Phylogenomics, Multiple Sequence Alignment, and Metagenomics. Tandy Warnow University of Illinois at Urbana-Champaign
|
|
- Clara Hicks
- 5 years ago
- Views:
Transcription
1 Phylogenomics, Multiple Sequence Alignment, and Metagenomics Tandy Warnow University of Illinois at Urbana-Champaign
2 Phylogeny (evolutionary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website, University of Arizona
3 Phylogeny + genomics = genome-scale phylogeny estimation.
4 Multiple Sequence Alignment (MSA): a scientific grand challenge 1 S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC Sn = TCACGACCGACA S1 = -AGGCTATCACCTGACCTCCA S2 = TAG-CTATCAC--GACCGC-- S3 = TAG-CT GACCGC-- Sn = TCAC--GACCGACA Novel techniques needed for scalability and accuracy NP-hard problems and large datasets Current methods do not provide good accuracy Few methods can analyze even moderately large datasets Many important applications besides phylogenetic estimation 1 Frontiers in Massive Data Analysis, National Academies Press, 2013
5 Estimating the Tree of Life Figure from Basic Biology: How did life evolve? Applications of phylogenies and multiple sequence alignments to: protein structure and function population genetics human migrations metagenomics
6 Muir, 2016
7 Estimating the Tree of Life Large datasets! Millions of species thousands of genes NP-hard optimization problems Exact solutions infeasible Approximation algorithms Heuristics Multiple optima Figure from High Performance Computing: necessary but not sufficient
8 Computational Phylogenetics (2005) Current methods can use months to estimate trees on 1000 DNA sequences Our objective: More accurate trees and alignments on 500,000 sequences in under a week Courtesy of the Tree of Life web project, tolweb.org
9 Computational Phylogenetics (2018) : Distance-based phylogenetic tree estimation from polynomial length sequences 2012: Computing accurate trees (almost) without multiple sequence alignments : Co-estimation of multiple sequence alignments and gene trees, now on 1,000,000 sequences in under two weeks : Species tree estimation from whole genomes in the presence of massive gene tree heterogeneity Courtesy of the Tree of Life web project, tolweb.org : Scaling methods to very large heterogeneous datasets using novel machine learning and supertree methods.
10 Metagenomic taxonomic identification and phylogenetic profiling Metagenomics, Venter et al., Exploring the Sargasso Sea: Scientists Discover One Million New Genes in Ocean Microbes
11 Basic Questions 1. What is this fragment? (Classify each fragment as well as possible.) 2. What is the taxonomic distribution in the dataset? (Note: helpful to use marker genes.) 3. What are the organisms in this metagenomic sample doing together?
12 Some of Our Methods and Software SEPP (phylogenetic placement), S. Mirarab et al. "SEPP: SATé-Enabled Phylogenetic Placement." Proceedings of the 2012 Pacific Symposium on Biocomputing (PSB 2012) 17: TIPP (Taxonomic abundance profiling of metagenomic data), N. Nguyen et al. "TIPP:Taxonomic Identification and Phylogenetic Profiling." Bioinformatics (2014) 30(24): UPP (Ultra-large alignments), N. Nguyen et al. "Ultra-large alignments using phylogeny aware profiles". Proceedings RECOMB 2015 and Genome Biology (2015) 16:124 HIPPI (protein family classification), N. Nguyen et al., HIPPI: Highly accurate protein family classification with ensembles of HMMs. BMC Genomics (2016): 17 (Suppl 10):765 PASTA (co-estimation of alignments and trees), S. Mirarab et al., J. Comput. Biol. (2014), 22(5): ASTRAL (species tree estimation from multi-locus data), S. Mirarab et al., Bioinformatics (2014), 30(17): i541-i548. ASTRID (species tree estimation from multi-locus data). P. Vachaspati and T. Warnow. BMC Genomics (2015), 16:S3. All software available in open-source form on github. See for more information
CS 581 Algorithmic Computational Genomics. Tandy Warnow University of Illinois at Urbana-Champaign
