Gene Ontology and overrepresentation analysis

Size: px
Start display at page:

Download "Gene Ontology and overrepresentation analysis"

Transcription

1 Gene Ontology and overrepresentation analysis Kjell Petersen J Express Microarray analysis course Oslo December 2009 Presentation adapted from Endre Anderssen and Vidar Beisvåg NMC Trondheim

2 Overview How can ontologies (and pathway) information help us What is an ontology? The Gene Ontology and how it's structured How to use Interactively Statistically Additional things to think about

3 So here you are Figure of diff exp

4 Gene lists Long list of differentially expressed genes Possibly hundreds of papers describing the functions of the genes Misleading names Different names in dfifferent organisms

5 What s in a name? The same name can be used to describe different concepts What is a cell?

6 Cell

7 Cell

8 Cell Image from

9 Gene Ontology (GO) Ontologies Sequence Ontology (SO) (sequence features) Phenotype and Trait Ontology (PATO) Taxon (NCBI) Anatomy (Penn) Disease (ICD9) Developmental stage (multiple sources)

10 Why Gene Ontology? Gene Ontology (GO) Produce a controlled vocabulary describing aspects of molecular biology, that can be applied to all organisms. Facilitate communication between people and organization. Improve interoperability between systems.

11 Goal of GO Consortium ( Produce a controlled vocabulary describing aspects of molecular biology, that could be applied to all organism. Describe gene products using vocabulary terms (annotation). Develop tools: to query and modify the vocavularies and annotations

12 How does GO work? What information might we want to capture about a gene product? What does the gene product do? Why does it perform these activities? Where does it act?

13 The Gene Ontology (GO) Molecular function: Gene product at biochemical level. Biological process: Cellular events to which the gene product contributes. Cellular component: Location or complex of gene/protein.

14 Molecular Function activities or jobs of a gene product Insulin binding insulin transport activity

15 Molecular Function drug transporter activity

16 Biological Process a commonly recognized series of events cell division

17 Cellular Component where a gene product acts

18 Content of GO Molecular Function 7,309 terms Biological Process 10,041 terms Cellular Component 1,629 terms Total 18, 975 terms Obsolete terms: 992 As of October 2005

19 Ontology Structure Directed acyclic graphs (DAGs) Relationships is a a is a type of b (e.g. truck is a car, or mitochondrion is an organelle) Regulates Positively regulates Negatively regulates part of sub process of (process) physical part of (component) (e.g. engine is part of a car, or mitochondrion membrane is a part of a mitochondrion)

20

21 Term Definitions and Curation The definitions for each GO term are being primarily derived from the Oxford Dictionary of Molecular Biology, or from relevant literature sources (SWISS PROT, PIR, NCBI CGAP, EC...). Curators around the world shifting through genomic and proteomic data then use the definitions and GO terms provided by GO to annotate or curate the genes and proteins in their favorite species. GO is stored as flat files, as XML files and as a relational database implemented in MySQL.

22 GO Annotation Association between gene product and applicable GO terms Provided by member databases. Collaborating databases annotate their gene products (or genes) with GO terms, providing references and indicating what kind of evidence is available to support the annotations. Made by manual or automated methods. GO Annotation Database object: gene or gene product GO term ID Evidence supporting annotation Reference publication or computational method

23 Gene Ontology and Microarrays Hypothesis: Functionally related, differentially expressed genes should accumulate in the corresponding GO group. Problem: Find a method, which scores accumulation of differential gene expression in a node of the Gene Ontology. GO tools can be important in order to answer questions such as: are genes involved in process P overrepresented among the total of differentially expressed genes in an experiment or does treatment A induce more genes involved in process P than treatment B?".

24 Browsing GO in J Express

25 Overrepresentation of GO terms We have a subset of genes List of differentially expressed genes List of genes that cluster together Which biological processes do these genes take part in? Is there an over representation of the number of genes belonging to a particular biological process, compared to what could be expected?

26 Question If we look at the dataset containing all of our genes and see that 10% of these belong to cell cycle. We then do a differentially expressed genes analysis and get a list of genes we believe are significantly changed. How many of the genes in the gene list do you expect belong to cell cycle?

27 Setup We name our subset of interesting genes for test data Reference data And the dataset containing all of our genes, the dataset we extracted the interesting genes Test datafrom and that we want to compare our testdata to, for reference data

28 Gene Ontology Analysis Reference data Test data Statistical comparison between the two GO components

29 Some gotchas P value not corrected for multiple testing Bonferroni correction: multiply by number of terms mapped to your dataset (sum of 3 blue numbers at the 3 top terms) Results depend on Selected cut off for test data (check for consistency over several cut offs) Version of GO obo and association files (keep track of which used) Browse the terms in the neighbourhood of high scoring terms, will often reveal more context.

30 Nice to know Alternative term hierarchies / tools GO slim Panther DB ( DAVID (

Genome Annotation. Bioinformatics and Computational Biology. Genome sequencing Assembly. Gene prediction. Protein targeting.

