Construc)ng the Tree of Life: Divide-and-Conquer! Tandy Warnow University of Illinois at Urbana-Champaign

Size: px
Start display at page:

Download "Construc)ng the Tree of Life: Divide-and-Conquer! Tandy Warnow University of Illinois at Urbana-Champaign"

Transcription

1 Construc)ng the Tree of Life: Divide-and-Conquer! Tandy Warnow University of Illinois at Urbana-Champaign

2 Phylogeny (evolutionary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website, University of Arizona

3 Phylogenies and Applications Basic Biology: How did life evolve? Applica)ons of phylogenies to: protein structure and func)on popula)on gene)cs human migra)ons metagenomics Figure from hhps://en.wikipedia.org/wiki/common_descent

4 phylogenomics Orangutan Chimpanzee gene 1 gene 2 gene 999 gene 1000 Gorilla Human ACTGCACACCG ACTGC-CCCCG AATGC-CCCCG -CTGCACACGG CTGAGCATCG CTGAGC-TCG ATGAGC-TC- CTGA-CAC-G AGCAGCATCGTG AGCAGC-TCGTG AGCAGC-TC-TG C-TA-CACGGTG CAGGCACGCACGAA AGC-CACGC-CATA ATGGCACGC-C-TA AGCTAC-CACGGAT gene here refers to a portion of the genome (not a functional gene) I ll use the term gene to refer to c-genes : recombination-free orthologous stretches of the genome 2

5 DNA Sequence Evolution AAGGCCT AAGACTT TGGACTT -3 mil yrs -2 mil yrs AGGGCAT TAGCCCT AGCACTT -1 mil yrs AGGGCAT TAGCCCA TAGACTT AGCACAA AGCGCTT today

6 Phylogenetic Tree Estimation U V W X Y AGGGCAT TAGCCCA TAGACTT TGCACAA TGCGCTT U X Y V W

7 However U V W X Y AGGGCATGA AGAT TAGACTT TGCACAA TGCGCTT U X Y V W

8 Indels (insertions and deletions) Deletion Mutation ACGGTGCAGTTACCA ACCAGTCACCA

9 Deletion Substitution ACGGTGCAGTTACCA Insertion ACCAGTCACCTA ACGGTGCAGTTACC-A AC----CAGTCACCTA The true mul*ple alignment Reflects historical substitution, insertion, and deletion events Defined using transitive closure of pairwise alignments computed on edges of the true tree

10 Phylogenetic Tree Estimation S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC S4 = TCACGACCGACA

11 Input: unaligned sequences S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC S4 = TCACGACCGACA

12 Phase 1: Alignment S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC S4 = TCACGACCGACA S1 = -AGGCTATCACCTGACCTCCA S2 = TAG-CTATCAC--GACCGC-- S3 = TAG-CT GACCGC-- S4 = TCAC--GACCGACA

13 Phase 2: Construct tree S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC S4 = TCACGACCGACA S1 = -AGGCTATCACCTGACCTCCA S2 = TAG-CTATCAC--GACCGC-- S3 = TAG-CT GACCGC-- S4 = TCAC--GACCGACA S1 S2 S4 S3

14 Two-phase es)ma)on Alignment methods Clustal POY (and POY*) Probcons (and Probtree) Probalign MAFFT Muscle Di-align T-Coffee Prank (PNAS 2005, Science 2008) Opal (ISMB and Bioinf. 2007) FSA (PLoS Comp. Bio. 2009) Infernal (Bioinf. 2009) Etc. Phylogeny methods Bayesian MCMC Maximum parsimony Maximum likelihood Neighbor joining FastME UPGMA Quartet puzzling Etc.

15 Two-phase es)ma)on Alignment methods Clustal POY (and POY*) Probcons (and Probtree) Probalign MAFFT Muscle Di-align T-Coffee Prank (PNAS 2005, Science 2008) Opal (ISMB and Bioinf. 2007) FSA (PLoS Comp. Bio. 2009) Infernal (Bioinf. 2009) Etc. Phylogeny methods Bayesian MCMC Maximum parsimony Maximum likelihood Neighbor joining FastME UPGMA Quartet puzzling Etc. RAxML: heuris>c for large-scale ML op>miza>on

16 Quan)fying Error FN FN: false negative (missing edge) FP: false positive (incorrect edge) 50% error rate FP

17 1000-taxon models, ordered by difficulty (Liu et al., Science 19 June 2009)

18 Multiple Sequence Alignment (MSA): a scientific grand challenge 1 S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC Sn = TCACGACCGACA S1 = -AGGCTATCACCTGACCTCCA S2 = TAG-CTATCAC--GACCGC-- S3 = TAG-CT GACCGC-- Sn = TCAC--GACCGACA Novel techniques needed for scalability and accuracy NP-hard problems and large datasets Current methods do not provide good accuracy Few methods can analyze even moderately large datasets Many important applications besides phylogenetic estimation 1 Frontiers in Massive Data Analysis, National Academies Press, 2013