CS 581 Algorithmic Computational Genomics Tandy Warnow University of Illinois at Urbana-Champaign Today Explain the course Introduce some of the research in this area Describe some open problems Talk about
More informationCS 581 Algorithmic Computational Genomics. Tandy Warnow University of Illinois at Urbana-Champaign
CS 581 Algorithmic Computational Genomics Tandy Warnow University of Illinois at Urbana-Champaign Course Staff Professor Tandy Warnow Office hours Tuesdays after class (2-3 PM) in Siebel 3235 Email address:
More informationMul$ple Sequence Alignment Methods. Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu
Mul$ple Sequence Alignment Methods Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu Species Tree Orangutan Gorilla Chimpanzee Human From the Tree of the Life
More informationUsing Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics
Using Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana-Champaign http://tandy.cs.illinois.edu
More informationCS 394C Algorithms for Computational Biology. Tandy Warnow Spring 2012
CS 394C Algorithms for Computational Biology Tandy Warnow Spring 2012 Biology: 21st Century Science! When the human genome was sequenced seven years ago, scientists knew that most of the major scientific
More informationSEPP and TIPP for metagenomic analysis. Tandy Warnow Department of Computer Science University of Texas
SEPP and TIPP for metagenomic analysis Tandy Warnow Department of Computer Science University of Texas Phylogeny (evolutionary tree) Orangutan From the Tree of the Life Website, University of Arizona Gorilla
More informationSEPP and TIPP for metagenomic analysis. Tandy Warnow Department of Computer Science University of Texas
SEPP and TIPP for metagenomic analysis Tandy Warnow Department of Computer Science University of Texas Metagenomics: Venter et al., Exploring the Sargasso Sea: Scientists Discover One Million New Genes
More informationConstruc)ng the Tree of Life: Divide-and-Conquer! Tandy Warnow University of Illinois at Urbana-Champaign
Construc)ng the Tree of Life: Divide-and-Conquer! Tandy Warnow University of Illinois at Urbana-Champaign Phylogeny (evolutionary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website,
More informationNJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees Erin Molloy and Tandy Warnow {emolloy2, warnow}@illinois.edu University of Illinois at Urbana
More informationUltra- large Mul,ple Sequence Alignment
Ultra- large Mul,ple Sequence Alignment Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana- Champaign hep://tandy.cs.illinois.edu Phylogeny (evolu,onary tree) Orangutan
More informationCS 581 / BIOE 540: Algorithmic Computa<onal Genomics. Tandy Warnow Departments of Bioengineering and Computer Science hhp://tandy.cs.illinois.
CS 581 / BIOE 540: Algorithmic Computa
More informationCREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
More informationFrom Genes to Genomes and Beyond: a Computational Approach to Evolutionary Analysis. Kevin J. Liu, Ph.D. Rice University Dept. of Computer Science
From Genes to Genomes and Beyond: a Computational Approach to Evolutionary Analysis Kevin J. Liu, Ph.D. Rice University Dept. of Computer Science!1 Adapted from U.S. Department of Energy Genomic Science
More informationUpcoming challenges in phylogenomics. Siavash Mirarab University of California, San Diego
Upcoming challenges in phylogenomics Siavash Mirarab University of California, San Diego Gene tree discordance The species tree gene1000 Causes of gene tree discordance include: Incomplete Lineage Sorting
More information394C, October 2, Topics: Mul9ple Sequence Alignment Es9ma9ng Species Trees from Gene Trees
394C, October 2, 2013 Topics: Mul9ple Sequence Alignment Es9ma9ng Species Trees from Gene Trees Mul9ple Sequence Alignment Mul9ple Sequence Alignments and Evolu9onary Histories (the meaning of homologous
More informationUSING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES
USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES HOW CAN BIOINFORMATICS BE USED AS A TOOL TO DETERMINE EVOLUTIONARY RELATIONSHPS AND TO BETTER UNDERSTAND PROTEIN HERITAGE?
