Design of topological proteins based on concatenated coiled-coil modules Roman Jerala
|
|
- Solomon Mathews
- 5 years ago
- Views:
Transcription
1 Design of topological proteins based on concatenated coiled-coil modules Roman Jerala Department of biotechnology National institute of chemistry Ljubljana, Slovenia
2 Topofolds Concept of modular topological polypeptide folds Designed single polypeptide chain tetrahedon DNA as the prototyping material to design the folding pathway
3 Natural molecular machines
4 Natural biopolymers with designable structure To a first approximation All nucleic acids are the same and All proteins are diferent. Biochemistry 101
5 Natural protein origami
6 Natural protein folds
7 Long range modular interactions in designed DNA nanostructures
8 Designed DNA nanostructures He et al., Nature, 2008
9 Evolved and designed bionanostructures DNA Protein Evolved compact fold Modular fold
10 Nucleic acids and polypeptides as building blocks DNA contains 4 nucleotides with similar properties - can fold into defined 3D structures +/- used to store information in nature prepared mainly by synthesis +/- - easy to program (W-C base pairs) + proteins contains 20 AA with different chemical properties + can fold into defined 3D structures + builds structures and functional devices in nature + produced by cell factories at low cost + structure-encoding information is complex - intro
11 Construction of buildings Artisanal ad hoc, unique Engineered - modular
12 Coiled-coils as building blocks Length: 3 - > 50 nm (hundreds of residues) 1C1G 1 nm
13 Coiled-coil design rules We used the principles governing the selectivity and stability of CC segments to design and experimentally test a set of peptides Stabilization Heptad repeat-specific pattern Destabilization hydrophobic residues at positions a and d opposite charged residues at positions e and g positions b, c and f can be chemically modified to introduce desired function into the coiled-coil assembly Negative design motif based on burial of polar Asn residues maximize the difference between designed (target) and unwanted combinations of residues
14 Orthogonality of the native coiled-coil dimers Analysis of pairwise interactions between 55 natural bzip CC segments Reinke et al. (Keating lab), JACS 2011
15 Design of orthogonal coiled-coil dimers
16 Orthogonality of designed coiled-coil peptides Molar ellipticity (10 3 deg cm 2 dmol -1 ) Peptide + non-partner P3-P7 P3-P8 P4-P7 P4-P Wavelength (nm) Molar ellipticity (10 3 deg cm 2 dmol -1 ) Peptide + designed partner P1-P2 P3-P4 P5-P6 P7-P Wavelength (nm) Peptide + non-partner P7 P4 Peptide + its partner P4 P3 - P4 P4 P7 P3 Gradišar and Jerala, J.Pept.Sc., 2011
17 Linking of coiled-coil forming segments Building block = 2 coiled-coil-forming segments a b Two linked coiled-coil-forming segments can only form fibrils (nearest neighbor interactions)
18 Flexible linker connecting interacting elements
19 Flexible linker connecting interacting elements
20 Deconstructing shape into modules Božič-Abram et al., Cur.Op.Chem.Biol. 2013
21 Construction of the tetrahedron Can the tetrahedral edges be traversed exactly twice, forming coiled-coils at each edge?
22
23 Topological solutions for a tetrahedron Two types of vertices of the degree of 3 (6).
24 Topological solutions for a tetrahedron Two possible types of vertices of the degree of 3 (6). Three possible topologies to construct a tetrahedron but could be realized by 28 different combinations of segments.