Genome Annotation. Bioinformatics and Computational Biology. Genome sequencing Assembly. Gene prediction. Protein targeting. Genome Annotation Bioinformatics and Computational Biology Genome Annotation Frank Oliver Glöckner 1 Genome Analysis Roadmap Genome sequencing Assembly Gene prediction Protein targeting trna prediction

More information

Gene Ontology. Shifra Ben-Dor. Weizmann Institute of Science

Gene Ontology. Shifra Ben-Dor. Weizmann Institute of Science Gene Ontology Shifra Ben-Dor Weizmann Institute of Science Outline of Session What is GO (Gene Ontology)? What tools do we use to work with it? Combination of GO with other analyses What is Ontology? 1700s

More information

2 GENE FUNCTIONAL SIMILARITY. 2.1 Semantic values of GO terms

2 GENE FUNCTIONAL SIMILARITY. 2.1 Semantic values of GO terms Bioinformatics Advance Access published March 7, 2007 The Author (2007). Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oxfordjournals.org

More information

GENE ONTOLOGY (GO) Wilver Martínez Martínez Giovanny Silva Rincón

GENE ONTOLOGY (GO) Wilver Martínez Martínez Giovanny Silva Rincón GENE ONTOLOGY (GO) Wilver Martínez Martínez Giovanny Silva Rincón What is GO? The Gene Ontology (GO) project is a collaborative effort to address the need for consistent descriptions of gene products in

More information

BMD645. Integration of Omics

BMD645. Integration of Omics BMD645 Integration of Omics Shu-Jen Chen, Chang Gung University Dec. 11, 2009 1 Traditional Biology vs. Systems Biology Traditional biology : Single genes or proteins Systems biology: Simultaneously study

More information

Gene Ontology and Functional Enrichment. Genome 559: Introduction to Statistical and Computational Genomics Elhanan Borenstein

Gene Ontology and Functional Enrichment. Genome 559: Introduction to Statistical and Computational Genomics Elhanan Borenstein Gene Ontology and Functional Enrichment Genome 559: Introduction to Statistical and Computational Genomics Elhanan Borenstein The parsimony principle: A quick review Find the tree that requires the fewest

More information

Integration of functional genomics data

Integration of functional genomics data Integration of functional genomics data Laboratoire Bordelais de Recherche en Informatique (UMR) Centre de Bioinformatique de Bordeaux (Plateforme) Rennes Oct. 2006 1 Observations and motivations Genomics

More information

Francisco M. Couto Mário J. Silva Pedro Coutinho

Francisco M. Couto Mário J. Silva Pedro Coutinho Francisco M. Couto Mário J. Silva Pedro Coutinho DI FCUL TR 03 29 Departamento de Informática Faculdade de Ciências da Universidade de Lisboa Campo Grande, 1749 016 Lisboa Portugal Technical reports are

More information

ToxiCat: Hybrid Named Entity Recognition services to support curation of the Comparative Toxicogenomic Database

ToxiCat: Hybrid Named Entity Recognition services to support curation of the Comparative Toxicogenomic Database ToxiCat: Hybrid Named Entity Recognition services to support curation of the Comparative Toxicogenomic Database Dina Vishnyakova 1,2, 4, *, Julien Gobeill 1,3,4, Emilie Pasche 1,2,3,4 and Patrick Ruch

More information

Analysis and visualization of protein-protein interactions. Olga Vitek Assistant Professor Statistics and Computer Science

Analysis and visualization of protein-protein interactions. Olga Vitek Assistant Professor Statistics and Computer Science 1 Analysis and visualization of protein-protein interactions Olga Vitek Assistant Professor Statistics and Computer Science 2 Outline 1. Protein-protein interactions 2. Using graph structures to study

More information

Lecture 2. The Blast2GO annotation framework

Lecture 2. The Blast2GO annotation framework Lecture 2 The Blast2GO annotation framework Annotation steps Modulation of annotation intensity Export/Import Functions Sequence Selection Additional Tools Functional assignment Annotation Transference

More information

CSCE555 Bioinformatics. Protein Function Annotation

CSCE555 Bioinformatics. Protein Function Annotation CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The

More information

Supplementary Information 16

Supplementary Information 16 Supplementary Information 16 Cellular Component % of Genes 50 45 40 35 30 25 20 15 10 5 0 human mouse extracellular other membranes plasma membrane cytosol cytoskeleton mitochondrion ER/Golgi translational

More information

SABIO-RK Integration and Curation of Reaction Kinetics Data Ulrike Wittig

SABIO-RK Integration and Curation of Reaction Kinetics Data  Ulrike Wittig SABIO-RK Integration and Curation of Reaction Kinetics Data http://sabio.villa-bosch.de/sabiork Ulrike Wittig Overview Introduction /Motivation Database content /User interface Data integration Curation