19 1KP: Thousand Transcriptome Project G. Ka-Shu Wong U Alberta J. Leebens-Mack U Georgia N. Wickett Northwestern N. Matasci iplant T. Warnow, S. Mirarab, N. Nguyen UT-Austin UT-Austin UT-Austin l First publica)on: WickeH, Mirarab, et al., PNAS, 2014 l Used SATé (Liu et al., Science 2009 and Syst Biol 2012) to compute mul)ple sequence alignments and trees l Used ASTRAL (Mirarab et al., Bioinf 2014 and 2015) to compute the species tree Upcoming Challenge: Mul)ple sequence alignment and gene tree es)ma)on on 100,000 sequences

20 Computa*onal Phylogene*cs (2005) Current methods can use months to estimate trees on 1000 DNA sequences Our objective: More accurate trees and alignments on 500,000 sequences in under a week Courtesy of the Tree of Life web project, tolweb.org

21 Computa*onal Phylogene*cs (2015) : Distance-based phylogenetic tree estimation from polynomial length sequences 2012: Computing accurate trees (almost) without multiple sequence alignments : Co-estimation of multiple sequence alignments and gene trees, now on 1,000,000 sequences in under two weeks : Species tree estimation from whole genomes in the presence of massive gene tree heterogeneity Courtesy of the Tree of Life web project, tolweb.org

22 Computa*onal Phylogene*cs (2015) : Distance-based phylogenetic tree estimation from polynomial length sequences 2012: Computing accurate trees (almost) without multiple sequence alignments : Co-estimation of multiple sequence alignments and gene trees, now on 1,000,000 sequences in under two weeks : Species tree estimation from whole genomes in the presence of massive gene tree heterogeneity Courtesy of the Tree of Life web project, tolweb.org

23 Key technique: Divide-and-conquer! In general, small datasets with not too much heterogeneity are easy to analyze with good accuracy.

24 Divide-and-Conquer Divide-and-conquer is a basic algorithmic trick for solving problems! Three steps: divide a dataset into two or more sets, solve the problem on each set, and combine solu)ons.

25 Sor)ng Objec)ve: sort this list of integers from smallest to largest. 10, 3, 54, 23, 75, 5, 1, 25 should become 1, 3, 5, 10, 23, 25, 54, 75

26 MergeSort Step 1: Divide into two sublists Step 2: Recursively sort each sublist Step 3: Merge the two sorted sublists

27 Step 1: break into two lists X: Y:

28 Step 2: sort the two lists X: Y:

29 Step 3: merge the sorted lists X: Y: Result:

30 Merging (cont.) X: Y: Result: 1

31 Merging (cont.) X: Y: Result: 1 3

32 Merging (cont.) X: Y: Result: 1 3 5

33 Merging (cont.) X: Y: Result:

34 Merging (cont.) X: Y: Result:

35 Merging (cont.) X: Y: Result:

36 Merging (cont.) X: Y: 75 Result:

37 Merging (cont.) X: Y: Result:

38 Multiple Sequence Alignment (MSA): a scientific grand challenge 1 S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC Sn = TCACGACCGACA S1 = -AGGCTATCACCTGACCTCCA S2 = TAG-CTATCAC--GACCGC-- S3 = TAG-CT GACCGC-- Sn = TCAC--GACCGACA Novel techniques needed for scalability and accuracy NP-hard problems and large datasets Current methods do not provide good accuracy Few methods can analyze even moderately large datasets Many important applications besides phylogenetic estimation 1 Frontiers in Massive Data Analysis, National Academies Press, 2013

39 SATé and PASTA Input: set of unaligned sequences Output: mul)ple sequence alignment and phylogene)c tree SATé: Liu et al., Science 2009 (up to 10,000 sequences) and Systema)c Biology 2012 (up to 50,000 sequences) PASTA: Mirarab et al., J. Comp Biol 2015 (up to 1,000,000 sequences)

40 1000-taxon models, ordered by difficulty (Liu et al., Science 19 June 2009)

41 Re-aligning on a tree A B C D Decompose dataset A C B D Align subproblems A C B D Estimate ML tree on merged alignment ABCD Merge subalignments

42 SATé and PASTA Algorithms Obtain initial alignment and estimated ML tree Tree Use tree to compute new alignment

43 SATé and PASTA Algorithms Obtain initial alignment and estimated ML tree Tree Use tree to compute new alignment Alignment

44 SATé and PASTA Algorithms Obtain initial alignment and estimated ML tree Estimate ML tree on new alignment Tree Use tree to compute new alignment Alignment

45 SATé and PASTA Algorithms Obtain initial alignment and estimated ML tree Estimate ML tree on new alignment Tree Use tree to compute new alignment Alignment Repeat un)l termina)on condi)on, and return the alignment/tree pair with the best ML score

46 SATé: 24-hour co-es*ma*on of highly accurate alignments and trees on 1000 sequences 1000-taxon models, ordered by difficulty (Liu et al., Science 19 June 2009) 24-hour SATé analysis, on desktop machines (Similar improvements for biological datasets)

