Construc)ng the Tree of Life: Divide-and-Conquer! Tandy Warnow University of Illinois at Urbana-Champaign
|
|
- Mitchell Charles
- 5 years ago
- Views:
Transcription
1 Construc)ng the Tree of Life: Divide-and-Conquer! Tandy Warnow University of Illinois at Urbana-Champaign
2 Phylogeny (evolutionary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website, University of Arizona
3 Phylogenies and Applications Basic Biology: How did life evolve? Applica)ons of phylogenies to: protein structure and func)on popula)on gene)cs human migra)ons metagenomics Figure from hhps://en.wikipedia.org/wiki/common_descent
4 phylogenomics Orangutan Chimpanzee gene 1 gene 2 gene 999 gene 1000 Gorilla Human ACTGCACACCG ACTGC-CCCCG AATGC-CCCCG -CTGCACACGG CTGAGCATCG CTGAGC-TCG ATGAGC-TC- CTGA-CAC-G AGCAGCATCGTG AGCAGC-TCGTG AGCAGC-TC-TG C-TA-CACGGTG CAGGCACGCACGAA AGC-CACGC-CATA ATGGCACGC-C-TA AGCTAC-CACGGAT gene here refers to a portion of the genome (not a functional gene) I ll use the term gene to refer to c-genes : recombination-free orthologous stretches of the genome 2
5 DNA Sequence Evolution AAGGCCT AAGACTT TGGACTT -3 mil yrs -2 mil yrs AGGGCAT TAGCCCT AGCACTT -1 mil yrs AGGGCAT TAGCCCA TAGACTT AGCACAA AGCGCTT today
6 Phylogenetic Tree Estimation U V W X Y AGGGCAT TAGCCCA TAGACTT TGCACAA TGCGCTT U X Y V W
7 However U V W X Y AGGGCATGA AGAT TAGACTT TGCACAA TGCGCTT U X Y V W
8 Indels (insertions and deletions) Deletion Mutation ACGGTGCAGTTACCA ACCAGTCACCA
9 Deletion Substitution ACGGTGCAGTTACCA Insertion ACCAGTCACCTA ACGGTGCAGTTACC-A AC----CAGTCACCTA The true mul*ple alignment Reflects historical substitution, insertion, and deletion events Defined using transitive closure of pairwise alignments computed on edges of the true tree
10 Phylogenetic Tree Estimation S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC S4 = TCACGACCGACA
11 Input: unaligned sequences S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC S4 = TCACGACCGACA
12 Phase 1: Alignment S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC S4 = TCACGACCGACA S1 = -AGGCTATCACCTGACCTCCA S2 = TAG-CTATCAC--GACCGC-- S3 = TAG-CT GACCGC-- S4 = TCAC--GACCGACA
13 Phase 2: Construct tree S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC S4 = TCACGACCGACA S1 = -AGGCTATCACCTGACCTCCA S2 = TAG-CTATCAC--GACCGC-- S3 = TAG-CT GACCGC-- S4 = TCAC--GACCGACA S1 S2 S4 S3
14 Two-phase es)ma)on Alignment methods Clustal POY (and POY*) Probcons (and Probtree) Probalign MAFFT Muscle Di-align T-Coffee Prank (PNAS 2005, Science 2008) Opal (ISMB and Bioinf. 2007) FSA (PLoS Comp. Bio. 2009) Infernal (Bioinf. 2009) Etc. Phylogeny methods Bayesian MCMC Maximum parsimony Maximum likelihood Neighbor joining FastME UPGMA Quartet puzzling Etc.
