Reconstruction of species trees from gene trees using ASTRAL. Siavash Mirarab University of California, San Diego (ECE)
|
|
- Rodney Elliott
- 5 years ago
- Views:
Transcription
1 Reconstruction of species trees from gene trees using ASTRAL Siavash Mirarab University of California, San Diego (ECE)
2 Phylogenomics Orangutan Chimpanzee gene 1 gene 2 gene 999 gene 1000 Gorilla Human ACTGCACACCG ACTGC-CCCCG AATGC-CCCCG -CTGCACACGG CTGAGCATCG CTGAGC-TCG ATGAGC-TC- CTGA-CAC-G AGCAGCATCGTG AGCAGC-TCGTG AGCAGC-TC-TG C-TA-CACGGTG CAGGCACGCACGAA AGC-CACGC-CATA ATGGCACGC-C-TA AGCTAC-CACGGAT Inference error gene here refers to a portion of the genome (not a functional gene) More data (#genes) 2
3 Gene tree discordance gene 1 gene1000 Gorilla Human Chimp Orang. Gorilla Chimp Human Orang. 3
4 Gene tree discordance The species tree gene 1 gene1000 Gorilla Human Chimp Orangutan Gorilla Human Chimp Orang. Gorilla Chimp Human Orang. A gene tree 3
5 Gene tree discordance The species tree gene 1 gene1000 Gorilla Human Chimp Orangutan Gorilla Human Chimp Orang. Gorilla Chimp Human Orang. A gene tree Causes of gene tree discordance include: Incomplete Lineage Sorting (ILS) Duplication and loss Horizontal Gene Transfer (HGT) 3
6 Incomplete Lineage Sorting (ILS) A random process related to the coalescence of alleles across various populations Tracing alleles through generations 4
7 Incomplete Lineage Sorting (ILS) A random process related to the coalescence of alleles across various populations Tracing alleles through generations 4
8 Incomplete Lineage Sorting (ILS) A random process related to the coalescence of alleles across various populations Tracing alleles through generations Omnipresent: possible for every tree Likely for short branches or large population sizes 4
9 MSC and Identifiability The statistical process multi-species coalescent (MSC) is used to model ILS. 5
10 MSC and Identifiability The statistical process multi-species coalescent (MSC) is used to model ILS. Any species tree defines a unique distribution on the set of all possible gene trees 5
11 MSC and Identifiability The statistical process multi-species coalescent (MSC) is used to model ILS. Any species tree defines a unique distribution on the set of all possible gene trees In principle, the species tree can be identified despite high discordance from the gene tree distribution 5
12 Multi-gene tree estimation pipelines gene 1 ACTGCACACCG ACTGC-CCCCG AATGC-CCCCG -CTGCACACGG gene 1 supermatrix ACTGCACACCG CTGAGCATCG ACTGC-CCCCG CTGAGC-TCG AATGC-CCCCG ATGAGC-TC- -CTGCACACGGCTGA-CAC-G gene 2 gene 1000 Approach 1: Concatenation Orangutan CAGAGCACGCACGAA AGCA-CACGC-CATA ATGAGCACGC-C-TA AGC-TAC-CACGGAT Phylogeny inference Gorilla Chimpanzee Human gene 2 CTGAGCATCG CTGAGC-TCG ATGAGC-TC- CTGA-CAC-G Gene tree estimation Approach 2: Summary methods Chimp Gorilla gene 1000 CAGGCACGCACGAA AGC-CACGC-CATA ATGGCACGC-C-TA AGCTAC-CACGGAT gene 1 gene 2 gene 1000 Human Gorilla Human Orang. Human Orang. Chimp Orang. Chimp Gorilla Summary method Orangutan Gorilla Chimpanzee Human There are also other very good approaches: co-estimation (e.g., *BEAST), site-based (e.g., SVDQuartets, SNAPP) 6
13 Multi-gene tree estimation pipelines gene 1 ACTGCACACCG ACTGC-CCCCG AATGC-CCCCG -CTGCACACGG gene 2 CTGAGCATCG CTGAGC-TCG ATGAGC-TC- CTGA-CAC-G gene 1 supermatrix ACTGCACACCG CTGAGCATCG ACTGC-CCCCG CTGAGC-TCG AATGC-CCCCG ATGAGC-TC- -CTGCACACGGCTGA-CAC-G gene 2 gene 1000 Gene tree estimation Approach 1: Concatenation Orangutan CAGAGCACGCACGAA AGCA-CACGC-CATA ATGAGCACGC-C-TA AGC-TAC-CACGGAT Phylogeny inference Approach 2: Summary methods Gorilla Chimpanzee Statistically inconsistent [Roch and Steel, 2014] Human Chimp Gorilla Error gene 1000 CAGGCACGCACGAA AGC-CACGC-CATA ATGGCACGC-C-TA AGCTAC-CACGGAT gene 1 gene 2 gene 1000 Human Gorilla Human Orang. Human Orang. Chimp Orang. Chimp Gorilla Summary method Orangutan Gorilla Chimpanzee Human Data Can be statistically consistent given true gene trees Error-free gene trees 6
14 Multi-gene tree estimation pipelines Error gene 1 ACTGCACACCG ACTGC-CCCCG AATGC-CCCCG -CTGCACACGG gene 2 CTGAGCATCG CTGAGC-TCG ATGAGC-TC- CTGA-CAC-G gene 1000 CAGGCACGCACGAA AGC-CACGC-CATA ATGGCACGC-C-TA AGCTAC-CACGGAT gene 1 ACTGCACACCG CTGAGCATCG ACTGC-CCCCG CTGAGC-TCG AATGC-CCCCG ATGAGC-TC- -CTGCACACGGCTGA-CAC-G gene 1 supermatrix gene 2 gene 1000 Gene tree estimation Chimp Approach 1: Concatenation Orangutan CAGAGCACGCACGAA AGCA-CACGC-CATA ATGAGCACGC-C-TA AGC-TAC-CACGGAT Gorilla Approach 2: Summary methods Summary method Phylogeny inference Gorilla Orangutan Human Orang. BUCKy (population tree), Gorilla Chimp gene 2 MP-EST, NJst (ASTRID), Human Orang. Gorilla Chimpanzee Statistically inconsistent [Roch and Steel, 2014] STAR, STELLS, GLASS, Human Chimpanzee Human ASTRAL, Orang. ASTRAL-II, ASTRAL-III Chimp gene 1000 Human Gorilla Data Can be statistically consistent given true gene trees Error-free gene trees 6
15 ASTRAL used by the biologists Plants: Wickett, et al., 2014, PNAS Birds: Prum, et al., 2015, Nature Xenoturbella, Cannon et al., 2016, Nature Xenoturbella, Rouse et al., 2016, Nature Flatworms: Laumer, et al., 2015, elife Shrews: Giarla, et al., 2015, Syst. Bio. Frogs: Yuan et al., 2016, Syst. Bio. Tomatoes: Pease, et al., 2016, PLoS Bio. ASTRAL-II ASTRAL Angiosperms: Huang et al., 2016, MBE Worms: Andrade, et al., 2015, MBE
16 This talk: ASTRAL Outlines of the method Accuracy in simulation studies With strong model violations The impact of Fragmentary sequence data Sampling multiple individuals Visualization 8
17 Unrooted quartets under MSC model For a quartet (4 species), the unrooted species tree topology has at least 1/3 probability in gene trees (Allman, et al. 2010) Chimp Gorilla θ 1 =70% θ 2 =15% θ 3 =15% d=0.8 Chimp Gorilla Orang. Chimp Gorilla Chimp Human Orang. Human Orang. Human Gorilla Human Orang. 9
18 Unrooted quartets under MSC model For a quartet (4 species), the unrooted species tree topology has at least 1/3 probability in gene trees (Allman, et al. 2010) Chimp Gorilla θ 1 =70% θ 2 =15% θ 3 =15% d=0.8 Chimp Gorilla Orang. Chimp Gorilla Chimp Human Orang. Human Orang. Human Gorilla Human Orang. The most frequent gene tree = The most likely species tree 9