More information

86 Part 4 SUMMARY INTRODUCTION

86 Part 4 SUMMARY INTRODUCTION 86 Part 4 Chapter # AN INTEGRATION OF THE DESCRIPTIONS OF GENE NETWORKS AND THEIR MODELS PRESENTED IN SIGMOID (CELLERATOR) AND GENENET Podkolodny N.L. *1, 2, Podkolodnaya N.N. 1, Miginsky D.S. 1, Poplavsky

More information

Introduction to the EMBL-EBI Ontology Lookup Service

Introduction to the EMBL-EBI Ontology Lookup Service Introduction to the EMBL-EBI Ontology Lookup Service Simon Jupp jupp@ebi.ac.uk, @simonjupp Samples, Phenotypes and Ontologies Team European Bioinformatics Institute Cambridge, UK. Ontologies in the life

More information

Biological Concepts and Information Technology (Systems Biology)

Biological Concepts and Information Technology (Systems Biology) Biological Concepts and Information Technology (Systems Biology) Janaina de Andréa Dernowsek Postdoctoral at Center for Information Technology Renato Archer Janaina.dernowsek@cti.gov.br Division of 3D

More information

Annotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010

Annotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010 Annotation Error in Public Databases ALEXANDRA SCHNOES UNIVERSITY OF CALIFORNIA, SAN FRANCISCO OCTOBER 25, 2010 1 New genomes (and metagenomes) sequenced every day... 2 3 3 3 3 3 3 3 3 3 Computational

More information

Ontology Alignment in the Presence of a Domain Ontology

Ontology Alignment in the Presence of a Domain Ontology Ontology Alignment in the Presence of a Domain Ontology Finding Protein Homology by Andrew August Carbonetto B.Sc., McGill University, 2005 A THESIS SUBMITTED IN PARTIAL FULFILMENT OF THE REQUIREMENTS

More information

Introduction to Bioinformatics

Introduction to Bioinformatics CSCI8980: Applied Machine Learning in Computational Biology Introduction to Bioinformatics Rui Kuang Department of Computer Science and Engineering University of Minnesota kuang@cs.umn.edu History of Bioinformatics

More information

Learning in Bayesian Networks

Learning in Bayesian Networks Learning in Bayesian Networks Florian Markowetz Max-Planck-Institute for Molecular Genetics Computational Molecular Biology Berlin Berlin: 20.06.2002 1 Overview 1. Bayesian Networks Stochastic Networks

More information

Cells The Units of Life

Cells The Units of Life Before You Read Before you read the chapter, respond to these statements. Write an A if you agree with the statement. Write a D if you disagree with the statement. Before You Read Bacteria are the smallest

More information

Networks & pathways. Hedi Peterson MTAT Bioinformatics

Networks & pathways. Hedi Peterson MTAT Bioinformatics Networks & pathways Hedi Peterson (peterson@quretec.com) MTAT.03.239 Bioinformatics 03.11.2010 Networks are graphs Nodes Edges Edges Directed, undirected, weighted Nodes Genes Proteins Metabolites Enzymes

More information

Bioinformatics. Dept. of Computational Biology & Bioinformatics

Bioinformatics. Dept. of Computational Biology & Bioinformatics Bioinformatics Dept. of Computational Biology & Bioinformatics 3 Bioinformatics - play with sequences & structures Dept. of Computational Biology & Bioinformatics 4 ORGANIZATION OF LIFE ROLE OF BIOINFORMATICS

More information

Computational approaches for functional genomics

Computational approaches for functional genomics Computational approaches for functional genomics Kalin Vetsigian October 31, 2001 The rapidly increasing number of completely sequenced genomes have stimulated the development of new methods for finding

More information

The EcoCyc Database. January 25, de Nitrógeno, UNAM,Cuernavaca, A.P. 565-A, Morelos, 62100, Mexico;

The EcoCyc Database. January 25, de Nitrógeno, UNAM,Cuernavaca, A.P. 565-A, Morelos, 62100, Mexico; The EcoCyc Database Peter D. Karp, Monica Riley, Milton Saier,IanT.Paulsen +, Julio Collado-Vides + Suzanne M. Paley, Alida Pellegrini-Toole,César Bonavides ++, and Socorro Gama-Castro ++ January 25, 2002

More information

Predicting Protein Functions and Domain Interactions from Protein Interactions

Predicting Protein Functions and Domain Interactions from Protein Interactions Predicting Protein Functions and Domain Interactions from Protein Interactions Fengzhu Sun, PhD Center for Computational and Experimental Genomics University of Southern California Outline High-throughput

More information

Gabriella Rustici EMBL-EBI

Gabriella Rustici EMBL-EBI Towards a cellular phenotype ontology Gabriella Rustici EMBL-EBI gabry@ebi.ac.uk Systems Microscopy NoE at a glance The Systems Microscopy NoE (2011 2015) is a FP7 funded project, involving 15 research