More informationGrundlagen der Bioinformatik Summer semester Lecturer: Prof. Daniel Huson
Grundlagen der Bioinformatik, SS 10, D. Huson, April 12, 2010 1 1 Introduction Grundlagen der Bioinformatik Summer semester 2010 Lecturer: Prof. Daniel Huson Office hours: Thursdays 17-18h (Sand 14, C310a)
More informationInvestigation 3: Comparing DNA Sequences to Understand Evolutionary Relationships with BLAST
Investigation 3: Comparing DNA Sequences to Understand Evolutionary Relationships with BLAST Introduction Bioinformatics is a powerful tool which can be used to determine evolutionary relationships and
More informationCladistics and Bioinformatics Questions 2013
AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species
More informationOrganizing Life s Diversity
17 Organizing Life s Diversity section 2 Modern Classification Classification systems have changed over time as information has increased. What You ll Learn species concepts methods to reveal phylogeny
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationA Phylogenetic Network Construction due to Constrained Recombination
A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer
More informationFrom Gene Trees to Species Trees. Tandy Warnow The University of Texas at Aus<n
From Gene Trees to Species Trees Tandy Warnow The University of Texas at Aus
More informationEvolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between
More informationChapter 18 Active Reading Guide Genomes and Their Evolution
Name: AP Biology Mr. Croft Chapter 18 Active Reading Guide Genomes and Their Evolution Most AP Biology teachers think this chapter involves an advanced topic. The questions posed here will help you understand
More informationASTRAL: Fast coalescent-based computation of the species tree topology, branch lengths, and local branch support
ASTRAL: Fast coalescent-based computation of the species tree topology, branch lengths, and local branch support Siavash Mirarab University of California, San Diego Joint work with Tandy Warnow Erfan Sayyari
More informationMicrobial analysis with STAMP
Microbial analysis with STAMP Conor Meehan cmeehan@itg.be A quick aside on who I am Tangents already! Who I am A postdoc at the Institute of Tropical Medicine in Antwerp, Belgium Mycobacteria evolution
More informationChapter 19 Organizing Information About Species: Taxonomy and Cladistics
Chapter 19 Organizing Information About Species: Taxonomy and Cladistics An unexpected family tree. What are the evolutionary relationships among a human, a mushroom, and a tulip? Molecular systematics
More informationSUPPLEMENTARY INFORMATION
Supplementary information S1 (box). Supplementary Methods description. Prokaryotic Genome Database Archaeal and bacterial genome sequences were downloaded from the NCBI FTP site (ftp://ftp.ncbi.nlm.nih.gov/genomes/all/)
More informationSCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of
More informationTitle ghost-tree: creating hybrid-gene phylogenetic trees for diversity analyses
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 Title ghost-tree: creating hybrid-gene phylogenetic trees for diversity analyses
More informationfirst (i.e., weaker) sense of the term, using a variety of algorithmic approaches. For example, some methods (e.g., *BEAST 20) co-estimate gene trees
Concatenation Analyses in the Presence of Incomplete Lineage Sorting May 22, 2015 Tree of Life Tandy Warnow Warnow T. Concatenation Analyses in the Presence of Incomplete Lineage Sorting.. 2015 May 22.
More informationCONTENTS. P A R T I Genomes 1. P A R T II Gene Transcription and Regulation 109
CONTENTS ix Preface xv Acknowledgments xxi Editors and contributors xxiv A computational micro primer xxvi P A R T I Genomes 1 1 Identifying the genetic basis of disease 3 Vineet Bafna 2 Pattern identification
More informationhttps://xkcd.com/1691/
https://xkcdcom/1691/ Mash: fast genome and metagenome distance estimation Don L Armstrong Institute for Genomic Biology, Computing Genomes for Reproductive Health, University of Illinois, Urbana-Champaign
More informationGenomes and Their Evolution
Chapter 21 Genomes and Their Evolution PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
More informationTaxonomy. Content. How to determine & classify a species. Phylogeny and evolution
Taxonomy Content Why Taxonomy? How to determine & classify a species Domains versus Kingdoms Phylogeny and evolution Why Taxonomy? Classification Arrangement in groups or taxa (taxon = group) Nomenclature
More informationDNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi
DNA Phylogeny Signals and Systems in Biology Kushal Shah @ EE, IIT Delhi Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics :
More informationPhylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein
More informationPhylogenetic Geometry
Phylogenetic Geometry Ruth Davidson University of Illinois Urbana-Champaign Department of Mathematics Mathematics and Statistics Seminar Washington State University-Vancouver September 26, 2016 Phylogenies
More information10 Biodiversity Support. AQA Biology. Biodiversity. Specification reference. Learning objectives. Introduction. Background