19 Unrooted quartets under MSC model For a quartet (4 species), the unrooted species tree topology has at least 1/3 probability in gene trees (Allman, et al. 2010) Chimp Gorilla θ 1 =70% θ 2 =15% θ 3 =15% d=0.8 Chimp Gorilla Orang. Chimp Gorilla Chimp Human Orang. Human Orang. Human Gorilla Human Orang. The most frequent gene tree = The most likely species tree shorter branches more discordance a harder species tree reconstruction problem 9
20 More than 4 species For >4 species, the species tree topology can be different from the most like gene tree (called anomaly zone) (Degnan, 2013) Gorilla Human Chimp Orang. Rhesus 10
21 More than 4 species For >4 species, the species tree topology can be different from the most like gene tree (called anomaly zone) (Degnan, 2013) Gorilla Human Chimp Orang. Rhesus 1. Break gene trees into ( n 4 ) quartets of species 2. Find the dominant tree for all quartets of taxa 3. Combine quartet trees Some tools (e.g.. BUCKy-p [Larget, et al., 2010]) 10
22 More than 4 species For >4 species, the species tree topology can be different from the most like gene tree (called anomaly zone) (Degnan, 2013) Gorilla Human Chimp Orang. Rhesus Alternative: 1. Break gene trees into ( n 4 ) quartets of species weight all 3( n 4 ) quartet topologies 2. Find the dominant tree for all quartets of taxa by their frequency and find the optimal tree 3. Combine quartet trees Some tools (e.g.. BUCKy-p [Larget, et al., 2010]) 10
23 Maximum Quartet Support Species Tree Optimization problem: Find the species tree with the maximum number of induced quartet trees shared with the collection of input gene trees Score(T )= mx Q(T ) \ Q(t i ) 1 the set of quartet trees induced by T a gene tree 11
24 Maximum Quartet Support Species Tree Optimization problem: Find the species tree with the maximum number of induced quartet trees shared with the collection of input gene trees Score(T )= mx Q(T ) \ Q(t i ) 1 the set of quartet trees induced by T a gene tree Theorem: Statistically consistent under the multispecies coalescent model when solved exactly 11
25 ASTRAL-I and ASTRAL-II [Mirarab, et al., Bioinformatics, 2014] [Mirarab and Warnow, Bioinformatics, 2015] Solve the problem exactly using dynamic programming Constrains the search space to make large datasets feasible The constrained version remains statistically consistent Running time: polynomially increases with the number of genes and the number of species 12
26 ASTRAL-I and ASTRAL-II [Mirarab, et al., Bioinformatics, 2014] [Mirarab and Warnow, Bioinformatics, 2015] Solve the problem exactly using dynamic programming Constrains the search space to make large datasets feasible The constrained version remains statistically consistent Running time: polynomially increases with the number of genes and the number of species ASTRAL-II: Increased the search space Improved the running time Can handle polytomies (lack of resolution) in input gene trees 12
27 Simulation study True (model) species tree True gene trees Sequence data Finch Falcon Owl Eagle Pigeon Finch Owl Falcon Eagle Pigeon Es mated species tree Es mated gene trees 13
28 Simulation study True (model) species tree True gene trees Sequence data Finch Falcon Owl Eagle Pigeon Finch Owl Falcon Eagle Pigeon Es mated species tree Es mated gene trees Evaluate using the FN rate: the percentage of branches in the true tree that are missing from the estimated tree 13
29 Number of species impacts estimation error in the species tree 1000 genes, medium levels of ILS, simulated species trees [S. Mirarab, T. Warnow, 2015] 14
30 ASTRAL: accurate and scalable Species tree topological error (FN) 16% 12% 8% 4% ASTRAL II MP EST genes, medium levels of ILS, simulated species trees [S. Mirarab, T. Warnow, 2015] 15
31 ASTRAL: accurate and scalable Species tree topological error (FN) 16% 12% 8% 4% ASTRAL II MP EST number of species 1000 genes, medium levels of ILS, simulated species trees [S. Mirarab, T. Warnow, 2015] 15
32 Comparison to concatenation: depends on the ILS level 30% 1000 genes 200 genes 50 genes Species tree topological error (FN) 20% 10% ASTRAL II NJst CA ML 0% L M H L M H L M H 10M 2M 500K 10M 2M 500K 10M 2M 500K tree length (controls the amount of ILS) more ILS more ILS more ILS 200 species, recent ILS 16
33 Comparison to concatenation: depends on the ILS level 30% 1000 genes 200 genes 50 genes Species tree topological error (FN) 20% 10% ASTRAL II NJst CA ML 0% L M H L M H L M H 10M 2M 500K 10M 2M 500K 10M 2M 500K tree length (controls the amount of ILS) more ILS more ILS more ILS 200 species, recent ILS 16
34 Horizontal Gene Transfer (HGT) [R. Davidson et al., BMC Genomics. 16 (2015)] Model violation: the simulated discordance is due to both ILS and randomly distributed HGT ~30% discordance ~35% ~55% ~70% 50 species, 10 genes
35 Horizontal Gene Transfer (HGT) [R. Davidson et al., BMC Genomics. 16 (2015)] Randomly distributed HGT is tolerated with enough genes # genes 50 species, varying # genes ~30% discordance ~55% ~35% ~70%
36 UCSD Work 1. Statistical support 2. ASTRAL-III Better running time GPU and CPU Parallelism Multi-Individual datasets 3. Impact of fragmentary data 19
37 Branch support Traditional approach: Multi-locus bootstrapping (MLBS) Slow: requires bootstrapping all genes (e.g., 100 m ML trees) Inaccurate and hard to interpret [Mirarab et al., Sys bio, 2014; Bayzid et al., PLoS One, 2015] We can do better! 20 [Mirarab et al., Sys bio, 2014]
38 Local posterior probability Recall quartet frequencies follow a multinomial distribution m 1 = 80 m 2 = 63 m 3 = 57 Chimp Gorilla Orang. Chimp Gorilla Chimp Human θ 1 Orang. Human Gorilla Human θ 2 θ 3 Orang. P ( topology seen in m 1 / m gene trees is the species tree ) = P ( θ 1 > 1/3 ) 21
39 Local posterior probability Recall quartet frequencies follow a multinomial distribution m 1 = 80 m 2 = 63 m 3 = 57 Chimp Gorilla Orang. Chimp Gorilla Chimp Human Orang. Gorilla Human Orang. P ( topology seen in m 1 / m gene trees is the species tree ) = P ( θ 1 > 1/3 ) θ 1 Human Can be analytically solved θ 2 θ 3 We implemented this idea in astral and called the measure the local posterior probability (localpp) 21
