Homology Modeling I. Growth of the Protein Data Bank PDB. Basel, September 30, EMBnet course: Introduction to Protein Structure Bioinformatics
|
|
- Stephanie Pearson
- 5 years ago
- Views:
Transcription
1 Swiss Institute of Bioinformatics EMBnet course: Introduction to Protein Structure Bioinformatics Homology Modeling I Basel, September 30, 2004 Torsten Schwede Biozentrum - Universität Basel Swiss Institute of Bioinformatics Klingelbergstr CH Basel, Switzerland Tel: Growth of the Protein Data Bank PDB [ PDB: ]
2 Public Database Holdings 1'000' '000 No experimental structure for most sequences 10'000 1'000 TrEMBL SwissProt PDB MNIFEMLRID EGLRLKIYKD TEGYYTIGIG HLLTKSPSLN AAKSELDKAI GRNCNGVITK DEAEKLFNQD VDAAVRGILR NAKLKPVYDS LDAVRRCALI NMVFQMGETG VAGFTNSLRM LQQKRWDEAA VNLAKSRWYN QTPNRAKRVI TTFRTGTWDA YKNL Many proteins fold spontaneously to their native structure Protein folding is relatively fast (nsec sec) Chaperones speed up folding, but do not alter the structure The protein sequence contains all information needed to create a correctly folded protein. Can we predict protein structures from protein sequences alone (ab initio)?
3 ν = bonds angles torsions Molecular Dynamics ki 2 ki 2 VN 2 ( l l ) ( θ θ ) i i i,0 i,0 ( 1+ cos( nω γ )) N N σ ij σ ij qiq j = + 4πεij + i 1 j i 1 rij rij 4πε 0rij = Ab initio protein folding simulation Physical time for simulation 10 4 seconds Typical time-step size seconds Number of MD time steps Atoms in a typical protein and water simulation Approximate number of interactions in force calculation 10 9 Machine instructions per force calculation 1000 Total number of machine instructions BlueGene capacity (floating point operations per second) 1 petaflop (10 15 ) Blue Gene will need 1-3 years to simulate 100 µsec. [ ]
4 Rosetta Stone Approach David Baker group Find sequence patterns that strongly correlate with protein structure at the local level to create a library of fragments (Isites). E.g. amphipathic helix : Amino acid statistics Helix position Rosetta Stone Approach To build a model building for a new sequence: Search for compatible fragments (reduced alphabet) Use Monte Carlo simulated annealing to assemble overlapping fragments Scoring functions are used to select best models (~1000)
5 Rosetta Stone Approach Generates thousands of models Best Models in CASP4: ~ 5 10 Å rmsd Ca Difficult to distinguish good and bad models The number of different protein folds is limited: Already known folds PDB submissions per year New folds Year
6 Evolution of the globin family: Evolution of protein structure families Rmsd of backbone atoms in core Percent identical residues in core [ Chothia & Lesk (1986) ] Common core = all residues that can be superposed in 3D For proteins > 60% identical residues, the core contains > 90 % of all residues deviating less than 1.0 Å.
7 .. Sequence similarity implies structural similarity? 100 identity Percentage sequence identity/similarity Don t know Sequence identity implies structural similarity region... (B.Rost, Columbia, NewYork) Number of residues aligned Sequence similarity implies structural similarity? Percentage sequence identity/similarity Don t know Sequence identity implies structural similarity region... identity similarity (B.Rost, Columbia, NewYork) Number of residues aligned
8 Similar Sequence Similar Structure Homology modeling = Comparative protein modeling = Knowledge-based modeling Idea: Using experimental 3D-structures of related family members (templates) to calculate a model for a new sequence (target). Comparative Modeling Known Structures (Templates) Target Sequence Template Selection Alignment Template - Target Structure Evaluation & Assessment Structure modeling Homology Model(s)
9 Comparative Modeling Known Structures (Templates) Target Sequence Template Selection Protein Data Bank PDB Alignment Template - Target Structure modeling Structure Evaluation & Assessment Database of templates Homology Model(s) Separate into single chains Remove bad structures (models) Create BLASTable database or fold library (profiles, HMMs) Comparative Modeling Known Structures (Templates) Template selection: Target Sequence Template Selection Alignment Template - Target Structure Evaluation & Assessment 1. Sequence Similarity / Fold recognition 2. Structure quality (resolution, experimental method) Structure modeling Homology Model(s) 3. Experimental conditions (ligands and cofactors)
10 Comparative Modeling Known Structures (Templates) Target Sequence Template Selection Multiple sequence alignment for pairs > 40% identity or Use structural alignment of templates to guide sequence alignment of target or Use separate profiles for template and targets Alignment Template - Target Structure modeling Homology Model(s) Structure Evaluation & Assessment Comparative Modeling Known Structures (Templates) Target Sequence Template Selection Alignment Template - Target Structure Evaluation & Assessment Errors in template selection or alignment result in bad models Structure modeling Homology Model(s) iterative cycles of alignment, modeling and evaluation Built many models, choose best.