Biodiversity Specification reference 3.4.5 3.4.6 3.4.7 Learning objectives After completing this worksheet you should be able to: recall the definition of a species and know how the binomial system is
More informationMETHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
More informationTaming the Beast Workshop
Workshop and Chi Zhang June 28, 2016 1 / 19 Species tree Species tree the phylogeny representing the relationships among a group of species Figure adapted from [Rogers and Gibbs, 2014] Gene tree the phylogeny
More informationComputa(onal Challenges in Construc(ng the Tree of Life
Computa(onal Challenges in Construc(ng the Tree of Life Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana-Champaign h?p://tandy.cs.illinois.edu Phylogeny (evolueonary tree)
More informationLecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
More information2018 Phylogenomics Software Symposium Institut des Sciences de l Evolution - Montpellier August 17, 2018 Abstracts
2018 Phylogenomics Software Symposium Institut des Sciences de l Evolution - Montpellier August 17, 2018 Abstracts Dominic J. Bennett Title: supersmartr: Towards a modular pipeline for phylogenetic tree
More informationPhylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
More informationMiGA: The Microbial Genome Atlas
December 12 th 2017 MiGA: The Microbial Genome Atlas Jim Cole Center for Microbial Ecology Dept. of Plant, Soil & Microbial Sciences Michigan State University East Lansing, Michigan U.S.A. Where I m From
More informationQuantifying sequence similarity
Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity
More informationWarm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab
Date: Agenda Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab Ask questions based on 5.1 and 5.2 Quiz on 5.1 and 5.2 How
More informationComputational Biology From The Perspective Of A Physical Scientist
Computational Biology From The Perspective Of A Physical Scientist Dr. Arthur Dong PP1@TUM 26 November 2013 Bioinformatics Education Curriculum Math, Physics, Computer Science (Statistics and Programming)
More informationEvolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies Anatomical features were the dominant
More informationSPECIATION. REPRODUCTIVE BARRIERS PREZYGOTIC: Barriers that prevent fertilization. Habitat isolation Populations can t get together
SPECIATION Origin of new species=speciation -Process by which one species splits into two or more species, accounts for both the unity and diversity of life SPECIES BIOLOGICAL CONCEPT Population or groups
More informationInDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
More informationEmily Blanton Phylogeny Lab Report May 2009
Introduction It is suggested through scientific research that all living organisms are connected- that we all share a common ancestor and that, through time, we have all evolved from the same starting
More informationthebiotutor.com AS Biology Unit 2 Classification, Adaptation & Biodiversity
thebiotutor.com AS Biology Unit 2 Classification, Adaptation & Biodiversity 1 Classification and taxonomy Classification Phylogeny Taxonomy The process of sorting living things into groups. The study of
More informationPhylogenetic Trees. How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species?
Why? Phylogenetic Trees How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species? The saying Don t judge a book by its cover. could be applied
More informationChapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
More informationThe practice of naming and classifying organisms is called taxonomy.
Chapter 18 Key Idea: Biologists use taxonomic systems to organize their knowledge of organisms. These systems attempt to provide consistent ways to name and categorize organisms. The practice of naming
More informationMULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE
MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE Manmeet Kaur 1, Navneet Kaur Bawa 2 1 M-tech research scholar (CSE Dept) ACET, Manawala,Asr 2 Associate Professor (CSE Dept) ACET, Manawala,Asr
More informationEffects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
More informationCOMPARING DNA SEQUENCES TO UNDERSTAND EVOLUTIONARY RELATIONSHIPS WITH BLAST
Big Idea 1 Evolution INVESTIGATION 3 COMPARING DNA SEQUENCES TO UNDERSTAND EVOLUTIONARY RELATIONSHIPS WITH BLAST How can bioinformatics be used as a tool to determine evolutionary relationships and to
More informationSubfamily HMMS in Functional Genomics. D. Brown, N. Krishnamurthy, J.M. Dale, W. Christopher, and K. Sjölander
Subfamily HMMS in Functional Genomics D. Brown, N. Krishnamurthy, J.M. Dale, W. Christopher, and K. Sjölander Pacific Symposium on Biocomputing 10:322-333(2005) SUBFAMILY HMMS IN FUNCTIONAL GENOMICS DUNCAN
More informationName: Class: Date: ID: A
Class: _ Date: _ Ch 17 Practice test 1. A segment of DNA that stores genetic information is called a(n) a. amino acid. b. gene. c. protein. d. intron. 2. In which of the following processes does change
More informationResearch Proposal. Title: Multiple Sequence Alignment used to investigate the co-evolving positions in OxyR Protein family.