40 Quartet support v.s. localpp quartet frequency Increased number of genes (m) increased support Decreased discordance increased support 22
41 localpp is more accurate than bootstrapping 1.00 MLBS Local PP Recall X faster False Positive Rate Avian simulated dataset (48 taxa, 1000 genes) [Sayyari and Mirarab, MBE, 2016] 23
42 ASTRAL can also estimate internal branch lengths estimated branch length (log scale) True gene trees true branch length (log scale) With true gene trees, ASTRAL correctly estimates BL 24
43 ASTRAL can also estimate internal branch lengths estimated branch length (log scale) low gene tree error Medium g.t. error Moderate g.t. error True gene trees High gene tree error true branch length (log scale) With error-prone With true estimated gene trees, gene ASTRAL trees, correctly ASTRAL estimates underestimates BL BL 24
44 ASTRAL-III and beyond (unpublished work) Maryam Rabiee Hashemi John Yin 25 Chao Zhang
45 ASTRAL-III Chao Zhang Improved running time (to be released in July) Can handle polytomies without slowing down Can exploit similarities between gene trees to reduce running time 26
46 ASTRAL-III Chao Zhang Improved running time (to be released in July) Can handle polytomies without slowing down Can exploit similarities between gene trees to reduce running time To be released in August Handling datasets with multiple individuals per species GPU and CPU parallelism 26
47 Low support branches Does it help to contract branches with low support? Yes, but only for 1000 very low supports 16% Mean GT error Low (<50%) Theoretical justifications not clear Species tree error (FN ratio) 12% 8% High (>50%) Simulations: 100 taxa, simphy, ILS: around 46% true discordance FastTree, support from bootstrapping 4% non contraction threshold 27
48 Low support branches Does it help to contract branches with low support? Yes, but only for very low supports 25% 16% Mean GT error Low (<50%) Theoretical justifications not clear Species tree error (FN ratio) 20% 12% 15% 8% 10% High (>50%) Simulations: 100 taxa, simphy, ILS: around 46% true discordance FastTree, support from bootstrapping 4% non contraction threshold 27
49 Multiple individuals Maryam Rabiee Hashemi What if we sample multiple individuals from each species? In recently diverged species individuals may have different trees for each gene Sampling multiple individuals may provide extra signal 28
50 Multiple individuals helpful? Species tree error (RF distance) ind. 2 ind. 5 ind. Variable effort 500 genes; 200 species Fixed effort genes x inds = 1000; 200 species Fixed effort 500 genes; species x inds = 200 Yes, it marginally helps accuracy 29
51 Multiple individuals helpful? Species tree error (RF distance) ind. 2 ind. 5 ind. Variable effort 500 genes; 200 species Fixed effort genes x inds = 1000; 200 species Fixed effort 500 genes; species x inds = 200 Yes, it marginally helps accuracy But not if sequencing effort is kept fixed 29
52 Multiple individuals helpful? Species tree error (RF distance) ind. 2 ind. 5 ind. Variable effort 500 genes; 200 species Fixed effort genes x inds = 1000; 200 species Fixed effort 500 genes; species x inds = 200 Yes, it marginally helps accuracy But not if sequencing effort is kept fixed 29
53 Parallelism 25 John Yin GPU (1000 species) 20 GPU (500 species) 15 Speed up species 500 species # CPU cores (comet) Can infer trees with 10,000 species & 400 genes in a day 30
54 Impact of fragmentary data Erfan Sayyari James B. Whitfield 31
55 Two types of missing data Missing genes: a taxon misses the gene fully (taxon occupancy) Figure from Hosner et al, 2016 Fragmentary data: the species is partially sequenced for some genes 32
56 Does missing data matter? Missing genes: Evidence suggests summary methods are often robust 33
57 Does missing data matter? Missing genes: Evidence suggests summary methods are often robust Fragmentary data: Less extensively studied Hosner et al. indicated: Fragments matter They suggest removing genes with many fragments 33
58 Our study Empirical data: An insect dataset of 144 species and 1478 genes 600 million years of evolution Transcriptomics, so plenty of missing data of both types Simulated data: 100 taxon, medium ILS, 1000 genes Added fragmentation with patterns similar to the insect data 34
59 Fragmentary data hurt gene trees and species trees 1.00 Gene tree error NRF Distance Species tree error: 2.8% error 0.25 no filtering orig seq with fragments Filtering method without fragments 35
60 Fragmentary data hurt gene trees and species trees 1.00 Fragmentary data dramatically increase gene tree and the species tree error Gene tree error NRF Distance Species tree error: 7.0% error Species tree error: 2.8% error 0.25 no filtering orig seq with fragments Filtering method without fragments 35
61 How do we solve this? Hosner et al. suggested removing entire genes. This is too conservative in our opinion. 36
62 How do we solve this? Hosner et al. suggested removing entire genes. This is too conservative in our opinion. We simply remove the fragmentary sequence from the gene and keep the rest of the gene What is fragmentary? Anything that has at most X% of sites We study different X values 36
63 Filtering helps to some level (simulations) FastTree RAxML 0.6 NRF Distance no filtering orig seq Filtering method Gene tree error 37
64 Filtering helps to some level (simulations) FastTree RAxML 0.06 NRF Distance no filtering orig seq Filtering method no-filter Gene tree error Species tree error 37
65 Filtering helps to some level (simulations) FastTree RAxML 0.06 NRF Distance Novel results: RAxML is much better than 0.04 FastTree 0.03 no filtering orig seq Filtering method no-filter Gene tree error Species tree error 37
66 How about real data? 38