47 SATé-2: even more accurate! (Liu et al., Syst Biol 61(1):90-106, 2012)

48 PASTA: even more accurate, and can scale to 1,000,000 sequences RNASim 0.20 Tree Error (FN Rate) Clustal Omega Muscle Mafft Starting Tree SATe2 PASTA Reference Alignment Simulated RNASim datasets from 10K to 200K taxa Limited to 24 hours using 12 CPUs Not all methods could run (missing bars could not finish) PASTA, Mirarab et al., J Comp Biol 22(5): (2015)

49 Avian Phylogenomics Project E Jarvis, HHMI MTP Gilbert, Copenhagen G Zhang, BGI T. Warnow UT-Aus)n S. Mirarab Md. S. Bayzid, UT-Aus)n UT-Aus)n First analysis (Jarvis, Mirarab, et al., Science 2014): Plus many many other people Approx. 50 species, 14,000 loci Used SATé for gene sequence alignment and tree es)ma)on Next analysis will have more species, and will use PASTA

50 1KP: Thousand Transcriptome Project G. Ka-Shu Wong U Alberta J. Leebens-Mack U Georgia N. Wickett Northwestern N. Matasci iplant T. Warnow, S. Mirarab, N. Nguyen UT-Austin UT-Austin UT-Austin First analysis (WickeH, Mirarab, et al., PNAS, 2014) About 100 species and 800 loci Used SATé Next analysis will be much larger and more difficult: Mul)ple sequence alignment and gene tree es)ma)on on 100,000 sequences, many datasets highly fragmentary Will use PASTA and UPP (Nguyen et al., Genome Biology 2015)

51 Computa*onal Phylogene*cs (2015) : Distance-based phylogenetic tree estimation from polynomial length sequences 2012: Computing accurate trees (almost) without multiple sequence alignments : Co-estimation of multiple sequence alignments and gene trees, now on 1,000,000 sequences in under two weeks : Species tree estimation from whole genomes in the presence of massive gene tree heterogeneity Courtesy of the Tree of Life web project, tolweb.org

52 Boosters, or Meta-Methods Meta-methods use divide-and-conquer and iteration (or other techniques) to boost the performance of base methods (phylogeny reconstruction, alignment estimation, etc) Base method M Meta-method M*

53 Main Points Innova)ve algorithm design can improve accuracy as well as reduce running *me. Divide-and-conquer is a key algorithmic technique that has drama)cally changed the toolkit for biologists!

54 Acknowledgments Funding: Guggenheim Founda)on, Packard Founda)on, NSF, Microsos Research New England, David Bruton Jr. Centennial Professorship, Grainger Founda)on, and TACC (Texas Advanced Compu)ng Center)

55 Avian Phylogenomics Project E Jarvis, HHMI MTP Gilbert, Copenhagen G Zhang, BGI T. Warnow UT-Aus)n S. Mirarab Md. S. Bayzid, UT-Aus)n UT-Aus)n Jarvis, Mirarab, et al., Science 2014 Major challenge: Plus many many other people Massive gene tree heterogeneity consistent with incomplete lineage sor)ng Very poor resolu)on in the 14,000 gene trees Standard coalescent-based species tree es)ma)on methods had poor accuracy Solu*on: New technique to improve coalescent-based species tree (sta*s*cal binning, Mirarab et al., Science 2014)

CS 581 Algorithmic Computational Genomics. Tandy Warnow University of Illinois at Urbana-Champaign

CS 581 Algorithmic Computational Genomics. Tandy Warnow University of Illinois at Urbana-Champaign CS 581 Algorithmic Computational Genomics Tandy Warnow University of Illinois at Urbana-Champaign Today Explain the course Introduce some of the research in this area Describe some open problems Talk about

More information

CS 581 Algorithmic Computational Genomics. Tandy Warnow University of Illinois at Urbana-Champaign

CS 581 Algorithmic Computational Genomics. Tandy Warnow University of Illinois at Urbana-Champaign CS 581 Algorithmic Computational Genomics Tandy Warnow University of Illinois at Urbana-Champaign Course Staff Professor Tandy Warnow Office hours Tuesdays after class (2-3 PM) in Siebel 3235 Email address:

More information

Mul$ple Sequence Alignment Methods. Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu

Mul$ple Sequence Alignment Methods. Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu Mul$ple Sequence Alignment Methods Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu Species Tree Orangutan Gorilla Chimpanzee Human From the Tree of the Life

More information

SEPP and TIPP for metagenomic analysis. Tandy Warnow Department of Computer Science University of Texas

SEPP and TIPP for metagenomic analysis. Tandy Warnow Department of Computer Science University of Texas SEPP and TIPP for metagenomic analysis Tandy Warnow Department of Computer Science University of Texas Phylogeny (evolutionary tree) Orangutan From the Tree of the Life Website, University of Arizona Gorilla

More information

SEPP and TIPP for metagenomic analysis. Tandy Warnow Department of Computer Science University of Texas

SEPP and TIPP for metagenomic analysis. Tandy Warnow Department of Computer Science University of Texas SEPP and TIPP for metagenomic analysis Tandy Warnow Department of Computer Science University of Texas Metagenomics: Venter et al., Exploring the Sargasso Sea: Scientists Discover One Million New Genes