11 Comparative Modeling Known Structures (Templates) Target Sequence Template Selection Alignment Template - Target Structure Evaluation & Assessment I. Manual Model building Structure modeling II. Template based fragment assembly Composer (Sybyl, Tripos) SWISS-MODEL Homology Model(s) III. Satisfaction of spatial restraints Modeller (Insight II, MSI) CPH-Models I. Manual Modeling [ ]
12 II. Template based fragment assembly Find structurally conserved core regions II. Template based fragment assembly Build model core by averaging core template backbone atoms (weighted by local sequence similarity with the target sequence). Leave non-conserved regions (loops) for later.
13 II. Template based fragment assembly Loop (insertion) modeling Use the spare part algorithm to find compatible fragments in a Loop- Database, or ab-initio rebuilding (e.g. Monte Carlo, MD, GA, etc.) to build missing loops. II. Template based fragment assembly Side Chain placement Find the most probable side chain conformation, using homologues structure information back-bone dependent rotamer libraries energetic and packing criteria
14 II. Template based fragment assembly Rotamer Libraries Only a small fraction of all possible side chain conformations is observed in experimental structures Rotamer libraries provide an ensemble of likely conformations The propensity of rotamers depends on the backbone geometry: Backbone-dependent rotamer libraries Phe,Tyr, His g+ p(g+ phi) p(g+ psi) trans p(t phi) p(t psi) p(g- phi) p(g- psi) g-
15 II. Template based fragment assembly Energy minimization modeling method will produce unfavorable contacts and bonds Energy minimization is used to regularize local bond and angle geometry Relax close contacts and geometric strain extensive energy minimization will move coordinates away from real structure keep it to a minimum SWISS-MODEL is using GROMOS 96 force field for a steepest descent III. Satisfaction of Spatial restraints Alignment of target sequence with templates Extraction of spatial restraints from templates Modeling by satisfaction of spatial restraints M A T E A F T Q S G
16 III. Satisfaction of Spatial restraints Some features of a protein structure: R resolution of X-ray experiment r amino acid residue type Φ, Ψ main chain angles t secondary structure class M main chain conformation class Χ i,, c i side chain dihedral angle class a residue solvent accessibility s residue neighborhood difference d C a -C a distance d difference between two C a -C a distances III. Satisfaction of Spatial restraints Feature properties can be associated with a protein (e.g. X-ray resolution) residues (e.g. solvent accessibility) pairs of residues (e.g. C a -C a distance) other features (e.g. main chain classes) How can we derive modeling restraints from this data? A restraint is defined as probability density function (pdf) p(x): p( x1 x < x2) = x1 x2 p( x) dx with p( x) dx = 1 p( x) > 0
17 III. Satisfaction of Spatial restraints Derive pdfs from frequency tables by smoothing: a) 11 Cys residues Chi-1 angles b) smoothed distribution from a) c) 297 Cys Chi-1 angles as control III. Satisfaction of Spatial restraints Combine basis pdfs to molecular probability density functions 0.2 < s' < < s' ' < < s' < < s'' < < s' < < s'' < 0.4
18 III. Satisfaction of Spatial restraints Satisfaction of spatial restraints Find the protein model with the highest probability Variable target function: Start with a linear conformation model or a model close to the template conformation At first, use only local restraints minimize some steps using a conjugate gradient optimization repeat with introducing more and more long range restraints until all restraints are used Model Accuracy Evaluation CASP Community Wide Experiment on the Critical Assessment of Techniques for Protein Structure Prediction EVA Evaluation of Automatic protein structure prediction [ Burkhard Rost, Andrej Sali, ]
19 Evaluation of Automatic protein structure prediction [ Burkhard Rost, Andrej Sali, ] New PDB Release Prediction Servers Target Sequence MNIFEMLRID EGLRLKIYKD TEGYYTIGIG HLLTKSPSLN AAKSELDKAI GRNCNGVITK 2 1 e.g. 3 Evaluation of prediction accuracy Typical types of errors Sequence alignment errors. Loops which cannot be rebuilt. Inappropriate template selection. Structural rearrangements.