15 Two-phase es)ma)on Alignment methods Clustal POY (and POY*) Probcons (and Probtree) Probalign MAFFT Muscle Di-align T-Coffee Prank (PNAS 2005, Science 2008) Opal (ISMB and Bioinf. 2007) FSA (PLoS Comp. Bio. 2009) Infernal (Bioinf. 2009) Etc. Phylogeny methods Bayesian MCMC Maximum parsimony Maximum likelihood Neighbor joining FastME UPGMA Quartet puzzling Etc. RAxML: heuris>c for large-scale ML op>miza>on
16 Quan)fying Error FN FN: false negative (missing edge) FP: false positive (incorrect edge) 50% error rate FP
17 1000-taxon models, ordered by difficulty (Liu et al., Science 19 June 2009)
18 Multiple Sequence Alignment (MSA): a scientific grand challenge 1 S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC Sn = TCACGACCGACA S1 = -AGGCTATCACCTGACCTCCA S2 = TAG-CTATCAC--GACCGC-- S3 = TAG-CT GACCGC-- Sn = TCAC--GACCGACA Novel techniques needed for scalability and accuracy NP-hard problems and large datasets Current methods do not provide good accuracy Few methods can analyze even moderately large datasets Many important applications besides phylogenetic estimation 1 Frontiers in Massive Data Analysis, National Academies Press, 2013
19 1KP: Thousand Transcriptome Project G. Ka-Shu Wong U Alberta J. Leebens-Mack U Georgia N. Wickett Northwestern N. Matasci iplant T. Warnow, S. Mirarab, N. Nguyen UT-Austin UT-Austin UT-Austin l First publica)on: WickeH, Mirarab, et al., PNAS, 2014 l Used SATé (Liu et al., Science 2009 and Syst Biol 2012) to compute mul)ple sequence alignments and trees l Used ASTRAL (Mirarab et al., Bioinf 2014 and 2015) to compute the species tree Upcoming Challenge: Mul)ple sequence alignment and gene tree es)ma)on on 100,000 sequences
20 Computa*onal Phylogene*cs (2005) Current methods can use months to estimate trees on 1000 DNA sequences Our objective: More accurate trees and alignments on 500,000 sequences in under a week Courtesy of the Tree of Life web project, tolweb.org
21 Computa*onal Phylogene*cs (2015) : Distance-based phylogenetic tree estimation from polynomial length sequences 2012: Computing accurate trees (almost) without multiple sequence alignments : Co-estimation of multiple sequence alignments and gene trees, now on 1,000,000 sequences in under two weeks : Species tree estimation from whole genomes in the presence of massive gene tree heterogeneity Courtesy of the Tree of Life web project, tolweb.org
22 Computa*onal Phylogene*cs (2015) : Distance-based phylogenetic tree estimation from polynomial length sequences 2012: Computing accurate trees (almost) without multiple sequence alignments : Co-estimation of multiple sequence alignments and gene trees, now on 1,000,000 sequences in under two weeks : Species tree estimation from whole genomes in the presence of massive gene tree heterogeneity Courtesy of the Tree of Life web project, tolweb.org
23 Key technique: Divide-and-conquer! In general, small datasets with not too much heterogeneity are easy to analyze with good accuracy.
24 Divide-and-Conquer Divide-and-conquer is a basic algorithmic trick for solving problems! Three steps: divide a dataset into two or more sets, solve the problem on each set, and combine solu)ons.
25 Sor)ng Objec)ve: sort this list of integers from smallest to largest. 10, 3, 54, 23, 75, 5, 1, 25 should become 1, 3, 5, 10, 23, 25, 54, 75
26 MergeSort Step 1: Divide into two sublists Step 2: Recursively sort each sublist Step 3: Merge the two sorted sublists
27 Step 1: break into two lists X: Y:
28 Step 2: sort the two lists X: Y:
29 Step 3: merge the sorted lists X: Y: Result:
30 Merging (cont.) X: Y: Result: 1
31 Merging (cont.) X: Y: Result: 1 3
32 Merging (cont.) X: Y: Result: 1 3 5
33 Merging (cont.) X: Y: Result:
34 Merging (cont.) X: Y: Result:
35 Merging (cont.) X: Y: Result:
36 Merging (cont.) X: Y: 75 Result:
37 Merging (cont.) X: Y: Result:
38 Multiple Sequence Alignment (MSA): a scientific grand challenge 1 S1 = AGGCTATCACCTGACCTCCA S2 = TAGCTATCACGACCGC S3 = TAGCTGACCGC Sn = TCACGACCGACA S1 = -AGGCTATCACCTGACCTCCA S2 = TAG-CTATCAC--GACCGC-- S3 = TAG-CT GACCGC-- Sn = TCAC--GACCGACA Novel techniques needed for scalability and accuracy NP-hard problems and large datasets Current methods do not provide good accuracy Few methods can analyze even moderately large datasets Many important applications besides phylogenetic estimation 1 Frontiers in Massive Data Analysis, National Academies Press, 2013
39 SATé and PASTA Input: set of unaligned sequences Output: mul)ple sequence alignment and phylogene)c tree SATé: Liu et al., Science 2009 (up to 10,000 sequences) and Systema)c Biology 2012 (up to 50,000 sequences) PASTA: Mirarab et al., J. Comp Biol 2015 (up to 1,000,000 sequences)
40 1000-taxon models, ordered by difficulty (Liu et al., Science 19 June 2009)
41 Re-aligning on a tree A B C D Decompose dataset A C B D Align subproblems A C B D Estimate ML tree on merged alignment ABCD Merge subalignments
42 SATé and PASTA Algorithms Obtain initial alignment and estimated ML tree Tree Use tree to compute new alignment
43 SATé and PASTA Algorithms Obtain initial alignment and estimated ML tree Tree Use tree to compute new alignment Alignment
44 SATé and PASTA Algorithms Obtain initial alignment and estimated ML tree Estimate ML tree on new alignment Tree Use tree to compute new alignment Alignment
45 SATé and PASTA Algorithms Obtain initial alignment and estimated ML tree Estimate ML tree on new alignment Tree Use tree to compute new alignment Alignment Repeat un)l termina)on condi)on, and return the alignment/tree pair with the best ML score
46 SATé: 24-hour co-es*ma*on of highly accurate alignments and trees on 1000 sequences 1000-taxon models, ordered by difficulty (Liu et al., Science 19 June 2009) 24-hour SATé analysis, on desktop machines (Similar improvements for biological datasets)
47 SATé-2: even more accurate! (Liu et al., Syst Biol 61(1):90-106, 2012)
48 PASTA: even more accurate, and can scale to 1,000,000 sequences RNASim 0.20 Tree Error (FN Rate) Clustal Omega Muscle Mafft Starting Tree SATe2 PASTA Reference Alignment Simulated RNASim datasets from 10K to 200K taxa Limited to 24 hours using 12 CPUs Not all methods could run (missing bars could not finish) PASTA, Mirarab et al., J Comp Biol 22(5): (2015)
49 Avian Phylogenomics Project E Jarvis, HHMI MTP Gilbert, Copenhagen G Zhang, BGI T. Warnow UT-Aus)n S. Mirarab Md. S. Bayzid, UT-Aus)n UT-Aus)n First analysis (Jarvis, Mirarab, et al., Science 2014): Plus many many other people Approx. 50 species, 14,000 loci Used SATé for gene sequence alignment and tree es)ma)on Next analysis will have more species, and will use PASTA
50 1KP: Thousand Transcriptome Project G. Ka-Shu Wong U Alberta J. Leebens-Mack U Georgia N. Wickett Northwestern N. Matasci iplant T. Warnow, S. Mirarab, N. Nguyen UT-Austin UT-Austin UT-Austin First analysis (WickeH, Mirarab, et al., PNAS, 2014) About 100 species and 800 loci Used SATé Next analysis will be much larger and more difficult: Mul)ple sequence alignment and gene tree es)ma)on on 100,000 sequences, many datasets highly fragmentary Will use PASTA and UPP (Nguyen et al., Genome Biology 2015)
51 Computa*onal Phylogene*cs (2015) : Distance-based phylogenetic tree estimation from polynomial length sequences 2012: Computing accurate trees (almost) without multiple sequence alignments : Co-estimation of multiple sequence alignments and gene trees, now on 1,000,000 sequences in under two weeks : Species tree estimation from whole genomes in the presence of massive gene tree heterogeneity Courtesy of the Tree of Life web project, tolweb.org
52 Boosters, or Meta-Methods Meta-methods use divide-and-conquer and iteration (or other techniques) to boost the performance of base methods (phylogeny reconstruction, alignment estimation, etc) Base method M Meta-method M*
53 Main Points Innova)ve algorithm design can improve accuracy as well as reduce running *me. Divide-and-conquer is a key algorithmic technique that has drama)cally changed the toolkit for biologists!