67 Gene trees seem to improve (less gene tree discordance) % filtering Proportion of relevant gene trees no-filtering Diptera Mecoptera Siphonaptera Lepidoptera Trichoptera Coleoptera Strepsiptera Neuropterida Hymenoptera Psocodea Hemiptera Thysanoptera Blattodea Mantodea Grylloblattodea Orthoptera Phasmida Embiidina Plecoptera Dermaptera Ephemeroptera Odonata Thysanura Archaeognatha Diplura Collembola Important Ingroup A B C B/C D D/B/C E F G H I J K L M N P Strongly Supported Weakly Supported Weakly Reject Strongly Reject 39
68 Gene trees seem to improve (less gene tree discordance) % filtering Proportion of relevant gene trees no-filtering Diptera Mecoptera Siphonaptera Lepidoptera Trichoptera Coleoptera Strepsiptera Neuropterida Hymenoptera Psocodea Hemiptera Thysanoptera Blattodea Mantodea Grylloblattodea Orthoptera Phasmida Embiidina Plecoptera Dermaptera Ephemeroptera Odonata Thysanura Archaeognatha Diplura Collembola Important Ingroup A B C B/C D D/B/C E F G H I J K L M N P Strongly Supported Weakly Supported Weakly Reject Strongly Reject 39
69 The species tree also improves ASTRAL trees differed with concatenation initially Ingroup A B C B/C D D/B/C After filtering, ASTRAL and concatenation were very similar E F G H I J K L Differences on controversial nodes M N P no-filtering no-filtering RAxML+ASTRAL is more robust than FastTree+ASTRAL 40 FastTree Weakly rejected (<0.95) Supported Strongly rejected (>=0.95) 0% 50% 100% RAxML
70 Visualizing discordance: DiscoVista Erfan Sayyari James B. Whitfield 41
71 DiscoVista Simple and interpretable Easy to run Focus on important branches 42
72 Quartet-based gene tree discordance Input: A species tree A set of gene trees Mapping of species to groups of interest Output: Quartet frequency per interesting branches Dataset (plants): Wicket et al, PNAS,
73 Compare different datasets Datasets (metazoa): Rouse et al, Nature, 2016, Cannon et al, Nature,
74 More traditional gene tree discordance measures Input: Gene trees Hypothetical clades Output: What percent of gene trees are compatible with those clades Dataset (insects): Misof et al, Science,
75 Species tree comparison Datasets (metazoa): Rouse et al, Nature, 2016, Cannon et al, Nature,
76 Summarize ASTRAL reconstructs species trees from gene trees with both high accuracy scalability to large datasets robust to some levels of model violations Like any other summary method, ASTRAL remains sensitive to gene tree estimation error try best to obtain highly accurate gene trees removing fragmentary data seems to help Visualizing discordance may prove illuminating 47
77 Future of ASTRAL Can it be changed to use characters directly? More broadly, can alternative scalable methods be developed for better gene tree estimation? 48
78 Future of ASTRAL Can it be changed to use characters directly? More broadly, can alternative scalable methods be developed for better gene tree estimation? ASTRAL scales to 10K leaves. We have 90K bacterial genomes. Can we scale further? 48
79 Tandy Warnow James B. Whitfield Maryam Rabiee Hashemi Chao Zhang S.M. Bayzid Théo Zimmermann John Yin Erfan Sayyari Shubhanshu Shekhar
80 Theoretical sample complexity results How many genes are enough to reconstruct the tree? ε # genes Balanced Caterpillar Theoretical f
81 Gene trees seem to improve (bootstrap) d 50% 40% Percent 30% 20% 10% no filtering Fragment filtering threshold Bootstrap support =0 <=33 >=75 =100 51
82 Gene trees seem to improve (less gene tree discordance) ) FN distance between species and gene trees occupancy no-filtering Filtering method 52
83 Impact of gene tree error (using true gene trees) ASTRAL II ASTRAL II (true gt) CA ML Species tree topological error (FN) Species tree topo Low ILS Medium ILS High ILS genes 53
84 Impact of gene tree error (using true gene trees) ASTRAL II ASTRAL II (true gt) CA ML Species tree topological error (FN) Species tree topo Low ILS Medium ILS High ILS genes When we divide our 50 replicates into low, medium, or high gene tree estimation error, ASTRAL tends to be better with low error 53
85 Running time (ho ASTRAL-I versus ASTRAL-II genes 1e 07 ASTRAL I ASTRAL II ASTRAL II + true st Species tree topological error (FN) 0.8 igure S2: 0.6 Comparison of various variants of ASTRAL with 200 taxa and varying tree sha 0.0 Low ILS Medium ILS High ILS nd number 0.4 of genes. Species tree accuracy (top) and running times (bottom) are shown. ASTRALrue st shows 0.2the case where the true species tree is added to the search space; this is included to approxim n ideal (e.g. exact) solution to the quartet problem genes s) species, deep ILS 54 1e
86 Running time (ho ASTRAL-I versus ASTRAL-II genes 1e 07 ASTRAL I ASTRAL II ASTRAL II + true st Species tree topological error (FN) 0.8 igure S2: 0.6 Comparison of various variants of ASTRAL with 200 taxa and varying tree sha 0.0 Low ILS Medium ILS High ILS nd number 0.4 of genes. Species tree accuracy (top) and running times (bottom) are shown. ASTRALrue st shows 0.2the case where the true species tree is added to the search space; this is included to approxim n ideal (e.g. exact) solution to the quartet problem genes s) species, deep ILS 54 1e
87 Dynamic programming L A L-A 55
88 Dynamic programming L A L-A A A-A A A-A A A-A Recursively break subsets of species into smaller subsets 55
89 Dynamic programming L A A L-A u L-A A-A A A-A A A-A A A-A Recursively break subsets of species into smaller subsets w(u) : Compare u against input gene trees and compute quartets from gene trees satisfied by u 55
90 Dynamic programming L Exponential A A L-A u L-A A-A A A-A A A-A A A-A Recursively break subsets of species into smaller subsets w(u) : Compare u against input gene trees and compute quartets from gene trees satisfied by u 55
91 Constrained version L A1 A2 A L-A A4 A10 A5 A6 A8 A9 A3 A A-A A A-A A A-A A7 56
92 Constrained version L A1 A2 A L-A A4 A10 A5 A6 A8 A9 A3 A A-A A A-A A A-A A7 Restrict branches in the species tree to a given constraint set X. 56
93 Deep ILS 30% 1000 genes 200 genes 50 genes Species tree topological error (FN) 20% 10% ASTRAL II NJst CA ML 10M 2M 500K 10M 2M 500K 10M 2M 500K tree length (controls the amount of ILS) 200 species, simulated species trees, deep ILS [Mirarab and Warnow, ISMB, 2015] 57