20 Empirical Force Fields e.g. GROMOS, CHARMM, AMBER,... Which type of errors in a protein structure can you identify by an empirical force filed? Which type of errors are not recognized? Statistical Methods Ramachandran Plot of backbone angles (ϕ,ψ) favored regions generously allowed regions disallowed regions Amino acids with special properties: PRO: ϕ = 60º GLY () Useful to identify regions with errors in backbone geometry
21 1D - 3D Checks Probability for a feature to occur in a given environment, e.g. Solvent exposed / buried Hydrophobic / polar environment Electrostatic interactions Secondary structure etc. Statistical Mean Force Potentials A I * + II III Val13 Met80 Phe134 Ala182 B *, Met80 +, Ile86 I, Val13 III, Ala182 II, Phe134
22 Atom Type Definitions Statistical Mean Force Potentials MFP kcal/mol Methyl-Methyl pairs Cysteine S-S-pairs Distance Å Distance Å
23 ANOLEA : (Atomic Non-Local Environment Assessment) ANOLEA Correct Structure: PDB: 1GES Detects local packing errors Errors in alignments Model with wrong alignment:
24 PROCHECK Checks the stereo-chemical quality of a protein structure, producing a number of plots analyzing its overall and residue-by-residue geometry. Covalent geometry Planarity Dihedral angles Chirality Non-bonded interactions Main-chain hydrogen bonds Disulphide bonds Stereochemical parameters Residue-by-residue analysis Laskowski R A, MacArthur M W, Moss D S & Thornton J M (1993). PROCHECK: a program to check the stereochemical quality of protein structures. J. Appl. Cryst., 26, Morris A L, MacArthur M W, Hutchinson E G & Thornton J M (1992). Stereochemical quality of protein structure coordinates. Proteins, 12, WhatCheck / WhatIf WHAT IF I check my structure? Imagine... An everyday situation in a biocomputing lab: "Should they use the structure?" An everyday situation in a crystallography lab: "Should they deposit the structure already?" In a WHAT_CHECK report, each reported fact has an assigned severity: error: severe errors encountered during the analyses. Items marked as errors are considered severe problems requiring immediate attention. warning: Either less severe problems or uncommon structural features. These still need special attention. note: Statistical values, plots, or other verbose results of tests and analyses that have been performed. WHAT IF: A molecular modeling and drug design program. G.Vriend, J. Mol. Graph. (1990) 8, Errors in protein structures. R.W.W. Hooft, G. Vriend, C. Sander, E.E. Abola, Nature (1996) 381,
25 WhatCheck / WhatIf report for a bad model... # 49 # Note: Summary report for users of a structure This is an overall summary of the quality of the structure as compared with current reliable structures. This summary is most useful for biologists seeking a good structure to use for modelling calculations. The second part of the table mostly gives an impression of how well the model conforms to common refinement constraint values. The first part of the table shows a number of constraint-independent quality indicators. Structure Z-scores, positive is better than average: 1st generation packing quality : nd generation packing quality : (bad) Ramachandran plot appearance : chi-1/chi-2 rotamer normality : Backbone conformation : RMS Z-scores, should be close to 1.0: Bond lengths : Bond angles : Omega angle restraints : Side chain planarity : (loose) Improper dihedral distribution : (loose) Inside/Outside distribution : (unusual) All checking tools are happy, so can I believe it now? Models are not experimental facts! Models can be partially inaccurate or sometimes completely wrong! A model is a tool that helps to interpret biochemical data.
26 Some useful Evaluation Tools ANOLEA : (Atomic Non-Local Environment Assessment) ProCheck WhatCheck Verify3D Biotech Validation Suite for Protein Structures Model quality vs. sequence identity Midnight Zone Twilight Zone Save Zone
27 What can models be used for? Discovery of CK2a Inhibitors by in silico docking Homology model of the target molecule: Reference: Discovery of a potent and selective protein kinase CK2 inhibitor by high-throughput docking. Vangrevelinghe E, Zimmermann K, Schoepfer J, Portmann R, Fabbro D, Furet P. Oncology Research, Novartis Pharma, Basle, J Med Chem Jun 19;46(13):
28 Discovery of CK2a Inhibitors by in silico docking In silico docking of a virtual library of compounds Distributed Computing on PC Grid Structural Genomics large scale experimental structure solution projects Goal: Most of the sequences in a genome database should match at least one structure with a sufficient sequence identity allowing for reliable modeling. The modeling error determines selection of targets for structural genomics. Range of sequence space that can be modeled with acceptable accuracy.