54 Acknowledgments Funding: Guggenheim Founda)on, Packard Founda)on, NSF, Microsos Research New England, David Bruton Jr. Centennial Professorship, Grainger Founda)on, and TACC (Texas Advanced Compu)ng Center)
55 Avian Phylogenomics Project E Jarvis, HHMI MTP Gilbert, Copenhagen G Zhang, BGI T. Warnow UT-Aus)n S. Mirarab Md. S. Bayzid, UT-Aus)n UT-Aus)n Jarvis, Mirarab, et al., Science 2014 Major challenge: Plus many many other people Massive gene tree heterogeneity consistent with incomplete lineage sor)ng Very poor resolu)on in the 14,000 gene trees Standard coalescent-based species tree es)ma)on methods had poor accuracy Solu*on: New technique to improve coalescent-based species tree (sta*s*cal binning, Mirarab et al., Science 2014)
CS 581 Algorithmic Computational Genomics. Tandy Warnow University of Illinois at Urbana-Champaign
CS 581 Algorithmic Computational Genomics Tandy Warnow University of Illinois at Urbana-Champaign Today Explain the course Introduce some of the research in this area Describe some open problems Talk about
More informationCS 581 Algorithmic Computational Genomics. Tandy Warnow University of Illinois at Urbana-Champaign
CS 581 Algorithmic Computational Genomics Tandy Warnow University of Illinois at Urbana-Champaign Course Staff Professor Tandy Warnow Office hours Tuesdays after class (2-3 PM) in Siebel 3235 Email address:
More informationMul$ple Sequence Alignment Methods. Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu
Mul$ple Sequence Alignment Methods Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu Species Tree Orangutan Gorilla Chimpanzee Human From the Tree of the Life
More informationSEPP and TIPP for metagenomic analysis. Tandy Warnow Department of Computer Science University of Texas
SEPP and TIPP for metagenomic analysis Tandy Warnow Department of Computer Science University of Texas Phylogeny (evolutionary tree) Orangutan From the Tree of the Life Website, University of Arizona Gorilla
More informationSEPP and TIPP for metagenomic analysis. Tandy Warnow Department of Computer Science University of Texas
SEPP and TIPP for metagenomic analysis Tandy Warnow Department of Computer Science University of Texas Metagenomics: Venter et al., Exploring the Sargasso Sea: Scientists Discover One Million New Genes
More informationCS 581 / BIOE 540: Algorithmic Computa<onal Genomics. Tandy Warnow Departments of Bioengineering and Computer Science hhp://tandy.cs.illinois.
CS 581 / BIOE 540: Algorithmic Computa
More informationPhylogenomics, Multiple Sequence Alignment, and Metagenomics. Tandy Warnow University of Illinois at Urbana-Champaign
Phylogenomics, Multiple Sequence Alignment, and Metagenomics Tandy Warnow University of Illinois at Urbana-Champaign Phylogeny (evolutionary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the
More information394C, October 2, Topics: Mul9ple Sequence Alignment Es9ma9ng Species Trees from Gene Trees
394C, October 2, 2013 Topics: Mul9ple Sequence Alignment Es9ma9ng Species Trees from Gene Trees Mul9ple Sequence Alignment Mul9ple Sequence Alignments and Evolu9onary Histories (the meaning of homologous
More informationCS 394C Algorithms for Computational Biology. Tandy Warnow Spring 2012
CS 394C Algorithms for Computational Biology Tandy Warnow Spring 2012 Biology: 21st Century Science! When the human genome was sequenced seven years ago, scientists knew that most of the major scientific
More informationUltra- large Mul,ple Sequence Alignment
Ultra- large Mul,ple Sequence Alignment Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana- Champaign hep://tandy.cs.illinois.edu Phylogeny (evolu,onary tree) Orangutan
More informationUsing Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics
Using Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana-Champaign http://tandy.cs.illinois.edu
More informationFrom Genes to Genomes and Beyond: a Computational Approach to Evolutionary Analysis. Kevin J. Liu, Ph.D. Rice University Dept. of Computer Science
From Genes to Genomes and Beyond: a Computational Approach to Evolutionary Analysis Kevin J. Liu, Ph.D. Rice University Dept. of Computer Science!1 Adapted from U.S. Department of Energy Genomic Science