More information

CS612 - Algorithms in Bioinformatics

CS612 - Algorithms in Bioinformatics Fall 2017 Databases and Protein Structure Representation October 2, 2017 Molecular Biology as Information Science > 12, 000 genomes sequenced, mostly bacterial (2013) > 5x10 6 unique sequences available

More information

Computational Genomics. Systems biology. Putting it together: Data integration using graphical models

Computational Genomics. Systems biology. Putting it together: Data integration using graphical models 02-710 Computational Genomics Systems biology Putting it together: Data integration using graphical models High throughput data So far in this class we discussed several different types of high throughput

More information

Science Online Instructional Materials Correlation to the 2010 Biology Standards of Learning and Curriculum Framework

Science Online Instructional Materials Correlation to the 2010 Biology Standards of Learning and Curriculum Framework and Curriculum Framework Provider York County School Divison Course Title Biology Last Updated 2010-11 Course Syllabus URL http://yorkcountyschools.org/virtuallearning/coursecatalog.aspx BIO.1 The student

More information

Hands-On Nine The PAX6 Gene and Protein

Hands-On Nine The PAX6 Gene and Protein Hands-On Nine The PAX6 Gene and Protein Main Purpose of Hands-On Activity: Using bioinformatics tools to examine the sequences, homology, and disease relevance of the Pax6: a master gene of eye formation.

More information

A Protein Ontology from Large-scale Textmining?

A Protein Ontology from Large-scale Textmining? A Protein Ontology from Large-scale Textmining? Protege-Workshop Manchester, 07-07-2003 Kai Kumpf, Juliane Fluck and Martin Hofmann Instructive mistakes: a narrative Aim: Protein ontology that supports

More information

Science Textbook and Instructional Materials Correlation to the 2010 Biology Standards of Learning and Curriculum Framework. Publisher Information

Science Textbook and Instructional Materials Correlation to the 2010 Biology Standards of Learning and Curriculum Framework. Publisher Information Publisher Information Copyright date 2013 Contact Carol Kornfeind Phone# 847-486-2065 E-mail carol.kornfeind@pearson.com Biology 1 of 12 Virginia Department of Education Text Miller Levine Biology, Virginia

More information

A Study of Correlations between the Definition and Application of the Gene Ontology

A Study of Correlations between the Definition and Application of the Gene Ontology University of Nebraska - Lincoln DigitalCommons@University of Nebraska - Lincoln Theses, Dissertations, & Student Research in Computer Electronics & Engineering Electrical & Computer Engineering, Department

More information

What is Systems Biology

What is Systems Biology What is Systems Biology 2 CBS, Department of Systems Biology 3 CBS, Department of Systems Biology Data integration In the Big Data era Combine different types of data, describing different things or the

More information

Research Article HomoKinase: A Curated Database of Human Protein Kinases

Research Article HomoKinase: A Curated Database of Human Protein Kinases ISRN Computational Biology Volume 2013, Article ID 417634, 5 pages http://dx.doi.org/10.1155/2013/417634 Research Article HomoKinase: A Curated Database of Human Protein Kinases Suresh Subramani, Saranya

More information

Lab 2 Worksheet. Problems. Problem 1: Geometry and Linear Equations

Lab 2 Worksheet. Problems. Problem 1: Geometry and Linear Equations Lab 2 Worksheet Problems Problem : Geometry and Linear Equations Linear algebra is, first and foremost, the study of systems of linear equations. You are going to encounter linear systems frequently in

More information

Lecture 3: A basic statistical concept

Lecture 3: A basic statistical concept Lecture 3: A basic statistical concept P value In statistical hypothesis testing, the p value is the probability of obtaining a result at least as extreme as the one that was actually observed, assuming

More information

A Database of human biological pathways

A Database of human biological pathways A Database of human biological pathways Steve Jupe - sjupe@ebi.ac.uk 1 Rationale Journal information Nature 407(6805):770-6.The Biochemistry of Apoptosis. Caspase-8 is the key initiator caspase in the

More information

EBI web resources II: Ensembl and InterPro. Yanbin Yin Spring 2013

EBI web resources II: Ensembl and InterPro. Yanbin Yin Spring 2013 EBI web resources II: Ensembl and InterPro Yanbin Yin Spring 2013 1 Outline Intro to genome annotation Protein family/domain databases InterPro, Pfam, Superfamily etc. Genome browser Ensembl Hands on Practice

More information

Proteomics. Yeast two hybrid. Proteomics - PAGE techniques. Data obtained. What is it?