More information

Phylogenomics, Multiple Sequence Alignment, and Metagenomics. Tandy Warnow University of Illinois at Urbana-Champaign

Phylogenomics, Multiple Sequence Alignment, and Metagenomics. Tandy Warnow University of Illinois at Urbana-Champaign Phylogenomics, Multiple Sequence Alignment, and Metagenomics Tandy Warnow University of Illinois at Urbana-Champaign Phylogeny (evolutionary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the

More information

394C, October 2, Topics: Mul9ple Sequence Alignment Es9ma9ng Species Trees from Gene Trees

394C, October 2, Topics: Mul9ple Sequence Alignment Es9ma9ng Species Trees from Gene Trees 394C, October 2, 2013 Topics: Mul9ple Sequence Alignment Es9ma9ng Species Trees from Gene Trees Mul9ple Sequence Alignment Mul9ple Sequence Alignments and Evolu9onary Histories (the meaning of homologous

More information

CS 394C Algorithms for Computational Biology. Tandy Warnow Spring 2012

CS 394C Algorithms for Computational Biology. Tandy Warnow Spring 2012 CS 394C Algorithms for Computational Biology Tandy Warnow Spring 2012 Biology: 21st Century Science! When the human genome was sequenced seven years ago, scientists knew that most of the major scientific

More information

Ultra- large Mul,ple Sequence Alignment

Ultra- large Mul,ple Sequence Alignment Ultra- large Mul,ple Sequence Alignment Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana- Champaign hep://tandy.cs.illinois.edu Phylogeny (evolu,onary tree) Orangutan

More information

Using Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics

Using Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics Using Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana-Champaign http://tandy.cs.illinois.edu

More information

From Genes to Genomes and Beyond: a Computational Approach to Evolutionary Analysis. Kevin J. Liu, Ph.D. Rice University Dept. of Computer Science

From Genes to Genomes and Beyond: a Computational Approach to Evolutionary Analysis. Kevin J. Liu, Ph.D. Rice University Dept. of Computer Science From Genes to Genomes and Beyond: a Computational Approach to Evolutionary Analysis Kevin J. Liu, Ph.D. Rice University Dept. of Computer Science!1 Adapted from U.S. Department of Energy Genomic Science

More information

From Gene Trees to Species Trees. Tandy Warnow The University of Texas at Aus<n

From Gene Trees to Species Trees. Tandy Warnow The University of Texas at Aus<n From Gene Trees to Species Trees Tandy Warnow The University of Texas at Aus

More information

Constrained Exact Op1miza1on in Phylogene1cs. Tandy Warnow The University of Illinois at Urbana-Champaign

Constrained Exact Op1miza1on in Phylogene1cs. Tandy Warnow The University of Illinois at Urbana-Champaign Constrained Exact Op1miza1on in Phylogene1cs Tandy Warnow The University of Illinois at Urbana-Champaign Phylogeny (evolu1onary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website,

More information

Fast coalescent-based branch support using local quartet frequencies

Fast coalescent-based branch support using local quartet frequencies Fast coalescent-based branch support using local quartet frequencies Molecular Biology and Evolution (2016) 33 (7): 1654 68 Erfan Sayyari, Siavash Mirarab University of California, San Diego (ECE) anzee

More information

ASTRAL: Fast coalescent-based computation of the species tree topology, branch lengths, and local branch support

ASTRAL: Fast coalescent-based computation of the species tree topology, branch lengths, and local branch support ASTRAL: Fast coalescent-based computation of the species tree topology, branch lengths, and local branch support Siavash Mirarab University of California, San Diego Joint work with Tandy Warnow Erfan Sayyari

More information

Upcoming challenges in phylogenomics. Siavash Mirarab University of California, San Diego

Upcoming challenges in phylogenomics. Siavash Mirarab University of California, San Diego Upcoming challenges in phylogenomics Siavash Mirarab University of California, San Diego Gene tree discordance The species tree gene1000 Causes of gene tree discordance include: Incomplete Lineage Sorting

More information

The Mathema)cs of Es)ma)ng the Tree of Life. Tandy Warnow The University of Illinois

The Mathema)cs of Es)ma)ng the Tree of Life. Tandy Warnow The University of Illinois The Mathema)cs of Es)ma)ng the Tree of Life Tandy Warnow The University of Illinois Phylogeny (evolu9onary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website, University of Arizona

More information

Reconstruction of species trees from gene trees using ASTRAL. Siavash Mirarab University of California, San Diego (ECE)

Reconstruction of species trees from gene trees using ASTRAL. Siavash Mirarab University of California, San Diego (ECE) Reconstruction of species trees from gene trees using ASTRAL Siavash Mirarab University of California, San Diego (ECE) Phylogenomics Orangutan Chimpanzee gene 1 gene 2 gene 999 gene 1000 Gorilla Human

More information

Computa(onal Challenges in Construc(ng the Tree of Life

Computa(onal Challenges in Construc(ng the Tree of Life Computa(onal Challenges in Construc(ng the Tree of Life Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana-Champaign h?p://tandy.cs.illinois.edu Phylogeny (evolueonary tree)