29 Structural Genomics Target Selection Protein Modeling Resources SWISS-MODEL Modeller WhatIf 3D-JIGSAW CPHmodels SDSC
Protein Structure Bioinformatics Introduction
1 Swiss Institute of Bioinformatics Protein Structure Bioinformatics Introduction Basel, 27. September 2004 Torsten Schwede Biozentrum - Universität Basel Swiss Institute of Bioinformatics Klingelbergstr
More informationHomology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB
Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More informationProgramme Last week s quiz results + Summary Fold recognition Break Exercise: Modelling remote homologues
Programme 8.00-8.20 Last week s quiz results + Summary 8.20-9.00 Fold recognition 9.00-9.15 Break 9.15-11.20 Exercise: Modelling remote homologues 11.20-11.40 Summary & discussion 11.40-12.00 Quiz 1 Feedback
More informationProtein Structure: Prediction and Analysis. Recap: Basic principles of proteins and their 3-dimensional structures
Swiss Institute of Bioinformatics SIB Doctoral School in Bioinformatics Advanced Course rotein Structure: rediction and Analysis Day 2: rotein Structure Modeling Lausanne, September 1-5, 2008 Torsten Schwede
More informationHOMOLOGY MODELING. The sequence alignment and template structure are then used to produce a structural model of the target.
HOMOLOGY MODELING Homology modeling, also known as comparative modeling of protein refers to constructing an atomic-resolution model of the "target" protein from its amino acid sequence and an experimental
More informationModeling for 3D structure prediction
Modeling for 3D structure prediction What is a predicted structure? A structure that is constructed using as the sole source of information data obtained from computer based data-mining. However, mixing
More informationCan protein model accuracy be. identified? NO! CBS, BioCentrum, Morten Nielsen, DTU
Can protein model accuracy be identified? Morten Nielsen, CBS, BioCentrum, DTU NO! Identification of Protein-model accuracy Why is it important? What is accuracy RMSD, fraction correct, Protein model correctness/quality
More informationProcheck output. Bond angles (Procheck) Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics.
Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics Iosif Vaisman Email: ivaisman@gmu.edu ----------------------------------------------------------------- Bond
More informationProtein Modeling Methods. Knowledge. Protein Modeling Methods. Fold Recognition. Knowledge-based methods. Introduction to Bioinformatics
Protein Modeling Methods Introduction to Bioinformatics Iosif Vaisman Ab initio methods Energy-based methods Knowledge-based methods Email: ivaisman@gmu.edu Protein Modeling Methods Ab initio methods:
More information7.91 Amy Keating. Solving structures using X-ray crystallography & NMR spectroscopy
7.91 Amy Keating Solving structures using X-ray crystallography & NMR spectroscopy How are X-ray crystal structures determined? 1. Grow crystals - structure determination by X-ray crystallography relies
More informationBuilding 3D models of proteins
Building 3D models of proteins Why make a structural model for your protein? The structure can provide clues to the function through structural similarity with other proteins With a structure it is easier
More informationHomology modeling. Dinesh Gupta ICGEB, New Delhi 1/27/2010 5:59 PM
Homology modeling Dinesh Gupta ICGEB, New Delhi Protein structure prediction Methods: Homology (comparative) modelling Threading Ab-initio Protein Homology modeling Homology modeling is an extrapolation
More informationMolecular Modeling. Prediction of Protein 3D Structure from Sequence. Vimalkumar Velayudhan. May 21, 2007
Molecular Modeling Prediction of Protein 3D Structure from Sequence Vimalkumar Velayudhan Jain Institute of Vocational and Advanced Studies May 21, 2007 Vimalkumar Velayudhan Molecular Modeling 1/23 Outline
More informationProtein structure analysis. Risto Laakso 10th January 2005
Protein structure analysis Risto Laakso risto.laakso@hut.fi 10th January 2005 1 1 Summary Various methods of protein structure analysis were examined. Two proteins, 1HLB (Sea cucumber hemoglobin) and 1HLM
More informationProtein Structure Prediction, Engineering & Design CHEM 430
Protein Structure Prediction, Engineering & Design CHEM 430 Eero Saarinen The free energy surface of a protein Protein Structure Prediction & Design Full Protein Structure from Sequence - High Alignment
More informationDesign of a Novel Globular Protein Fold with Atomic-Level Accuracy
Design of a Novel Globular Protein Fold with Atomic-Level Accuracy Brian Kuhlman, Gautam Dantas, Gregory C. Ireton, Gabriele Varani, Barry L. Stoddard, David Baker Presented by Kate Stafford 4 May 05 Protein
More informationCMPS 3110: Bioinformatics. Tertiary Structure Prediction
CMPS 3110: Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the laws of physics! Conformation space is finite
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Tertiary Structure Prediction