25 Design of a tetrahedron-forming polypeptide APH P3 BCR GCNsh APH P7 GCNsh P4 P5 P8 BCR P6 4 parallel dimers 2 antiparallel dimers TET12 His6 flexible tetrapeptide linker SGPG
26 Polypeptide production, isolation and self-assembly Production in E.coli SDS-PAGE In vitro self-assembly Dialysis at low polypeptide concentration Protein purification Affinity chromatography HPLC-RP Molar ellipticity (10 3 deg cm 2 dmol -1 ) Wavelength (nm)
27 Characterization of hydrodynamic size by DLS Denatured TET12 Self-assembled TET12
28 TEM and AFM imaging 5 nm Gradišar et al., Nature Chem. Biol. 2013
29 Detection of the N-terminal end of TET12 Ni NTA Ni NTA Ni NTA Ni NTA Ni NTA HHHHHH Negative staining Nanogold 1.8 nm + Negative staining
30 Termini of the tetrahedral path coincide
31 Coincidence of termini by YFP reconstitution Fluorescence intensity TET11 splityfp TET 12 splityfp TET12 TET splityfp 11 splityfp Wavelength (nm) In vitro reconstitution No fluorescence in producing bacteria TET12 splityfp Fluorescence is reconstituted only in TET12 splityfp but not for TET11 splityfp Gradišar et al., Nature Chem. Biol. 2013
32 Correct order of segments defines the structure Number distribution (%) TET ± 0.4 nm Diameter (nm) Number distribution (%) TETScr 15.6 ± 2.3 nm Diameter (nm) Number distribution (%) ± 1.1 nm Diameter (nm) TET11
33 Next steps - Increasing the complexity of topological folds - Establishing the foundations: - Expand the toolbox of building blocks - Selection of loop sequences - In vivo folding?
34 DNA as the prototyping material Square pyramid from a single DNA chain Only 2 circular paths to fold single chain antiparallel square pyramid
35 Selection of the folding pathway Optimal arrangement Kineticaly hindered arrangement
36 Single chain DNA pyramid
37 Kinetics of folding depending on the topology a) favorable b) unfavorable folding topology c) DNA pyramid
38 Natural and topological protein fold NATIVE PROTEIN FOLD TOPOLOGICAL PROTEIN FOLD Compact and continuous hydrophobic core joining secondary structure elements Hydrophobic core limited to within each building block Topology defines the fold!
39 Fold definition by long-range interactions
40 Summary Concatenated coiled-coil-based modules can be used to design new type of a topological protein fold based on similar principles as DNA nanostructures Tetrahedral fold not been found in nature has been designed and succesfully folded The arrangement of interacting segments according to stability allows define teh folding pathway
41 Acknowledgements Helena Gradišar Iva Hafner Bratkovič Sabina Božič Tibor Doles Slovenian igem 2009 team Tomaž Pisanski Nino Bašić Sandi Klavžar Sabina Božič, Nika Debeljak, Tibor Doles, Urška Jelerčič, Anja Lukan, Špela Miklavič, Marko Verce
A dynamic programming approach to generation of strong traces
A dynamic programming approach to generation of strong traces Nino Bašić Faculty of Mathematics, Natural Sciences and Information Technologies University of Primorska 32 nd TBI Winterseminar Bled, 16 February
More informationNanobiotechnology. Place: IOP 1 st Meeting Room Time: 9:30-12:00. Reference: Review Papers. Grade: 40% midterm, 60% final report (oral + written)
Nanobiotechnology Place: IOP 1 st Meeting Room Time: 9:30-12:00 Reference: Review Papers Grade: 40% midterm, 60% final report (oral + written) Midterm: 5/18 Oral Presentation 1. 20 minutes each person
More informationProtein Structure. W. M. Grogan, Ph.D. OBJECTIVES
Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate
More informationSupersecondary Structures (structural motifs)
Supersecondary Structures (structural motifs) Various Sources Slide 1 Supersecondary Structures (Motifs) Supersecondary Structures (Motifs): : Combinations of secondary structures in specific geometric
More informationHomologous proteins have similar structures and structural superposition means to rotate and translate the structures so that corresponding atoms are
1 Homologous proteins have similar structures and structural superposition means to rotate and translate the structures so that corresponding atoms are as close to each other as possible. Structural similarity
More informationExam I Answer Key: Summer 2006, Semester C
1. Which of the following tripeptides would migrate most rapidly towards the negative electrode if electrophoresis is carried out at ph 3.0? a. gly-gly-gly b. glu-glu-asp c. lys-glu-lys d. val-asn-lys
More informationPhysiochemical Properties of Residues
Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)
More informationProtein Folding & Stability. Lecture 11: Margaret A. Daugherty. Fall How do we go from an unfolded polypeptide chain to a