More informationFrom Gene Trees to Species Trees. Tandy Warnow The University of Texas at Aus<n
From Gene Trees to Species Trees Tandy Warnow The University of Texas at Aus
More informationConstrained Exact Op1miza1on in Phylogene1cs. Tandy Warnow The University of Illinois at Urbana-Champaign
Constrained Exact Op1miza1on in Phylogene1cs Tandy Warnow The University of Illinois at Urbana-Champaign Phylogeny (evolu1onary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website,
More informationFast coalescent-based branch support using local quartet frequencies
Fast coalescent-based branch support using local quartet frequencies Molecular Biology and Evolution (2016) 33 (7): 1654 68 Erfan Sayyari, Siavash Mirarab University of California, San Diego (ECE) anzee
More informationASTRAL: Fast coalescent-based computation of the species tree topology, branch lengths, and local branch support
ASTRAL: Fast coalescent-based computation of the species tree topology, branch lengths, and local branch support Siavash Mirarab University of California, San Diego Joint work with Tandy Warnow Erfan Sayyari
More informationUpcoming challenges in phylogenomics. Siavash Mirarab University of California, San Diego
Upcoming challenges in phylogenomics Siavash Mirarab University of California, San Diego Gene tree discordance The species tree gene1000 Causes of gene tree discordance include: Incomplete Lineage Sorting
More informationThe Mathema)cs of Es)ma)ng the Tree of Life. Tandy Warnow The University of Illinois
The Mathema)cs of Es)ma)ng the Tree of Life Tandy Warnow The University of Illinois Phylogeny (evolu9onary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website, University of Arizona
More informationReconstruction of species trees from gene trees using ASTRAL. Siavash Mirarab University of California, San Diego (ECE)
Reconstruction of species trees from gene trees using ASTRAL Siavash Mirarab University of California, San Diego (ECE) Phylogenomics Orangutan Chimpanzee gene 1 gene 2 gene 999 gene 1000 Gorilla Human
More informationComputa(onal Challenges in Construc(ng the Tree of Life
Computa(onal Challenges in Construc(ng the Tree of Life Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana-Champaign h?p://tandy.cs.illinois.edu Phylogeny (evolueonary tree)
More informationNJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees Erin Molloy and Tandy Warnow {emolloy2, warnow}@illinois.edu University of Illinois at Urbana
More informationNew methods for es-ma-ng species trees from genome-scale data. Tandy Warnow The University of Illinois
New methods for es-ma-ng species trees from genome-scale data Tandy Warnow The University of Illinois Phylogeny (evolu9onary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website,
More informationGenome-scale Es-ma-on of the Tree of Life. Tandy Warnow The University of Illinois
Genome-scale Es-ma-on of the Tree of Life Tandy Warnow The University of Illinois Phylogeny (evolu9onary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website, University of Arizona
More informationInDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
More informationGenome-scale Es-ma-on of the Tree of Life. Tandy Warnow The University of Illinois
WABI 2017 Factsheet 55 proceedings paper submissions, 27 accepted (49% acceptance rate) 9 additional poster-only submissions (+8 posters accompanying papers) 56 PC members Each paper reviewed by at least
More informationPhylogenetic Geometry
Phylogenetic Geometry Ruth Davidson University of Illinois Urbana-Champaign Department of Mathematics Mathematics and Statistics Seminar Washington State University-Vancouver September 26, 2016 Phylogenies
More informationfirst (i.e., weaker) sense of the term, using a variety of algorithmic approaches. For example, some methods (e.g., *BEAST 20) co-estimate gene trees
Concatenation Analyses in the Presence of Incomplete Lineage Sorting May 22, 2015 Tree of Life Tandy Warnow Warnow T. Concatenation Analyses in the Presence of Incomplete Lineage Sorting.. 2015 May 22.