CMPS 6630: Introduction to Computational Biology and Bioinformatics Tertiary Structure Prediction Tertiary Structure Prediction Why Should Tertiary Structure Prediction Be Possible? Molecules obey the
More informationProtein Structure Prediction
Protein Structure Prediction Michael Feig MMTSB/CTBP 2006 Summer Workshop From Sequence to Structure SEALGDTIVKNA Ab initio Structure Prediction Protocol Amino Acid Sequence Conformational Sampling to
More informationProtein Structure Prediction
Page 1 Protein Structure Prediction Russ B. Altman BMI 214 CS 274 Protein Folding is different from structure prediction --Folding is concerned with the process of taking the 3D shape, usually based on
More informationALL LECTURES IN SB Introduction
1. Introduction 2. Molecular Architecture I 3. Molecular Architecture II 4. Molecular Simulation I 5. Molecular Simulation II 6. Bioinformatics I 7. Bioinformatics II 8. Prediction I 9. Prediction II ALL
More informationPhysiochemical Properties of Residues
Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)
More informationProtein Structures: Experiments and Modeling. Patrice Koehl
Protein Structures: Experiments and Modeling Patrice Koehl Structural Bioinformatics: Proteins Proteins: Sources of Structure Information Proteins: Homology Modeling Proteins: Ab initio prediction Proteins:
More informationDihedral Angles. Homayoun Valafar. Department of Computer Science and Engineering, USC 02/03/10 CSCE 769
Dihedral Angles Homayoun Valafar Department of Computer Science and Engineering, USC The precise definition of a dihedral or torsion angle can be found in spatial geometry Angle between to planes Dihedral
More informationCS612 - Algorithms in Bioinformatics
Fall 2017 Protein Structure Detection Methods October 30, 2017 Comparative Modeling Comparative modeling is modeling of the unknown based on comparison to what is known In the context of modeling or computing
More informationHomology Modeling. Roberto Lins EPFL - summer semester 2005
Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,
More informationProtein Modeling. Generating, Evaluating and Refining Protein Homology Models
Protein Modeling Generating, Evaluating and Refining Protein Homology Models Troy Wymore and Kristen Messinger Biomedical Initiatives Group Pittsburgh Supercomputing Center Homology Modeling of Proteins
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/309/5742/1868/dc1 Supporting Online Material for Toward High-Resolution de Novo Structure Prediction for Small Proteins Philip Bradley, Kira M. S. Misura, David Baker*
More informationExamples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE
Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To
More informationProtein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror
Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major
More information114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009
114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009 9 Protein tertiary structure Sources for this chapter, which are all recommended reading: D.W. Mount. Bioinformatics: Sequences and Genome
More informationProtein Structure Determination Using NMR Restraints BCMB/CHEM 8190
Protein Structure Determination Using NMR Restraints BCMB/CHEM 8190 Programs for NMR Based Structure Determination CNS - Brünger, A. T.; Adams, P. D.; Clore, G. M.; DeLano, W. L.; Gros, P.; Grosse-Kunstleve,
More informationTemplate Free Protein Structure Modeling Jianlin Cheng, PhD
Template Free Protein Structure Modeling Jianlin Cheng, PhD Associate Professor Computer Science Department Informatics Institute University of Missouri, Columbia 2013 Protein Energy Landscape & Free Sampling
More informationPROTEIN'STRUCTURE'DETERMINATION'
PROTEIN'STRUCTURE'DETERMINATION' USING'NMR'RESTRAINTS' BCMB/CHEM'8190' Programs for NMR Based Structure Determination CNS - Brünger, A. T.; Adams, P. D.; Clore, G. M.; DeLano, W. L.; Gros, P.; Grosse-Kunstleve,
More informationAb-initio protein structure prediction
Ab-initio protein structure prediction Jaroslaw Pillardy Computational Biology Service Unit Cornell Theory Center, Cornell University Ithaca, NY USA Methods for predicting protein structure 1. Homology
More informationFigure 1. Molecules geometries of 5021 and Each neutral group in CHARMM topology was grouped in dash circle.
Project I Chemistry 8021, Spring 2005/2/23 This document was turned in by a student as a homework paper. 1. Methods First, the cartesian coordinates of 5021 and 8021 molecules (Fig. 1) are generated, in
More informationUser Guide for LeDock
User Guide for LeDock Hongtao Zhao, PhD Email: htzhao@lephar.com Website: www.lephar.com Copyright 2017 Hongtao Zhao. All rights reserved. Introduction LeDock is flexible small-molecule docking software,
More informationProtein Structure Prediction
Protein Structure Prediction Michael Feig MMTSB/CTBP 2009 Summer Workshop From Sequence to Structure SEALGDTIVKNA Folding with All-Atom Models AAQAAAAQAAAAQAA All-atom MD in general not succesful for real
More informationProtein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.
Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr
More informationProtein Structure Determination
Protein Structure Determination Given a protein sequence, determine its 3D structure 1 MIKLGIVMDP IANINIKKDS SFAMLLEAQR RGYELHYMEM GDLYLINGEA 51 RAHTRTLNVK QNYEEWFSFV GEQDLPLADL DVILMRKDPP FDTEFIYATY 101
More informationAssignment 2 Atomic-Level Molecular Modeling
Assignment 2 Atomic-Level Molecular Modeling CS/BIOE/CME/BIOPHYS/BIOMEDIN 279 Due: November 3, 2016 at 3:00 PM The goal of this assignment is to understand the biological and computational aspects of macromolecular
More informationMolecular Mechanics, Dynamics & Docking
Molecular Mechanics, Dynamics & Docking Lawrence Hunter, Ph.D. Director, Computational Bioscience Program University of Colorado School of Medicine Larry.Hunter@uchsc.edu http://compbio.uchsc.edu/hunter
More informationComputational Molecular Biology. Protein Structure and Homology Modeling
Computational Molecular Biology Protein Structure and Homology Modeling Prof. Alejandro Giorge1 Dr. Francesco Musiani Sequence, function and structure relationships v Life is the ability to metabolize
More informationStructural Bioinformatics (C3210) Molecular Docking
Structural Bioinformatics (C3210) Molecular Docking Molecular Recognition, Molecular Docking Molecular recognition is the ability of biomolecules to recognize other biomolecules and selectively interact
More informationTemplate Based Protein Structure Modeling Jianlin Cheng, PhD
Template Based Protein Structure Modeling Jianlin Cheng, PhD Professor Department of EECS Informatics Institute University of Missouri, Columbia 2018 Sequence, Structure and Function AGCWY Cell Protein
More informationReport of protein analysis
Report of protein analysis By the WHAT IF program 2010-09-19 1 Introduction what check is the name of the validation option in what if. It doesn t matter whether you use the what check program or the what
More informationCourse Notes: Topics in Computational. Structural Biology.
Course Notes: Topics in Computational Structural Biology. Bruce R. Donald June, 2010 Copyright c 2012 Contents 11 Computational Protein Design 1 11.1 Introduction.........................................
More information5.1. Hardwares, Softwares and Web server used in Molecular modeling
5. EXPERIMENTAL The tools, techniques and procedures/methods used for carrying out research work reported in this thesis have been described as follows: 5.1. Hardwares, Softwares and Web server used in
More informationFrancisco Melo, Damien Devos, Eric Depiereux and Ernest Feytmans
From: ISMB-97 Proceedings. Copyright 1997, AAAI (www.aaai.org). All rights reserved. ANOLEA: A www Server to Assess Protein Structures Francisco Melo, Damien Devos, Eric Depiereux and Ernest Feytmans Facultés
More informationProtein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror
Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationRietveld Structure Refinement of Protein Powder Diffraction Data using GSAS
Rietveld Structure Refinement of Protein Powder Diffraction Data using GSAS Jon Wright ESRF, Grenoble, France Plan This is a users perspective Cover the protein specific aspects (assuming knowledge of
More informationBuild_model v User Guide
Build_model v.2.0.1 User Guide MolTech Build_model User Guide 2008-2011 Molecular Technologies Ltd. www.moltech.ru Please send your comments and suggestions to contact@moltech.ru. Table of Contents Input
More informationSecondary Structure. Bioch/BIMS 503 Lecture 2. Structure and Function of Proteins. Further Reading. Φ, Ψ angles alone determine protein structure
Bioch/BIMS 503 Lecture 2 Structure and Function of Proteins August 28, 2008 Robert Nakamoto rkn3c@virginia.edu 2-0279 Secondary Structure Φ Ψ angles determine protein structure Φ Ψ angles are restricted
More informationNMR, X-ray Diffraction, Protein Structure, and RasMol
NMR, X-ray Diffraction, Protein Structure, and RasMol Introduction So far we have been mostly concerned with the proteins themselves. The techniques (NMR or X-ray diffraction) used to determine a structure
More informationTemplate Free Protein Structure Modeling Jianlin Cheng, PhD
Template Free Protein Structure Modeling Jianlin Cheng, PhD Professor Department of EECS Informatics Institute University of Missouri, Columbia 2018 Protein Energy Landscape & Free Sampling http://pubs.acs.org/subscribe/archive/mdd/v03/i09/html/willis.html
More informationHomology modeling of Ferredoxin-nitrite reductase from Arabidopsis thaliana
www.bioinformation.net Hypothesis Volume 6(3) Homology modeling of Ferredoxin-nitrite reductase from Arabidopsis thaliana Karim Kherraz*, Khaled Kherraz, Abdelkrim Kameli Biology department, Ecole Normale
More informationComputational Protein Design
11 Computational Protein Design This chapter introduces the automated protein design and experimental validation of a novel designed sequence, as described in Dahiyat and Mayo [1]. 11.1 Introduction Given
More informationChemical properties that affect binding of enzyme-inhibiting drugs to enzymes
Chemical properties that affect binding of enzyme-inhibiting drugs to enzymes Introduction The production of new drugs requires time for development and testing, and can result in large prohibitive costs
More informationStructure determination through NMR
Structure determination through NMR Protein Sample NMR data acquisition Sequential resonance assignment Collection of conformational constraints 3D structure calculations Structure refinement and Analysis
More informationBioinformatics: Secondary Structure Prediction
Bioinformatics: Secondary Structure Prediction Prof. David Jones d.jones@cs.ucl.ac.uk LMLSTQNPALLKRNIIYWNNVALLWEAGSD The greatest unsolved problem in molecular biology:the Protein Folding Problem? Entries
More informationTemplate-Based Modeling of Protein Structure
Template-Based Modeling of Protein Structure David Constant Biochemistry 218 December 11, 2011 Introduction. Much can be learned about the biology of a protein from its structure. Simply put, structure
More informationProtein Structures. 11/19/2002 Lecture 24 1
Protein Structures 11/19/2002 Lecture 24 1 All 3 figures are cartoons of an amino acid residue. 11/19/2002 Lecture 24 2 Peptide bonds in chains of residues 11/19/2002 Lecture 24 3 Angles φ and ψ in the
More informationMolecular Modeling Lecture 7. Homology modeling insertions/deletions manual realignment
Molecular Modeling 2018-- Lecture 7 Homology modeling insertions/deletions manual realignment Homology modeling also called comparative modeling Sequences that have similar sequence have similar structure.