More information

NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees

NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees Erin Molloy and Tandy Warnow {emolloy2, warnow}@illinois.edu University of Illinois at Urbana

More information

New methods for es-ma-ng species trees from genome-scale data. Tandy Warnow The University of Illinois

New methods for es-ma-ng species trees from genome-scale data. Tandy Warnow The University of Illinois New methods for es-ma-ng species trees from genome-scale data Tandy Warnow The University of Illinois Phylogeny (evolu9onary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website,

More information

Genome-scale Es-ma-on of the Tree of Life. Tandy Warnow The University of Illinois

Genome-scale Es-ma-on of the Tree of Life. Tandy Warnow The University of Illinois Genome-scale Es-ma-on of the Tree of Life Tandy Warnow The University of Illinois Phylogeny (evolu9onary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website, University of Arizona

More information

InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9

InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9 Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic

More information

Genome-scale Es-ma-on of the Tree of Life. Tandy Warnow The University of Illinois

Genome-scale Es-ma-on of the Tree of Life. Tandy Warnow The University of Illinois WABI 2017 Factsheet 55 proceedings paper submissions, 27 accepted (49% acceptance rate) 9 additional poster-only submissions (+8 posters accompanying papers) 56 PC members Each paper reviewed by at least

More information

Phylogenetic Geometry

Phylogenetic Geometry Phylogenetic Geometry Ruth Davidson University of Illinois Urbana-Champaign Department of Mathematics Mathematics and Statistics Seminar Washington State University-Vancouver September 26, 2016 Phylogenies

More information

first (i.e., weaker) sense of the term, using a variety of algorithmic approaches. For example, some methods (e.g., *BEAST 20) co-estimate gene trees

first (i.e., weaker) sense of the term, using a variety of algorithmic approaches. For example, some methods (e.g., *BEAST 20) co-estimate gene trees Concatenation Analyses in the Presence of Incomplete Lineage Sorting May 22, 2015 Tree of Life Tandy Warnow Warnow T. Concatenation Analyses in the Presence of Incomplete Lineage Sorting.. 2015 May 22.

More information

CS 394C March 21, Tandy Warnow Department of Computer Sciences University of Texas at Austin

CS 394C March 21, Tandy Warnow Department of Computer Sciences University of Texas at Austin CS 394C March 21, 2012 Tandy Warnow Department of Computer Sciences University of Texas at Austin Phylogeny From the Tree of the Life Website, University of Arizona Orangutan Gorilla Chimpanzee Human Phylogeny

More information

Phylogenetic Tree Reconstruction

Phylogenetic Tree Reconstruction I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven

More information

Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center

Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods

More information

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between

More information

Estimating Evolutionary Trees. Phylogenetic Methods

Estimating Evolutionary Trees. Phylogenetic Methods Estimating Evolutionary Trees v if the data are consistent with infinite sites then all methods should yield the same tree v it gets more complicated when there is homoplasy, i.e., parallel or convergent

More information

Anatomy of a species tree

Anatomy of a species tree Anatomy of a species tree T 1 Size of current and ancestral Populations (N) N Confidence in branches of species tree t/2n = 1 coalescent unit T 2 Branch lengths and divergence times of species & populations

More information

Recent Advances in Phylogeny Reconstruction

Recent Advances in Phylogeny Reconstruction Recent Advances in Phylogeny Reconstruction from Gene-Order Data Bernard M.E. Moret Department of Computer Science University of New Mexico Albuquerque, NM 87131 Department Colloqium p.1/41 Collaborators

More information

Parameter Es*ma*on: Cracking Incomplete Data

Parameter Es*ma*on: Cracking Incomplete Data Parameter Es*ma*on: Cracking Incomplete Data Khaled S. Refaat Collaborators: Arthur Choi and Adnan Darwiche Agenda Learning Graphical Models Complete vs. Incomplete Data Exploi*ng Data for Decomposi*on

More information

TheDisk-Covering MethodforTree Reconstruction

TheDisk-Covering MethodforTree Reconstruction TheDisk-Covering MethodforTree Reconstruction Daniel Huson PACM, Princeton University Bonn, 1998 1 Copyright (c) 2008 Daniel Huson. Permission is granted to copy, distribute and/or modify this document

More information

Bioinformatics tools for phylogeny and visualization. Yanbin Yin

Bioinformatics tools for phylogeny and visualization. Yanbin Yin Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and

More information

CSCI1950 Z Computa4onal Methods for Biology Lecture 4. Ben Raphael February 2, hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary

CSCI1950 Z Computa4onal Methods for Biology Lecture 4. Ben Raphael February 2, hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary CSCI1950 Z Computa4onal Methods for Biology Lecture 4 Ben Raphael February 2, 2009 hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary Parsimony Probabilis4c Method Input Output Sankoff s & Fitch

More information

Woods Hole brief primer on Multiple Sequence Alignment presented by Mark Holder

Woods Hole brief primer on Multiple Sequence Alignment presented by Mark Holder Woods Hole 2014 - brief primer on Multiple Sequence Alignment presented by Mark Holder Many forms of sequence alignment are used in bioinformatics: Structural Alignment Local alignments Global, evolutionary