More informationCS 394C March 21, Tandy Warnow Department of Computer Sciences University of Texas at Austin
CS 394C March 21, 2012 Tandy Warnow Department of Computer Sciences University of Texas at Austin Phylogeny From the Tree of the Life Website, University of Arizona Orangutan Gorilla Chimpanzee Human Phylogeny
More informationPhylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
More informationPhylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
More informationTHEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
More informationEstimating Evolutionary Trees. Phylogenetic Methods
Estimating Evolutionary Trees v if the data are consistent with infinite sites then all methods should yield the same tree v it gets more complicated when there is homoplasy, i.e., parallel or convergent
More informationAnatomy of a species tree
Anatomy of a species tree T 1 Size of current and ancestral Populations (N) N Confidence in branches of species tree t/2n = 1 coalescent unit T 2 Branch lengths and divergence times of species & populations
More informationRecent Advances in Phylogeny Reconstruction
Recent Advances in Phylogeny Reconstruction from Gene-Order Data Bernard M.E. Moret Department of Computer Science University of New Mexico Albuquerque, NM 87131 Department Colloqium p.1/41 Collaborators
More informationParameter Es*ma*on: Cracking Incomplete Data
Parameter Es*ma*on: Cracking Incomplete Data Khaled S. Refaat Collaborators: Arthur Choi and Adnan Darwiche Agenda Learning Graphical Models Complete vs. Incomplete Data Exploi*ng Data for Decomposi*on
More informationTheDisk-Covering MethodforTree Reconstruction
TheDisk-Covering MethodforTree Reconstruction Daniel Huson PACM, Princeton University Bonn, 1998 1 Copyright (c) 2008 Daniel Huson. Permission is granted to copy, distribute and/or modify this document
More informationBioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
More informationCSCI1950 Z Computa4onal Methods for Biology Lecture 4. Ben Raphael February 2, hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary
CSCI1950 Z Computa4onal Methods for Biology Lecture 4 Ben Raphael February 2, 2009 hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary Parsimony Probabilis4c Method Input Output Sankoff s & Fitch
More informationWoods Hole brief primer on Multiple Sequence Alignment presented by Mark Holder
Woods Hole 2014 - brief primer on Multiple Sequence Alignment presented by Mark Holder Many forms of sequence alignment are used in bioinformatics: Structural Alignment Local alignments Global, evolutionary
More informationPhylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
More informationComputational Challenges in Constructing the Tree of Life
Computational Challenges in Constructing the Tree of Life Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana-Champaign http://tandy.cs.illinois.edu Warnow Lab (PhD students)
More informationBIOINFORMATICS. Scaling Up Accurate Phylogenetic Reconstruction from Gene-Order Data. Jijun Tang 1 and Bernard M.E. Moret 1
BIOINFORMATICS Vol. 1 no. 1 2003 Pages 1 8 Scaling Up Accurate Phylogenetic Reconstruction from Gene-Order Data Jijun Tang 1 and Bernard M.E. Moret 1 1 Department of Computer Science, University of New
More informationEVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
More informationCSCI1950 Z Computa4onal Methods for Biology Lecture 5
CSCI1950 Z Computa4onal Methods for Biology Lecture 5 Ben Raphael February 6, 2009 hip://cs.brown.edu/courses/csci1950 z/ Alignment vs. Distance Matrix Mouse: ACAGTGACGCCACACACGT Gorilla: CCTGCGACGTAACAAACGC
More informationCREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
More informationTaming the Beast Workshop
Workshop and Chi Zhang June 28, 2016 1 / 19 Species tree Species tree the phylogeny representing the relationships among a group of species Figure adapted from [Rogers and Gibbs, 2014] Gene tree the phylogeny
More informationGene Regulatory Networks II Computa.onal Genomics Seyoung Kim
Gene Regulatory Networks II 02-710 Computa.onal Genomics Seyoung Kim Goal: Discover Structure and Func;on of Complex systems in the Cell Identify the different regulators and their target genes that are
More informationEvolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between
More informationPhylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki
Phylogene)cs IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, 2016 Joyce Nzioki Phylogenetics The study of evolutionary relatedness of organisms. Derived from two Greek words:» Phle/Phylon: Tribe/Race» Genetikos:
More informationQuantifying sequence similarity
Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity
More information7. Tests for selection
Sequence analysis and genomics 7. Tests for selection Dr. Katja Nowick Group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute for Brain Research www. nowicklab.info
More information9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