More informationChemical properties that affect binding of enzyme-inhibiting drugs to enzymes
Introduction Chemical properties that affect binding of enzyme-inhibiting drugs to enzymes The production of new drugs requires time for development and testing, and can result in large prohibitive costs
More informationType II Kinase Inhibitors Show an Unexpected Inhibition Mode against Parkinson s Disease-Linked LRRK2 Mutant G2019S.
Type II Kinase Inhibitors Show an Unexpected Inhibition Mode against Parkinson s Disease-Linked LRRK2 Mutant G219S. Min Liu@&*, Samantha A. Bender%*, Gregory D Cuny@, Woody Sherman, Marcie Glicksman@ Soumya
More informationComputational Biology & Computational Medicine
Computational Biology & Computational Medicine Homayoun Valafar Outline Why proteins? What are proteins? How do we compute them? How do we use computational approaches? Why Proteins? Molecular basis of
More informationWeek 10: Homology Modelling (II) - HHpred
Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative
More informationLecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability
Lecture 2 and 3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability Part I. Review of forces Covalent bonds Non-covalent Interactions: Van der Waals Interactions
More informationTHE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION
THE TANGO ALGORITHM: SECONDARY STRUCTURE PROPENSITIES, STATISTICAL MECHANICS APPROXIMATION AND CALIBRATION Calculation of turn and beta intrinsic propensities. A statistical analysis of a protein structure
More informationThe typical end scenario for those who try to predict protein
A method for evaluating the structural quality of protein models by using higher-order pairs scoring Gregory E. Sims and Sung-Hou Kim Berkeley Structural Genomics Center, Lawrence Berkeley National Laboratory,
More informationDocking. GBCB 5874: Problem Solving in GBCB
Docking Benzamidine Docking to Trypsin Relationship to Drug Design Ligand-based design QSAR Pharmacophore modeling Can be done without 3-D structure of protein Receptor/Structure-based design Molecular
More informationEnhancing Specificity in the Janus Kinases: A Study on the Thienopyridine. JAK2 Selective Mechanism Combined Molecular Dynamics Simulation
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2015 Supporting Information Enhancing Specificity in the Janus Kinases: A Study on the Thienopyridine
More informationSteps in protein modelling. Structure prediction, fold recognition and homology modelling. Basic principles of protein structure
Structure prediction, fold recognition and homology modelling Marjolein Thunnissen Lund September 2012 Steps in protein modelling 3-D structure known Comparative Modelling Sequence of interest Similarity
More informationMolecular Modeling lecture 2
Molecular Modeling 2018 -- lecture 2 Topics 1. Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction 4. Where do protein structures come from? X-ray crystallography
More informationProtein Structure Basics
Protein Structure Basics Presented by Alison Fraser, Christine Lee, Pradhuman Jhala, Corban Rivera Importance of Proteins Muscle structure depends on protein-protein interactions Transport across membranes
More informationPresenter: She Zhang
Presenter: She Zhang Introduction Dr. David Baker Introduction Why design proteins de novo? It is not clear how non-covalent interactions favor one specific native structure over many other non-native
More informationPacking of Secondary Structures
7.88 Lecture Notes - 4 7.24/7.88J/5.48J The Protein Folding and Human Disease Professor Gossard Retrieving, Viewing Protein Structures from the Protein Data Base Helix helix packing Packing of Secondary
More information3D Structure. Prediction & Assessment Pt. 2. David Wishart 3-41 Athabasca Hall
3D Structure Prediction & Assessment Pt. 2 David Wishart 3-41 Athabasca Hall david.wishart@ualberta.ca Objectives Become familiar with methods and algorithms for secondary Structure Prediction Become familiar
More information09/06/25. Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Non-uniform distribution of folds. Scheme of protein structure predicition
Sequence identity Structural similarity Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Fold recognition Sommersemester 2009 Peter Güntert Structural similarity X Sequence identity Non-uniform
More informationSCOP. all-β class. all-α class, 3 different folds. T4 endonuclease V. 4-helical cytokines. Globin-like