Lecture 11: Protein Folding & Stability Margaret A. Daugherty Fall 2004 How do we go from an unfolded polypeptide chain to a compact folded protein? (Folding of thioredoxin, F. Richards) Structure - Function
More informationOutline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins
Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2004 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets
More informationBasics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationTable 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2
Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell
More informationBBS501 Section 1 9:00 am 10:00 am Monday thru Friday LRC 105 A & B
BBS501 Section 1 9:00 am 10:00 am Monday thru Friday LRC 105 A & B Lecturers: Dr. Yie-Hwa Chang Room M130 Phone: #79263 E-mail:changy@slu.edu Dr. Tomasz Heyduk Room M99 Phone: #79238 E-mail: heydukt@slu.edu
More informationSupplementary Figure 1. SDS-PAGE analysis of GFP oligomer variants with different linkers. Oligomer mixtures were applied to a PAGE gel containing
Supplementary Figure 1. SDS-PAGE analysis of GFP oligomer variants with different linkers. Oligomer mixtures were applied to a PAGE gel containing 0.1% SDS without boiling. The gel was analyzed by a fluorescent
More information4 Proteins: Structure, Function, Folding W. H. Freeman and Company
4 Proteins: Structure, Function, Folding 2013 W. H. Freeman and Company CHAPTER 4 Proteins: Structure, Function, Folding Learning goals: Structure and properties of the peptide bond Structural hierarchy
More informationOutline. Levels of Protein Structure. Primary (1 ) Structure. Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins
Lecture 6:Protein Architecture II: Secondary Structure or From peptides to proteins Margaret Daugherty Fall 2003 Outline Four levels of structure are used to describe proteins; Alpha helices and beta sheets
More informationPresenter: She Zhang
Presenter: She Zhang Introduction Dr. David Baker Introduction Why design proteins de novo? It is not clear how non-covalent interactions favor one specific native structure over many other non-native
More informationScale in the biological world
Scale in the biological world 2 A cell seen by TEM 3 4 From living cells to atoms 5 Compartmentalisation in the cell: internal membranes and the cytosol 6 The Origin of mitochondria: The endosymbion hypothesis
More informationProtein Structure Prediction, Engineering & Design CHEM 430
Protein Structure Prediction, Engineering & Design CHEM 430 Eero Saarinen The free energy surface of a protein Protein Structure Prediction & Design Full Protein Structure from Sequence - High Alignment
More informationProtein Structure Basics
Protein Structure Basics Presented by Alison Fraser, Christine Lee, Pradhuman Jhala, Corban Rivera Importance of Proteins Muscle structure depends on protein-protein interactions Transport across membranes
More informationChapter 9 DNA recognition by eukaryotic transcription factors
Chapter 9 DNA recognition by eukaryotic transcription factors TRANSCRIPTION 101 Eukaryotic RNA polymerases RNA polymerase RNA polymerase I RNA polymerase II RNA polymerase III RNA polymerase IV Function
More informationDana Alsulaibi. Jaleel G.Sweis. Mamoon Ahram
15 Dana Alsulaibi Jaleel G.Sweis Mamoon Ahram Revision of last lectures: Proteins have four levels of structures. Primary,secondary, tertiary and quaternary. Primary structure is the order of amino acids
More informationSynthetic polypetides for materials science and biosensing. Professor Bo Liedberg, Molecular Physics, Linköping University, Sweden
bolie@ifm.liu.se www.ifm.liu.se/applphys/sensor Synthetic polypetides for materials science and biosensing Professor Bo Liedberg, Molecular Physics, Linköping University, Sweden 436 th Heraeus Seminar,
More informationPrinciples of Physical Biochemistry
Principles of Physical Biochemistry Kensal E. van Hold e W. Curtis Johnso n P. Shing Ho Preface x i PART 1 MACROMOLECULAR STRUCTURE AND DYNAMICS 1 1 Biological Macromolecules 2 1.1 General Principles
More informationGene regulation II Biochemistry 302. February 27, 2006
Gene regulation II Biochemistry 302 February 27, 2006 Molecular basis of inhibition of RNAP by Lac repressor 35 promoter site 10 promoter site CRP/DNA complex 60 Lewis, M. et al. (1996) Science 271:1247
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature10955 Supplementary Figures Supplementary Figure 1. Electron-density maps and crystallographic dimer structures of the motor domain. (a f) Stereo views of the final electron-density maps
More informationOutline. The ensemble folding kinetics of protein G from an all-atom Monte Carlo simulation. Unfolded Folded. What is protein folding?