More information

Phylogenetic inference

Phylogenetic inference Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types

More information

Computational Challenges in Constructing the Tree of Life

Computational Challenges in Constructing the Tree of Life Computational Challenges in Constructing the Tree of Life Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana-Champaign http://tandy.cs.illinois.edu Warnow Lab (PhD students)

More information

BIOINFORMATICS. Scaling Up Accurate Phylogenetic Reconstruction from Gene-Order Data. Jijun Tang 1 and Bernard M.E. Moret 1

BIOINFORMATICS. Scaling Up Accurate Phylogenetic Reconstruction from Gene-Order Data. Jijun Tang 1 and Bernard M.E. Moret 1 BIOINFORMATICS Vol. 1 no. 1 2003 Pages 1 8 Scaling Up Accurate Phylogenetic Reconstruction from Gene-Order Data Jijun Tang 1 and Bernard M.E. Moret 1 1 Department of Computer Science, University of New

More information

EVOLUTIONARY DISTANCES

EVOLUTIONARY DISTANCES EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:

More information

CSCI1950 Z Computa4onal Methods for Biology Lecture 5

CSCI1950 Z Computa4onal Methods for Biology Lecture 5 CSCI1950 Z Computa4onal Methods for Biology Lecture 5 Ben Raphael February 6, 2009 hip://cs.brown.edu/courses/csci1950 z/ Alignment vs. Distance Matrix Mouse: ACAGTGACGCCACACACGT Gorilla: CCTGCGACGTAACAAACGC

More information

CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES

CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:

More information

Taming the Beast Workshop

Taming the Beast Workshop Workshop and Chi Zhang June 28, 2016 1 / 19 Species tree Species tree the phylogeny representing the relationships among a group of species Figure adapted from [Rogers and Gibbs, 2014] Gene tree the phylogeny

More information

Gene Regulatory Networks II Computa.onal Genomics Seyoung Kim

Gene Regulatory Networks II Computa.onal Genomics Seyoung Kim Gene Regulatory Networks II 02-710 Computa.onal Genomics Seyoung Kim Goal: Discover Structure and Func;on of Complex systems in the Cell Identify the different regulators and their target genes that are

More information

Evolutionary trees. Describe the relationship between objects, e.g. species or genes

Evolutionary trees. Describe the relationship between objects, e.g. species or genes Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between

More information

Phylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki

Phylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki Phylogene)cs IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, 2016 Joyce Nzioki Phylogenetics The study of evolutionary relatedness of organisms. Derived from two Greek words:» Phle/Phylon: Tribe/Race» Genetikos:

More information

Quantifying sequence similarity

Quantifying sequence similarity Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity

More information

7. Tests for selection

7. Tests for selection Sequence analysis and genomics 7. Tests for selection Dr. Katja Nowick Group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute for Brain Research www. nowicklab.info

More information

9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)

9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree) I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by

More information

CSCI1950 Z Computa3onal Methods for Biology Lecture 24. Ben Raphael April 29, hgp://cs.brown.edu/courses/csci1950 z/ Network Mo3fs

CSCI1950 Z Computa3onal Methods for Biology Lecture 24. Ben Raphael April 29, hgp://cs.brown.edu/courses/csci1950 z/ Network Mo3fs CSCI1950 Z Computa3onal Methods for Biology Lecture 24 Ben Raphael April 29, 2009 hgp://cs.brown.edu/courses/csci1950 z/ Network Mo3fs Subnetworks with more occurrences than expected by chance. How to

More information

Phylogeny: building the tree of life

Phylogeny: building the tree of life Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan

More information

Phylogenetics. BIOL 7711 Computational Bioscience

Phylogenetics. BIOL 7711 Computational Bioscience Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium

More information

Using phylogenetics to estimate species divergence times... Basics and basic issues for Bayesian inference of divergence times (plus some digression)

Using phylogenetics to estimate species divergence times... Basics and basic issues for Bayesian inference of divergence times (plus some digression) Using phylogenetics to estimate species divergence times... More accurately... Basics and basic issues for Bayesian inference of divergence times (plus some digression) "A comparison of the structures

More information

Multiple Sequence Alignment. Sequences

Multiple Sequence Alignment. Sequences Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe

More information

Evolu&on, Popula&on Gene&cs, and Natural Selec&on Computa.onal Genomics Seyoung Kim

Evolu&on, Popula&on Gene&cs, and Natural Selec&on Computa.onal Genomics Seyoung Kim Evolu&on, Popula&on Gene&cs, and Natural Selec&on 02-710 Computa.onal Genomics Seyoung Kim Phylogeny of Mammals Phylogene&cs vs. Popula&on Gene&cs Phylogene.cs Assumes a single correct species phylogeny

