell.

Types of RNA. 1. Messenger RNA(mRNA): 1. Represents only 5% of the total RNA in the cell. RNAs L.Os. Know the different types of RNA & their relative concentration Know the structure of each RNA Understand their functions Know their locations in the cell Understand the differences between prokaryotic

More information

Self-assembled bionanostructures: proteins following the lead of DNA nanostructures

Self-assembled bionanostructures: proteins following the lead of DNA nanostructures Gradišar and Jerala Journal of Nanobiotechnology 2014, 12:4 REVIEW Self-assembled bionanostructures: proteins following the lead of DNA nanostructures Helena Gradišar 1,2* and Roman Jerala 1,2* Open Access

More information

Study of Non-Covalent Complexes by ESI-MS. By Quinn Tays

Study of Non-Covalent Complexes by ESI-MS. By Quinn Tays Study of Non-Covalent Complexes by ESI-MS By Quinn Tays History Overview Background Electrospray Ionization How it is used in study of noncovalent interactions Uses of the Technique Types of molecules

More information

NPTEL VIDEO LECTURE TOPICS FOR BIO-TECHNOLOGY

NPTEL VIDEO LECTURE TOPICS FOR BIO-TECHNOLOGY NPTEL VIDEO LECTURE TOPICS FOR BIO-TECHNOLOGY New No.1, Vembuliamman Koil Street, Pazhavanthangal, Chennai 600 114 Phone: 98841 65649 / 98847 36552 E-mail: nptel@linuxpert.in NPTEL Video Course - Biotechnology

More information

Bio nformatics. Lecture 23. Saad Mneimneh

Bio nformatics. Lecture 23. Saad Mneimneh Bio nformatics Lecture 23 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely

More information