SCOP all-β class 4-helical cytokines T4 endonuclease V all-α class, 3 different folds Globin-like TIM-barrel fold α/β class Profilin-like fold α+β class http://scop.mrc-lmb.cam.ac.uk/scop CATH Class, Architecture,
More informationBioinformatics. Macromolecular structure
Bioinformatics Macromolecular structure Contents Determination of protein structure Structure databases Secondary structure elements (SSE) Tertiary structure Structure analysis Structure alignment Domain
More informationKd = koff/kon = [R][L]/[RL]
Taller de docking y cribado virtual: Uso de herramientas computacionales en el diseño de fármacos Docking program GLIDE El programa de docking GLIDE Sonsoles Martín-Santamaría Shrödinger is a scientific
More informationNeural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha
Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this
More informationMolecular Mechanics. I. Quantum mechanical treatment of molecular systems
Molecular Mechanics I. Quantum mechanical treatment of molecular systems The first principle approach for describing the properties of molecules, including proteins, involves quantum mechanics. For example,
More informationGenerating Small Molecule Conformations from Structural Data
Generating Small Molecule Conformations from Structural Data Jason Cole cole@ccdc.cam.ac.uk Cambridge Crystallographic Data Centre 1 The Cambridge Crystallographic Data Centre About us A not-for-profit,
More informationHSQC spectra for three proteins
HSQC spectra for three proteins SH3 domain from Abp1p Kinase domain from EphB2 apo Calmodulin What do the spectra tell you about the three proteins? HSQC spectra for three proteins Small protein Big protein
More informationContact map guided ab initio structure prediction
Contact map guided ab initio structure prediction S M Golam Mortuza Postdoctoral Research Fellow I-TASSER Workshop 2017 North Carolina A&T State University, Greensboro, NC Outline Ab initio structure prediction:
More informationCrystal lattice Real Space. Reflections Reciprocal Space. I. Solving Phases II. Model Building for CHEM 645. Purified Protein. Build model.
I. Solving Phases II. Model Building for CHEM 645 Purified Protein Solve Phase Build model and refine Crystal lattice Real Space Reflections Reciprocal Space ρ (x, y, z) pronounced rho F hkl 2 I F (h,
More informationComputational protein design
Computational protein design There are astronomically large number of amino acid sequences that needs to be considered for a protein of moderate size e.g. if mutating 10 residues, 20^10 = 10 trillion sequences
More informationStructure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase Cwc27
Acta Cryst. (2014). D70, doi:10.1107/s1399004714021695 Supporting information Volume 70 (2014) Supporting information for article: Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase
More informationProtein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror
Protein structure (and biomolecular structure more generally) CS/CME/BioE/Biophys/BMI 279 Sept. 28 and Oct. 3, 2017 Ron Dror Please interrupt if you have questions, and especially if you re confused! Assignment
More informationVisualization of Macromolecular Structures
Visualization of Macromolecular Structures Present by: Qihang Li orig. author: O Donoghue, et al. Structural biology is rapidly accumulating a wealth of detailed information. Over 60,000 high-resolution
More informationProtein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationThe Structure and Functions of Proteins
Wright State University CORE Scholar Computer Science and Engineering Faculty Publications Computer Science and Engineering 2003 The Structure and Functions of Proteins Dan E. Krane Wright State University
More informationMolecular Modelling. part of Bioinformatik von RNA- und Proteinstrukturen. Sonja Prohaska. Leipzig, SS Computational EvoDevo University Leipzig
part of Bioinformatik von RNA- und Proteinstrukturen Computational EvoDevo University Leipzig Leipzig, SS 2011 Protein Structure levels or organization Primary structure: sequence of amino acids (from
More informationApril, The energy functions include:
REDUX A collection of Python scripts for torsion angle Monte Carlo protein molecular simulations and analysis The program is based on unified residue peptide model and is designed for more efficient exploration
More informationBioengineering 215. An Introduction to Molecular Dynamics for Biomolecules
Bioengineering 215 An Introduction to Molecular Dynamics for Biomolecules David Parker May 18, 2007 ntroduction A principal tool to study biological molecules is molecular dynamics simulations (MD). MD
More information