Proteomics. Yeast two hybrid. Proteomics - PAGE techniques. Data obtained. What is it? Proteomics What is it? Reveal protein interactions Protein profiling in a sample Yeast two hybrid screening High throughput 2D PAGE Automatic analysis of 2D Page Yeast two hybrid Use two mating strains

More information

Warm Up. What are some examples of living things? Describe the characteristics of living things

Warm Up. What are some examples of living things? Describe the characteristics of living things Warm Up What are some examples of living things? Describe the characteristics of living things Objectives Identify the levels of biological organization and explain their relationships Describe cell structure

More information

Goal 1: Develop knowledge and understanding of core content in biology

Goal 1: Develop knowledge and understanding of core content in biology Indiana State University» College of Arts & Sciences» Biology BA/BS in Biology Standing Requirements s Library Goal 1: Develop knowledge and understanding of core content in biology 1: Illustrate and examine

More information

Outline. Terminologies and Ontologies. Communication and Computation. Communication. Outline. Terminologies and Vocabularies.

Outline. Terminologies and Ontologies. Communication and Computation. Communication. Outline. Terminologies and Vocabularies. Page 1 Outline 1. Why do we need terminologies and ontologies? Terminologies and Ontologies Iwei Yeh yeh@smi.stanford.edu 04/16/2002 2. Controlled Terminologies Enzyme Classification Gene Ontology 3. Ontologies

More information

ATLAS of Biochemistry

ATLAS of Biochemistry ATLAS of Biochemistry USER GUIDE http://lcsb-databases.epfl.ch/atlas/ CONTENT 1 2 3 GET STARTED Create your user account NAVIGATE Curated KEGG reactions ATLAS reactions Pathways Maps USE IT! Fill a gap

More information

ADVANCED PLACEMENT BIOLOGY

ADVANCED PLACEMENT BIOLOGY ADVANCED PLACEMENT BIOLOGY Description Advanced Placement Biology is designed to be the equivalent of a two-semester college introductory course for Biology majors. The course meets seven periods per week

More information

Updated: 10/11/2018 Page 1 of 5

Updated: 10/11/2018 Page 1 of 5 A. Academic Division: Health Sciences B. Discipline: Biology C. Course Number and Title: BIOL1230 Biology I MASTER SYLLABUS 2018-2019 D. Course Coordinator: Justin Tickhill Assistant Dean: Melinda Roepke,

More information

Grundlagen der Bioinformatik Summer semester Lecturer: Prof. Daniel Huson

Grundlagen der Bioinformatik Summer semester Lecturer: Prof. Daniel Huson Grundlagen der Bioinformatik, SS 10, D. Huson, April 12, 2010 1 1 Introduction Grundlagen der Bioinformatik Summer semester 2010 Lecturer: Prof. Daniel Huson Office hours: Thursdays 17-18h (Sand 14, C310a)

More information

Comparative Network Analysis

Comparative Network Analysis Comparative Network Analysis BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2016 Anthony Gitter gitter@biostat.wisc.edu These slides, excluding third-party material, are licensed under CC BY-NC 4.0 by

More information

The Role of Network Science in Biology and Medicine. Tiffany J. Callahan Computational Bioscience Program Hunter/Kahn Labs

The Role of Network Science in Biology and Medicine. Tiffany J. Callahan Computational Bioscience Program Hunter/Kahn Labs The Role of Network Science in Biology and Medicine Tiffany J. Callahan Computational Bioscience Program Hunter/Kahn Labs Network Analysis Working Group 09.28.2017 Network-Enabled Wisdom (NEW) empirically

More information

FCModeler: Dynamic Graph Display and Fuzzy Modeling of Regulatory and Metabolic Maps

FCModeler: Dynamic Graph Display and Fuzzy Modeling of Regulatory and Metabolic Maps FCModeler: Dynamic Graph Display and Fuzzy Modeling of Regulatory and Metabolic Maps Julie Dickerson 1, Zach Cox 1 and Andy Fulmer 2 1 Iowa State University and 2 Proctor & Gamble. FCModeler Goals Capture

More information

EBI web resources II: Ensembl and InterPro

EBI web resources II: Ensembl and InterPro EBI web resources II: Ensembl and InterPro Yanbin Yin http://www.ebi.ac.uk/training/online/course/ 1 Homework 3 Go to http://www.ebi.ac.uk/interpro/training.htmland finish the second online training course

More information

The geneticist s questions

The geneticist s questions The geneticist s questions a) What is consequence of reduced gene function? 1) gene knockout (deletion, RNAi) b) What is the consequence of increased gene function? 2) gene overexpression c) What does

More information

Student Handout Fruit Fly Ethomics & Genomics

Student Handout Fruit Fly Ethomics & Genomics Student Handout Fruit Fly Ethomics & Genomics Summary of Laboratory Exercise In this laboratory unit, students will connect behavioral phenotypes to their underlying genes and molecules in the model genetic

More information

Cross Discipline Analysis made possible with Data Pipelining. J.R. Tozer SciTegic

Cross Discipline Analysis made possible with Data Pipelining. J.R. Tozer SciTegic Cross Discipline Analysis made possible with Data Pipelining J.R. Tozer SciTegic System Genesis Pipelining tool created to automate data processing in cheminformatics Modular system built with generic