More information

2018 Phylogenomics Software Symposium Institut des Sciences de l Evolution - Montpellier August 17, 2018 Abstracts

2018 Phylogenomics Software Symposium Institut des Sciences de l Evolution - Montpellier August 17, 2018 Abstracts 2018 Phylogenomics Software Symposium Institut des Sciences de l Evolution - Montpellier August 17, 2018 Abstracts Dominic J. Bennett Title: supersmartr: Towards a modular pipeline for phylogenetic tree

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods

More information

5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT

5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT 5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT.03.239 03.10.2012 ALIGNMENT Alignment is the task of locating equivalent regions of two or more sequences to maximize their similarity. Homology:

More information

Mathematics of Evolution and Phylogeny. Edited by Olivier Gascuel

Mathematics of Evolution and Phylogeny. Edited by Olivier Gascuel Mathematics of Evolution and Phylogeny Edited by Olivier Gascuel CLARENDON PRESS. OXFORD 2004 iv CONTENTS 12 Reconstructing Phylogenies from Gene-Content and Gene-Order Data 1 12.1 Introduction: Phylogenies

More information

A Phylogenetic Network Construction due to Constrained Recombination

A Phylogenetic Network Construction due to Constrained Recombination A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer

More information

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological

More information

Plan: Evolutionary trees, characters. Perfect phylogeny Methods: NJ, parsimony, max likelihood, Quartet method

Plan: Evolutionary trees, characters. Perfect phylogeny Methods: NJ, parsimony, max likelihood, Quartet method Phylogeny 1 Plan: Phylogeny is an important subject. We have 2.5 hours. So I will teach all the concepts via one example of a chain letter evolution. The concepts we will discuss include: Evolutionary

More information

On the variance of internode distance under the multispecies coalescent

On the variance of internode distance under the multispecies coalescent On the variance of internode distance under the multispecies coalescent Sébastien Roch 1[0000 000 7608 8550 Department of Mathematics University of Wisconsin Madison Madison, WI 53706 roch@math.wisc.edu

More information

Dr. Amira A. AL-Hosary

Dr. Amira A. AL-Hosary Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

More information

The impact of missing data on species tree estimation

The impact of missing data on species tree estimation MBE Advance Access published November 2, 215 The impact of missing data on species tree estimation Zhenxiang Xi, 1 Liang Liu, 2,3 and Charles C. Davis*,1 1 Department of Organismic and Evolutionary Biology,

More information

The statistical and informatics challenges posed by ascertainment biases in phylogenetic data collection

The statistical and informatics challenges posed by ascertainment biases in phylogenetic data collection The statistical and informatics challenges posed by ascertainment biases in phylogenetic data collection Mark T. Holder and Jordan M. Koch Department of Ecology and Evolutionary Biology, University of

More information

How to read and make phylogenetic trees Zuzana Starostová

How to read and make phylogenetic trees Zuzana Starostová How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation

More information

Phylogenetics: Building Phylogenetic Trees

Phylogenetics: Building Phylogenetic Trees 1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should

More information

Inferring Phylogenetic Trees. Distance Approaches. Representing distances. in rooted and unrooted trees. The distance approach to phylogenies

Inferring Phylogenetic Trees. Distance Approaches. Representing distances. in rooted and unrooted trees. The distance approach to phylogenies Inferring Phylogenetic Trees Distance Approaches Representing distances in rooted and unrooted trees The distance approach to phylogenies given: an n n matrix M where M ij is the distance between taxa

More information

A (short) introduction to phylogenetics

A (short) introduction to phylogenetics A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field

More information

MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE

MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE Manmeet Kaur 1, Navneet Kaur Bawa 2 1 M-tech research scholar (CSE Dept) ACET, Manawala,Asr 2 Associate Professor (CSE Dept) ACET, Manawala,Asr

More information

Hidden Markov models in population genetics and evolutionary biology

Hidden Markov models in population genetics and evolutionary biology Hidden Markov models in population genetics and evolutionary biology Gerton Lunter Wellcome Trust Centre for Human Genetics Oxford, UK April 29, 2013 Topics for today Markov chains Hidden Markov models

More information

CSCI1950 Z Computa3onal Methods for Biology* (*Working Title) Lecture 1. Ben Raphael January 21, Course Par3culars

CSCI1950 Z Computa3onal Methods for Biology* (*Working Title) Lecture 1. Ben Raphael January 21, Course Par3culars CSCI1950 Z Computa3onal Methods for Biology* (*Working Title) Lecture 1 Ben Raphael January 21, 2009 Course Par3culars Three major topics 1. Phylogeny: ~50% lectures 2. Func3onal Genomics: ~25% lectures

More information

POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics

POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the

More information

Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University

Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 03: Edit distance and sequence alignment Slides adapted from Dr. Shaojie Zhang (University of Central Florida) KUMC visit How many of you would like to attend

More information

Computational methods for predicting protein-protein interactions

Computational methods for predicting protein-protein interactions Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational

More information

Isolating - A New Resampling Method for Gene Order Data

Isolating - A New Resampling Method for Gene Order Data Isolating - A New Resampling Method for Gene Order Data Jian Shi, William Arndt, Fei Hu and Jijun Tang Abstract The purpose of using resampling methods on phylogenetic data is to estimate the confidence