Research Proposal Title: Multiple Sequence Alignment used to investigate the co-evolving positions in OxyR Protein family. Name: Minjal Pancholi Howard University Washington, DC. June 19, 2009 Research
More informationBiology. Slide 1 of 24. End Show. Copyright Pearson Prentice Hall
Biology 1 of 24 18-2 Modern Evolutionary Classification 2 of 24 18-2 Modern Evolutionary Classification Evolutionary Classification Evolutionary Classification Phylogeny is the study of evolutionary relationships
More informationStatistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic
More informationReconstruction of species trees from gene trees using ASTRAL. Siavash Mirarab University of California, San Diego (ECE)
Reconstruction of species trees from gene trees using ASTRAL Siavash Mirarab University of California, San Diego (ECE) Phylogenomics Orangutan Chimpanzee gene 1 gene 2 gene 999 gene 1000 Gorilla Human
More informationStatistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences
Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD William and Nancy Thompson Missouri Distinguished Professor Department
More informationMicrobiome: 16S rrna Sequencing 3/30/2018
Microbiome: 16S rrna Sequencing 3/30/2018 Skills from Previous Lectures Central Dogma of Biology Lecture 3: Genetics and Genomics Lecture 4: Microarrays Lecture 12: ChIP-Seq Phylogenetics Lecture 13: Phylogenetics
More informationComputational methods for predicting protein-protein interactions
Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational
More informationBiodiversity. The Road to the Six Kingdoms of Life
Biodiversity The Road to the Six Kingdoms of Life How the 6 kingdoms came about At first, only two kingdoms were recognized Then Haeckel proposed a third kingdom Protista (where protists had both plant
More informationBioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
More informationEvidences of Evolution (Clues)
Evidences of Evolution (Clues) Darwin stated that all organisms descended from a common ancestor Darwin based his theory of Natural Selection on observations of: Traits, geographical distribution, selective
More informationSemantic Integration of Biological Entities in Phylogeny Visualization: Ontology Approach
American Association for Science and Technology AASCIT Communications Volume 1, Issue 3 October 20, 2014 online Semantic Integration of Biological Entities in Phylogeny Visualization: Ontology Approach
More informationProcesses of Evolution
15 Processes of Evolution Forces of Evolution Concept 15.4 Selection Can Be Stabilizing, Directional, or Disruptive Natural selection can act on quantitative traits in three ways: Stabilizing selection
More informationA phylogenomic toolbox for assembling the tree of life
A phylogenomic toolbox for assembling the tree of life or, The Phylota Project (http://www.phylota.org) UC Davis Mike Sanderson Amy Driskell U Pennsylvania Junhyong Kim Iowa State Oliver Eulenstein David
More informationBioinformatics. Dept. of Computational Biology & Bioinformatics
Bioinformatics Dept. of Computational Biology & Bioinformatics 3 Bioinformatics - play with sequences & structures Dept. of Computational Biology & Bioinformatics 4 ORGANIZATION OF LIFE ROLE OF BIOINFORMATICS
More informationPredicting Protein Functions and Domain Interactions from Protein Interactions
Predicting Protein Functions and Domain Interactions from Protein Interactions Fengzhu Sun, PhD Center for Computational and Experimental Genomics University of Southern California Outline High-throughput
More information9/19/2012. Chapter 17 Organizing Life s Diversity. Early Systems of Classification
Section 1: The History of Classification Section 2: Modern Classification Section 3: Domains and Kingdoms Click on a lesson name to select. Early Systems of Classification Biologists use a system of classification
More informationPHYLOGENY AND SYSTEMATICS
AP BIOLOGY EVOLUTION/HEREDITY UNIT Unit 1 Part 11 Chapter 26 Activity #15 NAME DATE PERIOD PHYLOGENY AND SYSTEMATICS PHYLOGENY Evolutionary history of species or group of related species SYSTEMATICS Study
More informationOutline. I. Methods. II. Preliminary Results. A. Phylogeny Methods B. Whole Genome Methods C. Horizontal Gene Transfer
Comparative Genomics Preliminary Results April 4, 2016 Juan Castro, Aroon Chande, Cheng Chen, Evan Clayton, Hector Espitia, Alli Gombolay, Walker Gussler, Ken Lee, Tyrone Lee, Hari Prasanna, Carlos Ruiz,