Fast coalescent-based branch support using local quartet frequencies
Fast coalescent-based branch support using local quartet frequencies Molecular Biology and Evolution (2016) 33 (7): 1654 68 Erfan Sayyari, Siavash Mirarab University of California, San Diego (ECE) anzee
More informationASTRAL: Fast coalescent-based computation of the species tree topology, branch lengths, and local branch support
ASTRAL: Fast coalescent-based computation of the species tree topology, branch lengths, and local branch support Siavash Mirarab University of California, San Diego Joint work with Tandy Warnow Erfan Sayyari
More informationUpcoming challenges in phylogenomics. Siavash Mirarab University of California, San Diego
Upcoming challenges in phylogenomics Siavash Mirarab University of California, San Diego Gene tree discordance The species tree gene1000 Causes of gene tree discordance include: Incomplete Lineage Sorting
More informationNJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees Erin Molloy and Tandy Warnow {emolloy2, warnow}@illinois.edu University of Illinois at Urbana
More informationConstruc)ng the Tree of Life: Divide-and-Conquer! Tandy Warnow University of Illinois at Urbana-Champaign
Construc)ng the Tree of Life: Divide-and-Conquer! Tandy Warnow University of Illinois at Urbana-Champaign Phylogeny (evolutionary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website,
More informationAnatomy of a species tree
Anatomy of a species tree T 1 Size of current and ancestral Populations (N) N Confidence in branches of species tree t/2n = 1 coalescent unit T 2 Branch lengths and divergence times of species & populations
More informationfirst (i.e., weaker) sense of the term, using a variety of algorithmic approaches. For example, some methods (e.g., *BEAST 20) co-estimate gene trees
Concatenation Analyses in the Presence of Incomplete Lineage Sorting May 22, 2015 Tree of Life Tandy Warnow Warnow T. Concatenation Analyses in the Presence of Incomplete Lineage Sorting.. 2015 May 22.
More informationFrom Gene Trees to Species Trees. Tandy Warnow The University of Texas at Aus<n
From Gene Trees to Species Trees Tandy Warnow The University of Texas at Aus
More informationFragmentary Gene Sequences Negatively Impact Gene Tree and Species Tree Reconstruction
Fragmentary Gene Sequences Negatively Impact Gene Tree and Species Tree Reconstruction Erfan Sayyari, 1 James B. Whitfield, 2 and Siavash Mirarab*,1 1 Department of Electrical and Computer Engineering,
More informationUnit 3 Insect Orders
Unit 3 Insect Orders General Directions: 1. To complete this study guide, please read the assigned readings for Unit 3 and watch the lecture. If you need additional information to complete this study guide,
More informationWorkshop III: Evolutionary Genomics
Identifying Species Trees from Gene Trees Elizabeth S. Allman University of Alaska IPAM Los Angeles, CA November 17, 2011 Workshop III: Evolutionary Genomics Collaborators The work in today s talk is joint
More informationPhylogenetic Geometry
Phylogenetic Geometry Ruth Davidson University of Illinois Urbana-Champaign Department of Mathematics Mathematics and Statistics Seminar Washington State University-Vancouver September 26, 2016 Phylogenies
More informationNew methods for es-ma-ng species trees from genome-scale data. Tandy Warnow The University of Illinois
New methods for es-ma-ng species trees from genome-scale data Tandy Warnow The University of Illinois Phylogeny (evolu9onary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website,
More informationConstrained Exact Op1miza1on in Phylogene1cs. Tandy Warnow The University of Illinois at Urbana-Champaign
Constrained Exact Op1miza1on in Phylogene1cs Tandy Warnow The University of Illinois at Urbana-Champaign Phylogeny (evolu1onary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website,
More informationThe impact of missing data on species tree estimation
MBE Advance Access published November 2, 215 The impact of missing data on species tree estimation Zhenxiang Xi, 1 Liang Liu, 2,3 and Charles C. Davis*,1 1 Department of Organismic and Evolutionary Biology,
More informationMul$ple Sequence Alignment Methods. Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu
Mul$ple Sequence Alignment Methods Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu Species Tree Orangutan Gorilla Chimpanzee Human From the Tree of the Life
More informationJed Chou. April 13, 2015
of of CS598 AGB April 13, 2015 Overview of 1 2 3 4 5 Competing Approaches of Two competing approaches to species tree inference: Summary methods: estimate a tree on each gene alignment then combine gene
More informationTaming the Beast Workshop
Workshop and Chi Zhang June 28, 2016 1 / 19 Species tree Species tree the phylogeny representing the relationships among a group of species Figure adapted from [Rogers and Gibbs, 2014] Gene tree the phylogeny
More informationPhylogenetics in the Age of Genomics: Prospects and Challenges
Phylogenetics in the Age of Genomics: Prospects and Challenges Antonis Rokas Department of Biological Sciences, Vanderbilt University http://as.vanderbilt.edu/rokaslab http://pubmed2wordle.appspot.com/
More informationA Phylogenetic Network Construction due to Constrained Recombination
A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer
More informationCS 581 Algorithmic Computational Genomics. Tandy Warnow University of Illinois at Urbana-Champaign
CS 581 Algorithmic Computational Genomics Tandy Warnow University of Illinois at Urbana-Champaign Today Explain the course Introduce some of the research in this area Describe some open problems Talk about
More informationPhylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
More informationPhylogenomics, Multiple Sequence Alignment, and Metagenomics. Tandy Warnow University of Illinois at Urbana-Champaign
Phylogenomics, Multiple Sequence Alignment, and Metagenomics Tandy Warnow University of Illinois at Urbana-Champaign Phylogeny (evolutionary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the
More informationThe Mathema)cs of Es)ma)ng the Tree of Life. Tandy Warnow The University of Illinois