The ensemble folding kinetics of protein G from an all-atom Monte Carlo simulation By Jun Shimada and Eugine Shaknovich Bill Hawse Dr. Bahar Elisa Sandvik and Mehrdad Safavian Outline Background on protein
More informationAnnouncements. Primary (1 ) Structure. Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure
Announcements TA Office Hours: Brian Eckenroth Monday 3-4 pm Thursday 11 am-12 pm Lecture 7 & 8: PROTEIN ARCHITECTURE IV: Tertiary and Quaternary Structure Margaret Daugherty Fall 2003 Homework II posted
More informationLecture 11: Protein Folding & Stability
Structure - Function Protein Folding: What we know Lecture 11: Protein Folding & Stability 1). Amino acid sequence dictates structure. 2). The native structure represents the lowest energy state for a
More informationProtein Folding & Stability. Lecture 11: Margaret A. Daugherty. Fall Protein Folding: What we know. Protein Folding
Lecture 11: Protein Folding & Stability Margaret A. Daugherty Fall 2003 Structure - Function Protein Folding: What we know 1). Amino acid sequence dictates structure. 2). The native structure represents
More informationMany proteins spontaneously refold into native form in vitro with high fidelity and high speed.
Macromolecular Processes 20. Protein Folding Composed of 50 500 amino acids linked in 1D sequence by the polypeptide backbone The amino acid physical and chemical properties of the 20 amino acids dictate
More informationD Dobbs ISU - BCB 444/544X 1
11/7/05 Protein Structure: Classification, Databases, Visualization Announcements BCB 544 Projects - Important Dates: Nov 2 Wed noon - Project proposals due to David/Drena Nov 4 Fri PM - Approvals/responses
More informationLecture 26: Polymers: DNA Packing and Protein folding 26.1 Problem Set 4 due today. Reading for Lectures 22 24: PKT Chapter 8 [ ].
Lecture 26: Polymers: DA Packing and Protein folding 26.1 Problem Set 4 due today. eading for Lectures 22 24: PKT hapter 8 DA Packing for Eukaryotes: The packing problem for the larger eukaryotic genomes
More informationTranslation Part 2 of Protein Synthesis
Translation Part 2 of Protein Synthesis IN: How is transcription like making a jello mold? (be specific) What process does this diagram represent? A. Mutation B. Replication C.Transcription D.Translation
More informationLattice protein models
Lattice protein models Marc R. Roussel epartment of Chemistry and Biochemistry University of Lethbridge March 5, 2009 1 Model and assumptions The ideas developed in the last few lectures can be applied
More informationBME 5742 Biosystems Modeling and Control
BME 5742 Biosystems Modeling and Control Lecture 24 Unregulated Gene Expression Model Dr. Zvi Roth (FAU) 1 The genetic material inside a cell, encoded in its DNA, governs the response of a cell to various
More informationTable S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1.
Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. PDZK1 constru cts Amino acids MW [kda] KD [μm] PEPT2-CT- FITC KD [μm] NHE3-CT- FITC KD [μm] PDZK1-CT-
More informationBiomolecules. Energetics in biology. Biomolecules inside the cell
Biomolecules Energetics in biology Biomolecules inside the cell Energetics in biology The production of energy, its storage, and its use are central to the economy of the cell. Energy may be defined as
More informationDenaturation and renaturation of proteins
Denaturation and renaturation of proteins Higher levels of protein structure are formed without covalent bonds. Therefore, they are not as stable as peptide covalent bonds which make protein primary structure
More informationStructure of the α-helix
Structure of the α-helix Structure of the β Sheet Protein Dynamics Basics of Quenching HDX Hydrogen exchange of amide protons is catalyzed by H 2 O, OH -, and H 3 O +, but it s most dominated by base
More informationWhat binds to Hb in addition to O 2?