More information

Carri-Lyn Mead Thursday, January 13, 2005 Terry Fox Laboratory, Dr. Dixie Mager

Carri-Lyn Mead Thursday, January 13, 2005 Terry Fox Laboratory, Dr. Dixie Mager Investigating Trends in Transposable Element Insertion within Regulatory Regions Carri-Lyn Mead cmead@bcgsc.ca Thursday, January 13, 2005 Terry Fox Laboratory, Dr. Dixie Mager Outline Transposable Element

More information

Total

Total Student Performance by Question Biology (Multiple-Choice ONLY) Teacher: Core 1 / S-14 Scientific Investigation Life at the Molecular and Cellular Level Analysis of Performance by Question of each student

More information

The MANTiS Manual. Contents. MANTiS Version 1.1

The MANTiS Manual. Contents. MANTiS Version 1.1 The MANTiS Manual MANTiS Version 1.1 Contents Connection to the MANTiS database... 2 Memory settings... 2 Main functionalities... 2 Character Mapping View... 4 Genome content View... 5 Biological processes

More information

Proteomics Systems Biology

Proteomics Systems Biology Dr. Sanjeeva Srivastava IIT Bombay Proteomics Systems Biology IIT Bombay 2 1 DNA Genomics RNA Transcriptomics Global Cellular Protein Proteomics Global Cellular Metabolite Metabolomics Global Cellular

More information

Bioinformatics 2. Yeast two hybrid. Proteomics. Proteomics

Bioinformatics 2. Yeast two hybrid. Proteomics. Proteomics GENOME Bioinformatics 2 Proteomics protein-gene PROTEOME protein-protein METABOLISM Slide from http://www.nd.edu/~networks/ Citrate Cycle Bio-chemical reactions What is it? Proteomics Reveal protein Protein

More information

Computational methods for predicting protein-protein interactions

Computational methods for predicting protein-protein interactions Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational

More information

Molecular and cellular biology is about studying cell structure and function

Molecular and cellular biology is about studying cell structure and function Chapter 1 Exploring the World of the Cell In This Chapter Discovering the microscopic world Getting matter and energy Reading the genetic code Molecular and cellular biology is about studying cell structure

More information

Chetek-Weyerhaeuser High School

Chetek-Weyerhaeuser High School Chetek-Weyerhaeuser High School Unit 1 The Science of Biology (5 days) Biology I Units and s Biology I A s 1. I can design a scientific experiment that includes a control group, experimental group, constants,

More information

RCPS Curriculum Pacing Guide Subject: Biology. Remembering, Understanding, Applying, Analyzing, Evaluating, Creating

RCPS Curriculum Pacing Guide Subject: Biology. Remembering, Understanding, Applying, Analyzing, Evaluating, Creating RCPS Curriculum Pacing Guide 2013 2014 Subject: Biology Week of: SOL # Unit Bloom s Objectives Week 1 and throughout the semester #BIO1 Scientific reasoning, logic and the nature of science Chapter 1 Biology:

More information

Dynamical Modeling in Biology: a semiotic perspective. Junior Barrera BIOINFO-USP

Dynamical Modeling in Biology: a semiotic perspective. Junior Barrera BIOINFO-USP Dynamical Modeling in Biology: a semiotic perspective Junior Barrera BIOINFO-USP Layout Introduction Dynamical Systems System Families System Identification Genetic networks design Cell Cycle Modeling

More information

CISC 636 Computational Biology & Bioinformatics (Fall 2016)

CISC 636 Computational Biology & Bioinformatics (Fall 2016) CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein

More information

Bayesian Hierarchical Classification. Seminar on Predicting Structured Data Jukka Kohonen

Bayesian Hierarchical Classification. Seminar on Predicting Structured Data Jukka Kohonen Bayesian Hierarchical Classification Seminar on Predicting Structured Data Jukka Kohonen 17.4.2008 Overview Intro: The task of hierarchical gene annotation Approach I: SVM/Bayes hybrid Barutcuoglu et al:

More information

Browsing Genomic Information with Ensembl Plants

Browsing Genomic Information with Ensembl Plants Browsing Genomic Information with Ensembl Plants Etienne de Villiers, PhD (Adapted from slides by Bert Overduin EMBL-EBI) Outline of workshop Brief introduction to Ensembl Plants History Content Tutorial

More information

Comparative RNA-seq analysis of transcriptome dynamics during petal development in Rosa chinensis

Comparative RNA-seq analysis of transcriptome dynamics during petal development in Rosa chinensis Title Comparative RNA-seq analysis of transcriptome dynamics during petal development in Rosa chinensis Author list Yu Han 1, Huihua Wan 1, Tangren Cheng 1, Jia Wang 1, Weiru Yang 1, Huitang Pan 1* & Qixiang