The Mathema)cs of Es)ma)ng the Tree of Life Tandy Warnow The University of Illinois Phylogeny (evolu9onary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website, University of Arizona
More informationUsing Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics
Using Ensembles of Hidden Markov Models for Grand Challenges in Bioinformatics Tandy Warnow Founder Professor of Engineering The University of Illinois at Urbana-Champaign http://tandy.cs.illinois.edu
More informationToday's project. Test input data Six alignments (from six independent markers) of Curcuma species
DNA sequences II Analyses of multiple sequence data datasets, incongruence tests, gene trees vs. species tree reconstruction, networks, detection of hybrid species DNA sequences II Test of congruence of
More informationCS 581 Algorithmic Computational Genomics. Tandy Warnow University of Illinois at Urbana-Champaign
CS 581 Algorithmic Computational Genomics Tandy Warnow University of Illinois at Urbana-Champaign Course Staff Professor Tandy Warnow Office hours Tuesdays after class (2-3 PM) in Siebel 3235 Email address:
More informationBioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
More informationEstimating phylogenetic trees from genome-scale data
Ann. N.Y. Acad. Sci. ISSN 0077-8923 ANNALS OF THE NEW YORK ACADEMY OF SCIENCES Issue: The Year in Evolutionary Biology Estimating phylogenetic trees from genome-scale data Liang Liu, 1,2 Zhenxiang Xi,
More informationGenome-scale Es-ma-on of the Tree of Life. Tandy Warnow The University of Illinois
Genome-scale Es-ma-on of the Tree of Life Tandy Warnow The University of Illinois Phylogeny (evolu9onary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the Life Website, University of Arizona
More informationIn comparisons of genomic sequences from multiple species, Challenges in Species Tree Estimation Under the Multispecies Coalescent Model REVIEW
REVIEW Challenges in Species Tree Estimation Under the Multispecies Coalescent Model Bo Xu* and Ziheng Yang*,,1 *Beijing Institute of Genomics, Chinese Academy of Sciences, Beijing 100101, China and Department
More informationOn the variance of internode distance under the multispecies coalescent
On the variance of internode distance under the multispecies coalescent Sébastien Roch 1[0000 000 7608 8550 Department of Mathematics University of Wisconsin Madison Madison, WI 53706 roch@math.wisc.edu
More informationPhylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
More informationGenome-scale Es-ma-on of the Tree of Life. Tandy Warnow The University of Illinois
WABI 2017 Factsheet 55 proceedings paper submissions, 27 accepted (49% acceptance rate) 9 additional poster-only submissions (+8 posters accompanying papers) 56 PC members Each paper reviewed by at least
More informationPOPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
More informationInferring phylogenetic networks with maximum pseudolikelihood under incomplete lineage sorting
arxiv:1509.06075v3 [q-bio.pe] 12 Feb 2016 Inferring phylogenetic networks with maximum pseudolikelihood under incomplete lineage sorting Claudia Solís-Lemus 1 and Cécile Ané 1,2 1 Department of Statistics,
More informationEstimating phylogenetic trees from genome-scale data
Estimating phylogenetic trees from genome-scale data Liang Liu 1,2, Zhenxiang Xi 3, Shaoyuan Wu 4, Charles Davis 3, and Scott V. Edwards 4* 1 Department of Statistics, University of Georgia, Athens, GA
More informationQuartet Inference from SNP Data Under the Coalescent Model
Bioinformatics Advance Access published August 7, 2014 Quartet Inference from SNP Data Under the Coalescent Model Julia Chifman 1 and Laura Kubatko 2,3 1 Department of Cancer Biology, Wake Forest School
More informationProperties of Consensus Methods for Inferring Species Trees from Gene Trees
Syst. Biol. 58(1):35 54, 2009 Copyright c Society of Systematic Biologists DOI:10.1093/sysbio/syp008 Properties of Consensus Methods for Inferring Species Trees from Gene Trees JAMES H. DEGNAN 1,4,,MICHAEL
More informationC3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
More informationPhylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
More informationThe Wonderful World of Insects. James A. Bethke University of California Cooperative Extension Farm Advisor Floriculture and Nursery San Diego County
The Wonderful World of Insects James A. Bethke University of California Cooperative Extension Farm Advisor Floriculture and Nursery San Diego County Taxonomy The Insects The Orders Part I Taxonomy Scientific
More informationUsing phylogenetics to estimate species divergence times... Basics and basic issues for Bayesian inference of divergence times (plus some digression)
Using phylogenetics to estimate species divergence times... More accurately... Basics and basic issues for Bayesian inference of divergence times (plus some digression) "A comparison of the structures
More informationEstimating Evolutionary Trees. Phylogenetic Methods
Estimating Evolutionary Trees v if the data are consistent with infinite sites then all methods should yield the same tree v it gets more complicated when there is homoplasy, i.e., parallel or convergent
More informationReconstruire le passé biologique modèles, méthodes, performances, limites
Reconstruire le passé biologique modèles, méthodes, performances, limites Olivier Gascuel Centre de Bioinformatique, Biostatistique et Biologie Intégrative C3BI USR 3756 Institut Pasteur & CNRS Reconstruire
More informationSpecies Tree Inference using SVDquartets
Species Tree Inference using SVDquartets Laura Kubatko and Dave Swofford May 19, 2015 Laura Kubatko SVDquartets May 19, 2015 1 / 11 SVDquartets In this tutorial, we ll discuss several different data types:
More informationElements of Bioinformatics 14F01 TP5 -Phylogenetic analysis
Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis 10 December 2012 - Corrections - Exercise 1 Non-vertebrate chordates generally possess 2 homologs, vertebrates 3 or more gene copies; a Drosophila
More informationMany of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks!