More informationOMICS Journals are welcoming Submissions
OMICS Journals are welcoming Submissions OMICS International welcomes submissions that are original and technically so as to serve both the developing world and developed countries in the best possible
More informationUnsupervised Learning in Spectral Genome Analysis
Unsupervised Learning in Spectral Genome Analysis Lutz Hamel 1, Neha Nahar 1, Maria S. Poptsova 2, Olga Zhaxybayeva 3, J. Peter Gogarten 2 1 Department of Computer Sciences and Statistics, University of
More informationK-means-based Feature Learning for Protein Sequence Classification
K-means-based Feature Learning for Protein Sequence Classification Paul Melman and Usman W. Roshan Department of Computer Science, NJIT Newark, NJ, 07102, USA pm462@njit.edu, usman.w.roshan@njit.edu Abstract
More informationPostgraduate teaching for the next generation of taxonomists
Postgraduate teaching for the next generation of taxonomists Alfried P. Vogler Professor of Molecular Systematics Imperial College London and Natural History Museum MSc in Taxonomy and Biodiversity MRes
More informationA. Incorrect! In the binomial naming convention the Kingdom is not part of the name.
Microbiology Problem Drill 08: Classification of Microorganisms No. 1 of 10 1. In the binomial system of naming which term is always written in lowercase? (A) Kingdom (B) Domain (C) Genus (D) Specific
More informationFor Classroom Trial Testing
For Classroom Trial Testing Video Description Secrets of the Sequence, Show 141, Episode 2 From Slime to Sublime approximately 10 minutes viewing time While we are similar to our fellow man in size, shape,
More informationdoi: / _25
Boc, A., P. Legendre and V. Makarenkov. 2013. An efficient algorithm for the detection and classification of horizontal gene transfer events and identification of mosaic genes. Pp. 253-260 in: B. Lausen,
More information#33 - Genomics 11/09/07
BCB 444/544 Required Reading (before lecture) Lecture 33 Mon Nov 5 - Lecture 31 Phylogenetics Parsimony and ML Chp 11 - pp 142 169 Genomics Wed Nov 7 - Lecture 32 Machine Learning Fri Nov 9 - Lecture 33
More informationFigure 1. Consider this cladogram. Let s examine it with all three species concepts:
Biology 1B Evolution Lecture 9 - Speciation Processes Species identification - the grey zone Figure 1 Consider this cladogram. Let s examine it with all three species concepts: For each species, we can
More informationPhylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
More informationPhylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches
Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell
More informationComparison of Cost Functions in Sequence Alignment. Ryan Healey
Comparison of Cost Functions in Sequence Alignment Ryan Healey Use of Cost Functions Used to score and align sequences Mathematically model how sequences mutate and evolve. Evolution and mutation can be
More informationBIOINFORMATICS: An Introduction
BIOINFORMATICS: An Introduction What is Bioinformatics? The term was first coined in 1988 by Dr. Hwa Lim The original definition was : a collective term for data compilation, organisation, analysis and
More informationFast coalescent-based branch support using local quartet frequencies
Fast coalescent-based branch support using local quartet frequencies Molecular Biology and Evolution (2016) 33 (7): 1654 68 Erfan Sayyari, Siavash Mirarab University of California, San Diego (ECE) anzee
More informationBiodiversity. The Road to the Six Kingdoms of Life
Biodiversity The Road to the Six Kingdoms of Life How the 6 kingdoms came about At first, only two kingdoms were recognized Then Haeckel proposed a third kingdom Protista (where protists had both plant
More informationPhylogenetic Networks, Trees, and Clusters
Phylogenetic Networks, Trees, and Clusters Luay Nakhleh 1 and Li-San Wang 2 1 Department of Computer Science Rice University Houston, TX 77005, USA nakhleh@cs.rice.edu 2 Department of Biology University
More informationreconciling trees Stefanie Hartmann postdoc, Todd Vision s lab University of North Carolina the data
reconciling trees Stefanie Hartmann postdoc, Todd Vision s lab University of North Carolina 1 the data alignments and phylogenies for ~27,000 gene families from 140 plant species www.phytome.org publicly
More information