More information

Computational Biology Course Descriptions 12-14

Computational Biology Course Descriptions 12-14 Computational Biology Course Descriptions 12-14 Course Number and Title INTRODUCTORY COURSES BIO 311C: Introductory Biology I BIO 311D: Introductory Biology II BIO 325: Genetics CH 301: Principles of Chemistry

More information

BIOINFORMATICS: An Introduction

BIOINFORMATICS: An Introduction BIOINFORMATICS: An Introduction What is Bioinformatics? The term was first coined in 1988 by Dr. Hwa Lim The original definition was : a collective term for data compilation, organisation, analysis and

More information

Differential Modeling for Cancer Microarray Data

Differential Modeling for Cancer Microarray Data Differential Modeling for Cancer Microarray Data Omar Odibat Department of Computer Science Feb, 01, 2011 1 Outline Introduction Cancer Microarray data Problem Definition Differential analysis Existing

More information

Discovering molecular pathways from protein interaction and ge

Discovering molecular pathways from protein interaction and ge Discovering molecular pathways from protein interaction and gene expression data 9-4-2008 Aim To have a mechanism for inferring pathways from gene expression and protein interaction data. Motivation Why

More information

BIOLOGY 111. CHAPTER 1: An Introduction to the Science of Life

BIOLOGY 111. CHAPTER 1: An Introduction to the Science of Life BIOLOGY 111 CHAPTER 1: An Introduction to the Science of Life An Introduction to the Science of Life: Chapter Learning Outcomes 1.1) Describe the properties of life common to all living things. (Module

More information

Erzsébet Ravasz Advisor: Albert-László Barabási

Erzsébet Ravasz Advisor: Albert-László Barabási Hierarchical Networks Erzsébet Ravasz Advisor: Albert-László Barabási Introduction to networks How to model complex networks? Clustering and hierarchy Hierarchical organization of cellular metabolism The

More information

10-810: Advanced Algorithms and Models for Computational Biology. microrna and Whole Genome Comparison

10-810: Advanced Algorithms and Models for Computational Biology. microrna and Whole Genome Comparison 10-810: Advanced Algorithms and Models for Computational Biology microrna and Whole Genome Comparison Central Dogma: 90s Transcription factors DNA transcription mrna translation Proteins Central Dogma:

More information

A taxonomy of visualization tasks for the analysis of biological pathway data

A taxonomy of visualization tasks for the analysis of biological pathway data The Author(s) BMC Bioinformatics 2016, 18(Suppl 2):21 DOI 10.1186/s12859-016-1443-5 RESEARCH A taxonomy of visualization tasks for the analysis of biological pathway data Paul Murray 1*,FintanMcGee 2 and

More information

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models

Intro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL

More information

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure

Today. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK

More information

CATEGORY a TERM COUNT b P VALUE GENE FAMILIES: REPRESENTATIVE GENE SYMBOLS c. Annotation Cluster 1 Enrichment Score: 1.

CATEGORY a TERM COUNT b P VALUE GENE FAMILIES: REPRESENTATIVE GENE SYMBOLS c. Annotation Cluster 1 Enrichment Score: 1. Table S7 GO term and functional classification enrichment analysis using DAVID for gene families that are expanded in the Drosophila suzukii genome as compared to 14 Drosophila species analyzed in this

More information

Protein Interaction Mapping: Use of Osprey to map Survival of Motor Neuron Protein interactions

Protein Interaction Mapping: Use of Osprey to map Survival of Motor Neuron Protein interactions Protein Interaction Mapping: Use of Osprey to map Survival of Motor Neuron Protein interactions Presented by: Meg Barnhart Computational Biosciences Arizona State University The Spinal Muscular Atrophy

More information

Comparison of Human Protein-Protein Interaction Maps

Comparison of Human Protein-Protein Interaction Maps Comparison of Human Protein-Protein Interaction Maps Matthias E. Futschik 1, Gautam Chaurasia 1,2, Erich Wanker 2 and Hanspeter Herzel 1 1 Institute for Theoretical Biology, Charité, Humboldt-Universität

More information

Genome-wide multilevel spatial interactome model of rice

Genome-wide multilevel spatial interactome model of rice Sino-German Workshop on Multiscale Spatial Computational Systems Biology, Beijing, Oct 8-12, 2015 Genome-wide multilevel spatial interactome model of rice Ming CHEN ( 陈铭 ) mchen@zju.edu.cn College of Life

More information

The Drosophila Interactions Database: Integrating The Interactome And Transcriptome

The Drosophila Interactions Database: Integrating The Interactome And Transcriptome Wayne State University Wayne State University Dissertations 1-2-2013 The Drosophila Interactions Database: Integrating The Interactome And Transcriptome Thilakam Murali Wayne State University, Follow this

More information

Tandem Mass Spectrometry: Generating function, alignment and assembly

Tandem Mass Spectrometry: Generating function, alignment and assembly Tandem Mass Spectrometry: Generating function, alignment and assembly With slides from Sangtae Kim and from Jones & Pevzner 2004 Determining reliability of identifications Can we use Target/Decoy to estimate

More information

Week 10: Homology Modelling (II) - HHpred

Week 10: Homology Modelling (II) - HHpred Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative

More information

I. Molecules & Cells. A. Unit One: The Nature of Science. B. Unit Two: The Chemistry of Life. C. Unit Three: The Biology of the Cell.