Many of the slides that I ll use have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks! Paul has many great tools for teaching phylogenetics at his web site: http://hydrodictyon.eeb.uconn.edu/people/plewis
More informationAmira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
More informationComparative Methods on Phylogenetic Networks
Comparative Methods on Phylogenetic Networks Claudia Solís-Lemus Emory University Joint Statistical Meetings August 1, 2018 Phylogenetic What? Networks Why? Part I Part II How? When? PCM What? Phylogenetic
More informationDr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
More informationSEPP and TIPP for metagenomic analysis. Tandy Warnow Department of Computer Science University of Texas
SEPP and TIPP for metagenomic analysis Tandy Warnow Department of Computer Science University of Texas Phylogeny (evolutionary tree) Orangutan From the Tree of the Life Website, University of Arizona Gorilla
More informationPhylogenetics: Bayesian Phylogenetic Analysis. COMP Spring 2015 Luay Nakhleh, Rice University
Phylogenetics: Bayesian Phylogenetic Analysis COMP 571 - Spring 2015 Luay Nakhleh, Rice University Bayes Rule P(X = x Y = y) = P(X = x, Y = y) P(Y = y) = P(X = x)p(y = y X = x) P x P(X = x 0 )P(Y = y X
More informationUnderstanding How Stochasticity Impacts Reconstructions of Recent Species Divergent History. Huateng Huang
Understanding How Stochasticity Impacts Reconstructions of Recent Species Divergent History by Huateng Huang A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor
More informationCS 394C Algorithms for Computational Biology. Tandy Warnow Spring 2012
CS 394C Algorithms for Computational Biology Tandy Warnow Spring 2012 Biology: 21st Century Science! When the human genome was sequenced seven years ago, scientists knew that most of the major scientific
More informationOrganizing Life s Diversity
17 Organizing Life s Diversity section 2 Modern Classification Classification systems have changed over time as information has increased. What You ll Learn species concepts methods to reveal phylogeny
More informationEvaluating Fast Maximum Likelihood-Based Phylogenetic Programs Using Empirical Phylogenomic Data Sets
Evaluating Fast Maximum Likelihood-Based Phylogenetic Programs Using Empirical Phylogenomic Data Sets Xiaofan Zhou, 1,2 Xing-Xing Shen, 3 Chris Todd Hittinger, 4 and Antonis Rokas*,3 1 Integrative Microbiology
More informationHokie Bugfest (October 17, 2015)
Hokie Bugfest (October 17, 2015) It s time to get collecting!! Start an insect collection and have it judged at the Hokie Bugfest on October 17. The Bugfest will be held from 10 a.m. to 5 p.m. at the Inn
More informationX X (2) X Pr(X = x θ) (3)
Notes for 848 lecture 6: A ML basis for compatibility and parsimony Notation θ Θ (1) Θ is the space of all possible trees (and model parameters) θ is a point in the parameter space = a particular tree
More informationNon-binary Tree Reconciliation. Louxin Zhang Department of Mathematics National University of Singapore
Non-binary Tree Reconciliation Louxin Zhang Department of Mathematics National University of Singapore matzlx@nus.edu.sg Introduction: Gene Duplication Inference Consider a duplication gene family G Species
More informationMolecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
More information9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
More informationEfficient Bayesian Species Tree Inference under the Multispecies Coalescent
Syst. Biol. 66(5):823 842, 2017 The Author(s) 2017. Published by Oxford University Press, on behalf of the Society of Systematic Biologists. All rights reserved. For Permissions, please email: journals.permissions@oup.com
More informationBiology ENTOMOLOGY Dr. Tatiana Rossolimo, Class syllabus
Biology 3327.03 ENTOMOLOGY Dr. Tatiana Rossolimo, e-mail: trossoli@dal.ca Class syllabus Insects are the most biodiverse group of organisms on the Earth. They far surpass other terrestrial animals in abundance
More informationMolecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
More information394C, October 2, Topics: Mul9ple Sequence Alignment Es9ma9ng Species Trees from Gene Trees
394C, October 2, 2013 Topics: Mul9ple Sequence Alignment Es9ma9ng Species Trees from Gene Trees Mul9ple Sequence Alignment Mul9ple Sequence Alignments and Evolu9onary Histories (the meaning of homologous
More informationHokie BugFest (October 20, 2018)
Hokie BugFest (October 20, 2018) It s time to get collecting!! Start an insect collection and have it judged at the Hokie BugFest on October 20 th. The BugFest will be held from 10 a.m. to 5 p.m. at the
More informationA phylogenomic toolbox for assembling the tree of life
A phylogenomic toolbox for assembling the tree of life or, The Phylota Project (http://www.phylota.org) UC Davis Mike Sanderson Amy Driskell U Pennsylvania Junhyong Kim Iowa State Oliver Eulenstein David
More informationLarge-scale gene family analysis of 76 Arthropods
Large-scale gene family analysis of 76 Arthropods i5k webinar / September 5, 28 Gregg Thomas @greggwcthomas Indiana University The genomic basis of Arthropod diversity https://www.biorxiv.org/content/early/28/8/4/382945
More informationPhylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
More informationarxiv: v1 [math.st] 22 Jun 2018
Hypothesis testing near singularities and boundaries arxiv:1806.08458v1 [math.st] Jun 018 Jonathan D. Mitchell, Elizabeth S. Allman, and John A. Rhodes Department of Mathematics & Statistics University
More informationFine-Scale Phylogenetic Discordance across the House Mouse Genome
Fine-Scale Phylogenetic Discordance across the House Mouse Genome Michael A. White 1,Cécile Ané 2,3, Colin N. Dewey 4,5,6, Bret R. Larget 2,3, Bret A. Payseur 1 * 1 Laboratory of Genetics, University of
More informationA (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
More information8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
More informationQ1) Explain how background selection and genetic hitchhiking could explain the positive correlation between genetic diversity and recombination rate.