Reading: Ch5; 158-169, 162-166, 169-174 Problems: Ch5 (text); 3,7,8,10 Ch5 (study guide-facts); 1,2,3,4,5,8 Ch5 (study guide-apply); 2,3 Remember Today at 5:30 in CAS-522 is the second chance for the MB
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr
More informationSECOND PUBLIC EXAMINATION. Honour School of Physics Part C: 4 Year Course. Honour School of Physics and Philosophy Part C C7: BIOLOGICAL PHYSICS
2757 SECOND PUBLIC EXAMINATION Honour School of Physics Part C: 4 Year Course Honour School of Physics and Philosophy Part C C7: BIOLOGICAL PHYSICS TRINITY TERM 2013 Monday, 17 June, 2.30 pm 5.45 pm 15
More informationHomology models of the tetramerization domain of six eukaryotic voltage-gated potassium channels Kv1.1-Kv1.6
Homology models of the tetramerization domain of six eukaryotic voltage-gated potassium channels Kv1.1-Kv1.6 Hsuan-Liang Liu* and Chin-Wen Chen Department of Chemical Engineering and Graduate Institute
More informationLesson Overview The Structure of DNA
12.2 THINK ABOUT IT The DNA molecule must somehow specify how to assemble proteins, which are needed to regulate the various functions of each cell. What kind of structure could serve this purpose without
More informationBiomolecules: lecture 10
Biomolecules: lecture 10 - understanding in detail how protein 3D structures form - realize that protein molecules are not static wire models but instead dynamic, where in principle every atom moves (yet
More informationProtein synthesis I Biochemistry 302. February 17, 2006
Protein synthesis I Biochemistry 302 February 17, 2006 Key features and components involved in protein biosynthesis High energy cost (essential metabolic activity of cell Consumes 90% of the chemical energy
More informationIntroduction to" Protein Structure
Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.
More informationMajor Types of Association of Proteins with Cell Membranes. From Alberts et al
Major Types of Association of Proteins with Cell Membranes From Alberts et al Proteins Are Polymers of Amino Acids Peptide Bond Formation Amino Acid central carbon atom to which are attached amino group
More informationBIOCHEMISTRY GUIDED NOTES - AP BIOLOGY-
BIOCHEMISTRY GUIDED NOTES - AP BIOLOGY- ELEMENTS AND COMPOUNDS - anything that has mass and takes up space. - cannot be broken down to other substances. - substance containing two or more different elements
More informationProtein Folding In Vitro*
Protein Folding In Vitro* Biochemistry 412 February 29, 2008 [*Note: includes computational (in silico) studies] Fersht & Daggett (2002) Cell 108, 573. Some folding-related facts about proteins: Many small,
More informationProtein Structure. Hierarchy of Protein Structure. Tertiary structure. independently stable structural unit. includes disulfide bonds
Protein Structure Hierarchy of Protein Structure 2 3 Structural element Primary structure Secondary structure Super-secondary structure Domain Tertiary structure Quaternary structure Description amino
More informationLocal Interactions Dominate Folding in a Simple Protein Model
J. Mol. Biol. (1996) 259, 988 994 Local Interactions Dominate Folding in a Simple Protein Model Ron Unger 1,2 * and John Moult 2 1 Department of Life Sciences Bar-Ilan University Ramat-Gan, 52900, Israel
More informationBSc and MSc Degree Examinations
Examination Candidate Number: Desk Number: BSc and MSc Degree Examinations 2018-9 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes Marking
More informationEffect of the Single and Double Chain Surfactant Cobalt(III) Complexes on Their Hydrophobicity, Micelle Formation,
Electronic Supplementary Material (ESI) for Inorganic Chemistry Frontiers. This journal is the Partner Organisations 2014 Supplementary Information Effect of the Single and Double Chain Surfactant Cobalt(III)
More informationProtein synthesis I Biochemistry 302. Bob Kelm February 23, 2004
Protein synthesis I Biochemistry 302 Bob Kelm February 23, 2004 Key features of protein synthesis Energy glutton Essential metabolic activity of the cell. Consumes 90% of the chemical energy (ATP,GTP).
More informationLecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability
Lecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability Part I. Review of forces Covalent bonds Non-covalent Interactions: Van der Waals Interactions
More informationSupplementary Information. Structural basis for precursor protein-directed ribosomal peptide macrocyclization
Supplementary Information Structural basis for precursor protein-directed ribosomal peptide macrocyclization Kunhua Li 1,3, Heather L. Condurso 1,3, Gengnan Li 1, Yousong Ding 2 and Steven D. Bruner 1*
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. The asymmetric unit in para-iodio-phenylalanine crystal. The 50% probability ellipsoid representation was prepared using the Mercury Software. Colors are as
More informationEXAM I COURSE TFY4310 MOLECULAR BIOPHYSICS December Suggested resolution
page 1 of 7 EXAM I COURSE TFY4310 MOLECULAR BIOPHYSICS December 2013 Suggested resolution Exercise 1. [total: 25 p] a) [t: 5 p] Describe the bonding [1.5 p] and the molecular orbitals [1.5 p] of the ethylene
More informationRNA & PROTEIN SYNTHESIS. Making Proteins Using Directions From DNA
RNA & PROTEIN SYNTHESIS Making Proteins Using Directions From DNA RNA & Protein Synthesis v Nitrogenous bases in DNA contain information that directs protein synthesis v DNA remains in nucleus v in order
More informationOrganic Chemistry Option II: Chemical Biology
Organic Chemistry Option II: Chemical Biology Recommended books: Dr Stuart Conway Department of Chemistry, Chemistry Research Laboratory, University of Oxford email: stuart.conway@chem.ox.ac.uk Teaching
More informationSecondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure
Bioch/BIMS 503 Lecture 2 Structure and Function of Proteins August 28, 2008 Robert Nakamoto rkn3c@virginia.edu 2-0279 Secondary Structure Φ Ψ angles determine protein structure Φ Ψ angles are restricted
More informationBIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) PROTEINS
BIOLOGY BIOCHEMISTRY Unit 2 Part 4 ACTIVITY #6 (Chapter 5) NAME NAME PERIOD PROTEINS GENERAL CHARACTERISTICS AND IMPORTANCES: Polymers of amino acids Each has unique 3-D shape Vary in sequence of amino
More informationFrom Amino Acids to Proteins - in 4 Easy Steps
From Amino Acids to Proteins - in 4 Easy Steps Although protein structure appears to be overwhelmingly complex, you can provide your students with a basic understanding of how proteins fold by focusing
More informationCHEM 3653 Exam # 1 (03/07/13)
1. Using phylogeny all living organisms can be divided into the following domains: A. Bacteria, Eukarya, and Vertebrate B. Archaea and Eukarya C. Bacteria, Eukarya, and Archaea D. Eukarya and Bacteria
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationNMR Characterization of Partially Folded and Unfolded Conformational Ensembles of Proteins
Elisar Barbar Department of Chemistry and Biochemistry, Ohio University, Athens, OH 45701 NMR Characterization of Partially Folded and Unfolded Conformational Ensembles of Proteins Abstract: Studies of
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationTranslation. Genetic code
Translation Genetic code If genes are segments of DNA and if DNA is just a string of nucleotide pairs, then how does the sequence of nucleotide pairs dictate the sequence of amino acids in proteins? Simple
More informationIntroduction to Polymer Physics
Introduction to Polymer Physics Enrico Carlon, KU Leuven, Belgium February-May, 2016 Enrico Carlon, KU Leuven, Belgium Introduction to Polymer Physics February-May, 2016 1 / 28 Polymers in Chemistry and
More informationMBLG lecture 5. The EGG! Visualising Molecules. Dr. Dale Hancock Lab 715
MBLG lecture 5 Dr. Dale Hancock D.Hancock@mmb.usyd.edu.au Lab 715 The EGG! Visualising Molecules In molecular biology and biochemistry it is better to view molecules as killer pythons rather than smarties.