More informationCSCI1950 Z Computa3onal Methods for Biology Lecture 24. Ben Raphael April 29, hgp://cs.brown.edu/courses/csci1950 z/ Network Mo3fs
CSCI1950 Z Computa3onal Methods for Biology Lecture 24 Ben Raphael April 29, 2009 hgp://cs.brown.edu/courses/csci1950 z/ Network Mo3fs Subnetworks with more occurrences than expected by chance. How to
More informationPhylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
More informationPhylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
More informationUsing phylogenetics to estimate species divergence times... Basics and basic issues for Bayesian inference of divergence times (plus some digression)
Using phylogenetics to estimate species divergence times... More accurately... Basics and basic issues for Bayesian inference of divergence times (plus some digression) "A comparison of the structures
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationEvolu&on, Popula&on Gene&cs, and Natural Selec&on Computa.onal Genomics Seyoung Kim
Evolu&on, Popula&on Gene&cs, and Natural Selec&on 02-710 Computa.onal Genomics Seyoung Kim Phylogeny of Mammals Phylogene&cs vs. Popula&on Gene&cs Phylogene.cs Assumes a single correct species phylogeny
More information2018 Phylogenomics Software Symposium Institut des Sciences de l Evolution - Montpellier August 17, 2018 Abstracts
2018 Phylogenomics Software Symposium Institut des Sciences de l Evolution - Montpellier August 17, 2018 Abstracts Dominic J. Bennett Title: supersmartr: Towards a modular pipeline for phylogenetic tree
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
More information5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT
5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT.03.239 03.10.2012 ALIGNMENT Alignment is the task of locating equivalent regions of two or more sequences to maximize their similarity. Homology:
More informationMathematics of Evolution and Phylogeny. Edited by Olivier Gascuel
Mathematics of Evolution and Phylogeny Edited by Olivier Gascuel CLARENDON PRESS. OXFORD 2004 iv CONTENTS 12 Reconstructing Phylogenies from Gene-Content and Gene-Order Data 1 12.1 Introduction: Phylogenies
More informationA Phylogenetic Network Construction due to Constrained Recombination
A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer
More informationAmira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
More informationPlan: Evolutionary trees, characters. Perfect phylogeny Methods: NJ, parsimony, max likelihood, Quartet method
Phylogeny 1 Plan: Phylogeny is an important subject. We have 2.5 hours. So I will teach all the concepts via one example of a chain letter evolution. The concepts we will discuss include: Evolutionary
More informationOn the variance of internode distance under the multispecies coalescent
On the variance of internode distance under the multispecies coalescent Sébastien Roch 1[0000 000 7608 8550 Department of Mathematics University of Wisconsin Madison Madison, WI 53706 roch@math.wisc.edu
More informationDr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
More informationThe impact of missing data on species tree estimation
MBE Advance Access published November 2, 215 The impact of missing data on species tree estimation Zhenxiang Xi, 1 Liang Liu, 2,3 and Charles C. Davis*,1 1 Department of Organismic and Evolutionary Biology,
More informationThe statistical and informatics challenges posed by ascertainment biases in phylogenetic data collection
The statistical and informatics challenges posed by ascertainment biases in phylogenetic data collection Mark T. Holder and Jordan M. Koch Department of Ecology and Evolutionary Biology, University of
More informationHow to read and make phylogenetic trees Zuzana Starostová
How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation
More informationPhylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
More informationInferring Phylogenetic Trees. Distance Approaches. Representing distances. in rooted and unrooted trees. The distance approach to phylogenies
Inferring Phylogenetic Trees Distance Approaches Representing distances in rooted and unrooted trees The distance approach to phylogenies given: an n n matrix M where M ij is the distance between taxa
More informationA (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
More informationMULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE
MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE Manmeet Kaur 1, Navneet Kaur Bawa 2 1 M-tech research scholar (CSE Dept) ACET, Manawala,Asr 2 Associate Professor (CSE Dept) ACET, Manawala,Asr
More informationHidden Markov models in population genetics and evolutionary biology
Hidden Markov models in population genetics and evolutionary biology Gerton Lunter Wellcome Trust Centre for Human Genetics Oxford, UK April 29, 2013 Topics for today Markov chains Hidden Markov models
More informationCSCI1950 Z Computa3onal Methods for Biology* (*Working Title) Lecture 1. Ben Raphael January 21, Course Par3culars