I. Molecules & Cells. A. Unit One: The Nature of Science. B. Unit Two: The Chemistry of Life. C. Unit Three: The Biology of the Cell. I. Molecules & Cells A. Unit One: The Nature of Science a. How is the scientific method used to solve problems? b. What is the importance of controls? c. How does Darwin s theory of evolution illustrate

More information

TEST SUMMARY AND FRAMEWORK TEST SUMMARY

TEST SUMMARY AND FRAMEWORK TEST SUMMARY Washington Educator Skills Tests Endorsements (WEST E) TEST SUMMARY AND FRAMEWORK TEST SUMMARY BIOLOGY Copyright 2014 by the Washington Professional Educator Standards Board 1 Washington Educator Skills

More information

Predicting rice (Oryza sativa) metabolism

Predicting rice (Oryza sativa) metabolism Predicting rice (Oryza sativa) metabolism Sudip Kundu Department of Biophysics, Molecular Biology & Bioinformatics, University of Calcutta, WB, India. skbmbg@caluniv.ac.in Collaborators: Mark G Poolman

More information

Written Exam 15 December Course name: Introduction to Systems Biology Course no

Written Exam 15 December Course name: Introduction to Systems Biology Course no Technical University of Denmark Written Exam 15 December 2008 Course name: Introduction to Systems Biology Course no. 27041 Aids allowed: Open book exam Provide your answers and calculations on separate

More information

Chemical Ontologies. Chemical Ontologies. ChemAxon UGM May 23, 2012

Chemical Ontologies. Chemical Ontologies. ChemAxon UGM May 23, 2012 Chemical Ontologies ChemAxon UGM May 23, 2012 Chemical Ontologies OntoChem GmbH Heinrich-Damerow-Str. 4 06120 Halle (Saale) Germany Tel. +49 345 4780472 Fax: +49 345 4780471 mail: info(at)ontochem.com

More information

International Journal of Scientific & Engineering Research, Volume 6, Issue 2, February ISSN

International Journal of Scientific & Engineering Research, Volume 6, Issue 2, February ISSN International Journal of Scientific & Engineering Research, Volume 6, Issue 2, February-2015 273 Analogizing And Investigating Some Applications of Metabolic Pathway Analysis Methods Gourav Mukherjee 1,

More information

From networks of protein interactions to networks of functional dependencies

From networks of protein interactions to networks of functional dependencies Luciani and Bazzoni BMC Systems Biology 2012, 6:44 RESEARCH ARTICLE From networks of protein interactions to networks of functional depencies Davide Luciani 1 and Gianfranco Bazzoni 2* Open Access Abstract

More information

Context dependent visualization of protein function

Context dependent visualization of protein function Article III Context dependent visualization of protein function In: Juho Rousu, Samuel Kaski and Esko Ukkonen (eds.). Probabilistic Modeling and Machine Learning in Structural and Systems Biology. 2006,

More information

Map of AP-Aligned Bio-Rad Kits with Learning Objectives

Map of AP-Aligned Bio-Rad Kits with Learning Objectives Map of AP-Aligned Bio-Rad Kits with Learning Objectives Cover more than one AP Biology Big Idea with these AP-aligned Bio-Rad kits. Big Idea 1 Big Idea 2 Big Idea 3 Big Idea 4 ThINQ! pglo Transformation

More information

Miller & Levine Biology 2014

Miller & Levine Biology 2014 A Correlation of Miller & Levine Biology To the Essential Standards for Biology High School Introduction This document demonstrates how meets the North Carolina Essential Standards for Biology, grades

More information

MTopGO: a tool for module identification in PPI Networks

MTopGO: a tool for module identification in PPI Networks MTopGO: a tool for module identification in PPI Networks Danila Vella 1,2, Simone Marini 3,4, Francesca Vitali 5,6,7, Riccardo Bellazzi 1,4 1 Clinical Scientific Institute Maugeri, Pavia, Italy, 2 Department

More information

Range of Competencies

Range of Competencies BIOLOGY Content Domain Range of Competencies l. Nature of Science 0001 0003 20% ll. Biochemistry and Cell Biology 0004 0005 13% lll. Genetics and Evolution 0006 0009 27% lv. Biological Unity and Diversity

More information

Computational Systems Biology

Computational Systems Biology Computational Systems Biology Vasant Honavar Artificial Intelligence Research Laboratory Bioinformatics and Computational Biology Graduate Program Center for Computational Intelligence, Learning, & Discovery

More information