More informationSignal Transduction Phosphorylation Protein kinases. Misfolding diseases. Protein Engineering Lysozyme variants
Signal Transduction Phosphorylation Protein kinases Misfolding diseases Protein Engineering Lysozyme variants Cells and Signals Regulation The cell must be able to respond to stimuli Cellular activities
More informationAmino Acid Structures from Klug & Cummings. 10/7/2003 CAP/CGS 5991: Lecture 7 1
Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 1 Amino Acid Structures from Klug & Cummings 10/7/2003 CAP/CGS 5991: Lecture 7 2 Amino Acid Structures from Klug & Cummings
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationGene regulation I Biochemistry 302. Bob Kelm February 25, 2005
Gene regulation I Biochemistry 302 Bob Kelm February 25, 2005 Principles of gene regulation (cellular versus molecular level) Extracellular signals Chemical (e.g. hormones, growth factors) Environmental
More informationBiological Macromolecules
Introduction for Chem 493 Chemistry of Biological Macromolecules Dr. L. Luyt January 2008 Dr. L. Luyt Chem 493-2008 1 Biological macromolecules are the molecules of life allow for organization serve a
More information1. What is an ångstrom unit, and why is it used to describe molecular structures?
1. What is an ångstrom unit, and why is it used to describe molecular structures? The ångstrom unit is a unit of distance suitable for measuring atomic scale objects. 1 ångstrom (Å) = 1 10-10 m. The diameter
More informationStructure Determination by NMR Spectroscopy #3-1
Structure Determination by NMR Spectroscopy #3-1 3. Computational methods in NMR-spectroscopy 3.1 Nomenclature of proteins and nucleic acids 3.1.1. Classification of structural relationships between molecules
More informationBiotechnology of Proteins. The Source of Stability in Proteins (III) Fall 2015
Biotechnology of Proteins The Source of Stability in Proteins (III) Fall 2015 Conformational Entropy of Unfolding It is The factor that makes the greatest contribution to stabilization of the unfolded
More informationBiochemistry Quiz Review 1I. 1. Of the 20 standard amino acids, only is not optically active. The reason is that its side chain.
Biochemistry Quiz Review 1I A general note: Short answer questions are just that, short. Writing a paragraph filled with every term you can remember from class won t improve your answer just answer clearly,
More informationBiochemistry: Concepts and Connections
Biochemistry: Concepts and Connections Dean R. Appling Spencer J. Anthony-Cahill Christopher K. Mathews Chapter 6 The Three Dimensional Structure of Proteins Cartoon representation of myoglobin, showing
More informationInterdisciplinary Nanoscience Center University of Aarhus, Denmark. Design and Imaging. Assistant Professor.
Interdisciplinary Nanoscience Center University of Aarhus, Denmark Design and Imaging DNA Nanostructures Assistant Professor Wael Mamdouh wael@inano.dk Molecular Self-assembly Synthesis, SPM microscopy,
More informationCell Division. OpenStax College. 1 Genomic DNA
OpenStax-CNX module: m44459 1 Cell Division OpenStax College This work is produced by OpenStax-CNX and licensed under the Creative Commons Attribution License 3.0 By the end of this section, you will be
More informationContents. xiii. Preface v
Contents Preface Chapter 1 Biological Macromolecules 1.1 General PrincipIes 1.1.1 Macrornolecules 1.2 1.1.2 Configuration and Conformation Molecular lnteractions in Macromolecular Structures 1.2.1 Weak
More informationAchievement of Protein Thermostability by Amino Acid Substitution. 2018/6/30 M1 Majima Sohei
Achievement of Protein Thermostability by Amino Acid Substitution 2018/6/30 M1 Majima Sohei Contents of Today s seminar Introduction Study on hyperthermophilic enzymes to understand the origin of thermostability
More information4 Examples of enzymes
Catalysis 1 4 Examples of enzymes Adding water to a substrate: Serine proteases. Carbonic anhydrase. Restrictions Endonuclease. Transfer of a Phosphoryl group from ATP to a nucleotide. Nucleoside monophosphate
More informationPaul Sigler et al, 1998.