CSCI1950 Z Computa3onal Methods for Biology* (*Working Title) Lecture 1 Ben Raphael January 21, 2009 Course Par3culars Three major topics 1. Phylogeny: ~50% lectures 2. Func3onal Genomics: ~25% lectures
More informationPOPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
More informationPhylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 03: Edit distance and sequence alignment Slides adapted from Dr. Shaojie Zhang (University of Central Florida) KUMC visit How many of you would like to attend
More informationComputational methods for predicting protein-protein interactions
Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational
More informationIsolating - A New Resampling Method for Gene Order Data
Isolating - A New Resampling Method for Gene Order Data Jian Shi, William Arndt, Fei Hu and Jijun Tang Abstract The purpose of using resampling methods on phylogenetic data is to estimate the confidence
More informationMoreover, the circular logic
Moreover, the circular logic How do we know what is the right distance without a good alignment? And how do we construct a good alignment without knowing what substitutions were made previously? ATGCGT--GCAAGT
More informationBINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
More informationWhat is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
More informationPhylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches
Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell
More informationSTEM-hy: Species Tree Estimation using Maximum likelihood (with hybridization)
STEM-hy: Species Tree Estimation using Maximum likelihood (with hybridization) Laura Salter Kubatko Departments of Statistics and Evolution, Ecology, and Organismal Biology The Ohio State University kubatko.2@osu.edu
More informationPhylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
More informationUsing Phylogenomics to Predict Novel Fungal Pathogenicity Genes
Using Phylogenomics to Predict Novel Fungal Pathogenicity Genes David DeCaprio, Ying Li, Hung Nguyen (sequenced Ascomycetes genomes courtesy of the Broad Institute) Phylogenomics Combining whole genome
More informationOrganisatorische Details
Organisatorische Details Vorlesung: Di 13-14, Do 10-12 in DI 205 Übungen: Do 16:15-18:00 Laborraum Schanzenstrasse Vorwiegend Programmieren in Matlab/Octave Teilnahme freiwillig. Übungsblätter jeweils
More informationTools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2015 Week-4 BLAST Algorithm Continued Multiple Sequence Alignment Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and
More informationComparison of Cost Functions in Sequence Alignment. Ryan Healey
Comparison of Cost Functions in Sequence Alignment Ryan Healey Use of Cost Functions Used to score and align sequences Mathematically model how sequences mutate and evolve. Evolution and mutation can be
More informationPhylogenetic hypotheses and the utility of multiple sequence alignment
Phylogenetic hypotheses and the utility of multiple sequence alignment Ward C. Wheeler 1 and Gonzalo Giribet 2 1 Division of Invertebrate Zoology, American Museum of Natural History Central Park West at
More informationEffects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
More informationUsing algebraic geometry for phylogenetic reconstruction
Using algebraic geometry for phylogenetic reconstruction Marta Casanellas i Rius (joint work with Jesús Fernández-Sánchez) Departament de Matemàtica Aplicada I Universitat Politècnica de Catalunya IMA
More informationWorkshop III: Evolutionary Genomics
Identifying Species Trees from Gene Trees Elizabeth S. Allman University of Alaska IPAM Los Angeles, CA November 17, 2011 Workshop III: Evolutionary Genomics Collaborators The work in today s talk is joint
More informationAdditive distances. w(e), where P ij is the path in T from i to j. Then the matrix [D ij ] is said to be additive.
Additive distances Let T be a tree on leaf set S and let w : E R + be an edge-weighting of T, and assume T has no nodes of degree two. Let D ij = e P ij w(e), where P ij is the path in T from i to j. Then
More informationPhylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying
More informationToday's project. Test input data Six alignments (from six independent markers) of Curcuma species
DNA sequences II Analyses of multiple sequence data datasets, incongruence tests, gene trees vs. species tree reconstruction, networks, detection of hybrid species DNA sequences II Test of congruence of
More informationSmith et al. American Journal of Botany 98(3): Data Supplement S2 page 1
Smith et al. American Journal of Botany 98(3):404-414. 2011. Data Supplement S1 page 1 Smith, Stephen A., Jeremy M. Beaulieu, Alexandros Stamatakis, and Michael J. Donoghue. 2011. Understanding angiosperm
More informationCONTENTS. P A R T I Genomes 1. P A R T II Gene Transcription and Regulation 109
CONTENTS ix Preface xv Acknowledgments xxi Editors and contributors xxiv A computational micro primer xxvi P A R T I Genomes 1 1 Identifying the genetic basis of disease 3 Vineet Bafna 2 Pattern identification
More information