More information

Moreover, the circular logic

Moreover, the circular logic Moreover, the circular logic How do we know what is the right distance without a good alignment? And how do we construct a good alignment without knowing what substitutions were made previously? ATGCGT--GCAAGT

More information

BINF6201/8201. Molecular phylogenetic methods

BINF6201/8201. Molecular phylogenetic methods BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics

More information

What is Phylogenetics

What is Phylogenetics What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)

More information

Phylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches

Phylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell

More information

STEM-hy: Species Tree Estimation using Maximum likelihood (with hybridization)

STEM-hy: Species Tree Estimation using Maximum likelihood (with hybridization) STEM-hy: Species Tree Estimation using Maximum likelihood (with hybridization) Laura Salter Kubatko Departments of Statistics and Evolution, Ecology, and Organismal Biology The Ohio State University kubatko.2@osu.edu

More information

Phylogenetic analyses. Kirsi Kostamo

Phylogenetic analyses. Kirsi Kostamo Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,

More information

Using Phylogenomics to Predict Novel Fungal Pathogenicity Genes

Using Phylogenomics to Predict Novel Fungal Pathogenicity Genes Using Phylogenomics to Predict Novel Fungal Pathogenicity Genes David DeCaprio, Ying Li, Hung Nguyen (sequenced Ascomycetes genomes courtesy of the Broad Institute) Phylogenomics Combining whole genome

More information

Organisatorische Details

Organisatorische Details Organisatorische Details Vorlesung: Di 13-14, Do 10-12 in DI 205 Übungen: Do 16:15-18:00 Laborraum Schanzenstrasse Vorwiegend Programmieren in Matlab/Octave Teilnahme freiwillig. Übungsblätter jeweils

More information

Tools and Algorithms in Bioinformatics

Tools and Algorithms in Bioinformatics Tools and Algorithms in Bioinformatics GCBA815, Fall 2015 Week-4 BLAST Algorithm Continued Multiple Sequence Alignment Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and

More information

Comparison of Cost Functions in Sequence Alignment. Ryan Healey

Comparison of Cost Functions in Sequence Alignment. Ryan Healey Comparison of Cost Functions in Sequence Alignment Ryan Healey Use of Cost Functions Used to score and align sequences Mathematically model how sequences mutate and evolve. Evolution and mutation can be

More information

Phylogenetic hypotheses and the utility of multiple sequence alignment

Phylogenetic hypotheses and the utility of multiple sequence alignment Phylogenetic hypotheses and the utility of multiple sequence alignment Ward C. Wheeler 1 and Gonzalo Giribet 2 1 Division of Invertebrate Zoology, American Museum of Natural History Central Park West at

More information

Effects of Gap Open and Gap Extension Penalties

Effects of Gap Open and Gap Extension Penalties Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See

More information

Using algebraic geometry for phylogenetic reconstruction

Using algebraic geometry for phylogenetic reconstruction Using algebraic geometry for phylogenetic reconstruction Marta Casanellas i Rius (joint work with Jesús Fernández-Sánchez) Departament de Matemàtica Aplicada I Universitat Politècnica de Catalunya IMA

More information

Workshop III: Evolutionary Genomics

Workshop III: Evolutionary Genomics Identifying Species Trees from Gene Trees Elizabeth S. Allman University of Alaska IPAM Los Angeles, CA November 17, 2011 Workshop III: Evolutionary Genomics Collaborators The work in today s talk is joint

More information

Additive distances. w(e), where P ij is the path in T from i to j. Then the matrix [D ij ] is said to be additive.

Additive distances. w(e), where P ij is the path in T from i to j. Then the matrix [D ij ] is said to be additive. Additive distances Let T be a tree on leaf set S and let w : E R + be an edge-weighting of T, and assume T has no nodes of degree two. Let D ij = e P ij w(e), where P ij is the path in T from i to j. Then

More information

Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline

Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying

More information

Today's project. Test input data Six alignments (from six independent markers) of Curcuma species

Today's project. Test input data Six alignments (from six independent markers) of Curcuma species DNA sequences II Analyses of multiple sequence data datasets, incongruence tests, gene trees vs. species tree reconstruction, networks, detection of hybrid species DNA sequences II Test of congruence of

More information

Smith et al. American Journal of Botany 98(3): Data Supplement S2 page 1

Smith et al. American Journal of Botany 98(3): Data Supplement S2 page 1 Smith et al. American Journal of Botany 98(3):404-414. 2011. Data Supplement S1 page 1 Smith, Stephen A., Jeremy M. Beaulieu, Alexandros Stamatakis, and Michael J. Donoghue. 2011. Understanding angiosperm

More information

CONTENTS. P A R T I Genomes 1. P A R T II Gene Transcription and Regulation 109

CONTENTS. P A R T I Genomes 1. P A R T II Gene Transcription and Regulation 109 CONTENTS ix Preface xv Acknowledgments xxi Editors and contributors xxiv A computational micro primer xxvi P A R T I Genomes 1 1 Identifying the genetic basis of disease 3 Vineet Bafna 2 Pattern identification

More information