Biological systems are necessarily metastable. They are created, modulated, and destroyed according to a temporal plan that meets the survival needs of the cell, organism, and species...clearly, no biological
More informationBiophysics Service at the MPIB Biochemistry Core Facility Stephan Uebel, Biochemistry Core Facility
Biophysics Service at the MPIB Biochemistry Core Facility 30.11.2015 Stephan Uebel, Biochemistry Core Facility uebel@biochem.mpg.de Overview Peptide Chemistry - Peptide synthesis -Amino acid analysis -
More informationTHE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION
THE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION AND CALIBRATION Calculation of turn and beta intrinsic propensities. A statistical analysis of a protein structure
More informationBCHS 6229 Protein Structure and Function. Lecture 3 (October 18, 2011) Protein Folding: Forces, Mechanisms & Characterization
BCHS 6229 Protein Structure and Function Lecture 3 (October 18, 2011) Protein Folding: Forces, Mechanisms & Characterization 1 The folding problem One of the greatest unsolved problems of Science The folding
More informationBA, BSc, and MSc Degree Examinations
Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes
More informationRanjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India. 1 st November, 2013
Hydration of protein-rna recognition sites Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India 1 st November, 2013 Central Dogma of life DNA
More informationMultimedia : Fibronectin and Titin unfolding simulation movies.
I LECTURE 21: SINGLE CHAIN ELASTICITY OF BIOMACROMOLECULES: THE GIANT PROTEIN TITIN AND DNA Outline : REVIEW LECTURE #2 : EXTENSIBLE FJC AND WLC... 2 STRUCTURE OF MUSCLE AND TITIN... 3 SINGLE MOLECULE
More informationProtein Folding experiments and theory
Protein Folding experiments and theory 1, 2,and 3 Protein Structure Fig. 3-16 from Lehninger Biochemistry, 4 th ed. The 3D structure is not encoded at the single aa level Hydrogen Bonding Shared H atom
More informationtitin, has 35,213 amino acid residues (the human version of titin is smaller, with only 34,350 residues in the full length protein).
Introduction to Protein Structure Proteins are large heteropolymers usually comprised of 50 2500 monomer units, although larger proteins are observed 8. The monomer units of proteins are amino acids. Proteins
More informationTypes of RNA. 1. Messenger RNA(mRNA): 1. Represents only 5% of the total RNA in the cell.
RNAs L.Os. Know the different types of RNA & their relative concentration Know the structure of each RNA Understand their functions Know their locations in the cell Understand the differences between prokaryotic
More informationSelf-assembled bionanostructures: proteins following the lead of DNA nanostructures
Gradišar and Jerala Journal of Nanobiotechnology 2014, 12:4 REVIEW Self-assembled bionanostructures: proteins following the lead of DNA nanostructures Helena Gradišar 1,2* and Roman Jerala 1,2* Open Access
More informationStudy of Non-Covalent Complexes by ESI-MS. By Quinn Tays
Study of Non-Covalent Complexes by ESI-MS By Quinn Tays History Overview Background Electrospray Ionization How it is used in study of noncovalent interactions Uses of the Technique Types of molecules
More informationNPTEL VIDEO LECTURE TOPICS FOR BIO-TECHNOLOGY
NPTEL VIDEO LECTURE TOPICS FOR BIO-TECHNOLOGY New No.1, Vembuliamman Koil Street, Pazhavanthangal, Chennai 600 114 Phone: 98841 65649 / 98847 36552 E-mail: nptel@linuxpert.in NPTEL Video Course - Biotechnology
More informationBio nformatics. Lecture 23. Saad Mneimneh
Bio nformatics Lecture 23 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely
More information