OEB 242 Exam Practice Problems Answer Key Q1) Explain how background selection and genetic hitchhiking could explain the positive correlation between genetic diversity and recombination rate. First, recall
More informationPhylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
More informationTo link to this article: DOI: / URL:
This article was downloaded by:[ohio State University Libraries] [Ohio State University Libraries] On: 22 February 2007 Access Details: [subscription number 731699053] Publisher: Taylor & Francis Informa
More informationTechniques for generating phylogenomic data matrices: transcriptomics vs genomics. Rosa Fernández & Marina Marcet-Houben
Techniques for generating phylogenomic data matrices: transcriptomics vs genomics Rosa Fernández & Marina Marcet-Houben DE NOVO Raw reads Sanitize Filter Assemble Translate Reduce reduncancy Download DATABASES
More informationIsolating - A New Resampling Method for Gene Order Data
Isolating - A New Resampling Method for Gene Order Data Jian Shi, William Arndt, Fei Hu and Jijun Tang Abstract The purpose of using resampling methods on phylogenetic data is to estimate the confidence
More informationSEPP and TIPP for metagenomic analysis. Tandy Warnow Department of Computer Science University of Texas
SEPP and TIPP for metagenomic analysis Tandy Warnow Department of Computer Science University of Texas Metagenomics: Venter et al., Exploring the Sargasso Sea: Scientists Discover One Million New Genes
More informationConcepts and Methods in Molecular Divergence Time Estimation
Concepts and Methods in Molecular Divergence Time Estimation 26 November 2012 Prashant P. Sharma American Museum of Natural History Overview 1. Why do we date trees? 2. The molecular clock 3. Local clocks
More informationWenEtAl-biorxiv 2017/12/21 10:55 page 2 #2
WenEtAl-biorxiv 0// 0: page # Inferring Phylogenetic Networks Using PhyloNet Dingqiao Wen, Yun Yu, Jiafan Zhu, Luay Nakhleh,, Computer Science, Rice University, Houston, TX, USA; BioSciences, Rice University,
More informationPhylogenetic Networks, Trees, and Clusters
Phylogenetic Networks, Trees, and Clusters Luay Nakhleh 1 and Li-San Wang 2 1 Department of Computer Science Rice University Houston, TX 77005, USA nakhleh@cs.rice.edu 2 Department of Biology University
More informationSTEM-hy: Species Tree Estimation using Maximum likelihood (with hybridization)
STEM-hy: Species Tree Estimation using Maximum likelihood (with hybridization) Laura Salter Kubatko Departments of Statistics and Evolution, Ecology, and Organismal Biology The Ohio State University kubatko.2@osu.edu
More informationMisconceptions on Missing Data in RAD-seq Phylogenetics with a Deep-scale Example from Flowering Plants
Syst. Biol. 66(3):399 412, 2017 The Author(s) 2016. Published by Oxford University Press, on behalf of the Society of Systematic Biologists. All rights reserved. For Permissions, please email: journals.permissions@oup.com
More informationIncomplete Lineage Sorting: Consistent Phylogeny Estimation From Multiple Loci
University of Pennsylvania ScholarlyCommons Statistics Papers Wharton Faculty Research 1-2010 Incomplete Lineage Sorting: Consistent Phylogeny Estimation From Multiple Loci Elchanan Mossel University of
More informationHexapoda Origins: Monophyletic, Paraphyletic or Polyphyletic? Rob King and Matt Kretz
Hexapoda Origins: Monophyletic, Paraphyletic or Polyphyletic? Rob King and Matt Kretz Outline Review Hexapod Origins Response to Hexapod Origins How the same data = different trees Arthropod Origins The
More informationPhyloNet. Yun Yu. Department of Computer Science Bioinformatics Group Rice University
PhyloNet Yun Yu Department of Computer Science Bioinformatics Group Rice University yy9@rice.edu Symposium And Software School 2016 The University Of Texas At Austin Installation System requirement: Java
More informationMethods to reconstruct phylogene1c networks accoun1ng for ILS
Methods to reconstruct phylogene1c networks accoun1ng for ILS Céline Scornavacca some slides have been kindly provided by Fabio Pardi ISE-M, Equipe Phylogénie & Evolu1on Moléculaires Montpellier, France
More informationTheDisk-Covering MethodforTree Reconstruction
TheDisk-Covering MethodforTree Reconstruction Daniel Huson PACM, Princeton University Bonn, 1998 1 Copyright (c) 2008 Daniel Huson. Permission is granted to copy, distribute and/or modify this document
More informationLecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) p.1/30
Lecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) Joe Felsenstein Department of Genome Sciences and Department of Biology Lecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) p.1/30 A non-phylogeny
More informationConstructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
More information"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2009 University of California, Berkeley
"PRINCIPLES OF PHYLOGENETICS: ECOLOGY AND EVOLUTION" Integrative Biology 200B Spring 2009 University of California, Berkeley B.D. Mishler Jan. 22, 2009. Trees I. Summary of previous lecture: Hennigian
More informationPhylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
More informationPhylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata.
Supplementary Note S2 Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata. Phylogenetic trees reconstructed by a variety of methods from either single-copy orthologous loci (Class
More informationThe minimal prokaryotic genome. The minimal prokaryotic genome. The minimal prokaryotic genome. The minimal prokaryotic genome
Dr. Dirk Gevers 1,2 1 Laboratorium voor Microbiologie 2 Bioinformatics & Evolutionary Genomics The bacterial species in the genomic era CTACCATGAAAGACTTGTGAATCCAGGAAGAGAGACTGACTGGGCAACATGTTATTCAG GTACAAAAAGATTTGGACTGTAACTTAAAAATGATCAAATTATGTTTCCCATGCATCAGG
More informationPhylogenetic Assumptions
Substitution Models and the Phylogenetic Assumptions Vivek Jayaswal Lars S. Jermiin COMMONWEALTH OF AUSTRALIA Copyright htregulation WARNING This material has been reproduced and communicated to you by
More informationFrom Individual-based Population Models to Lineage-based Models of Phylogenies
From Individual-based Population Models to Lineage-based Models of Phylogenies Amaury Lambert (joint works with G. Achaz, H.K. Alexander, R.S. Etienne, N. Lartillot, H. Morlon, T.L. Parsons, T. Stadler)
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More information