Phylogenetic Trees. Bret Larget. Departments of Botany and of Statistics University of Wisconsin Madison. September 8, 2011
|
|
- Eustace Austin
- 6 years ago
- Views:
Transcription
1 Phylogenetic Trees ret Larget epartments of otany and of Statistics University of Wisconsin Madison September 8, 2011 Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
2 rief History arwin Phylogenetics and arwin In 1837, shortly after his famous five-year voyage as naturalist on the eagle, arwin sketched a tree diagram in one of his notebooks. This simple sketch is remarkably similar to modern diagrams of phylogenies. In addition, the sole figure in The Origin of Species (1859) is a phylogeny. Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
3 arwin s Trees rief History arwin Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
4 rief History arly History arly History Shortly after the 1859 publication of The Origin of Species, many biologists came to accept the truth of a universal Tree of Life. rnst Haeckel and many others created highly stylized trees that were based on expert opinion. century passed before development of formal scientific methods for estimating phylogenies began. Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
5 Haeckel s Trees rief History arly History Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
6 rief History What is the Origin of Whales? Modern Phylogenetics dolphin TGTGTTTTT giant sperm whale TGTGTTTTTTT bowhead whale TGTGTTTTTT right whale TGTGGTTTTTT minke whale TGTGTTTTT fin whale TGTGTTTGT blue whale TGTGTTTT humpback whale TGTGTTTTT... hippopotamus TGTGTTTTTTTT camel TGTGTTTTTTT pig TGTGTTTTTT cow TGTTTGGTTTTTGT sheep TGTTGTTTTGT goat TGTGGTTTTTGT Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
7 rief History n stimated Whale Phylogeny Modern Phylogenetics Scienceirect - ull Size Image 09/04/ :10 M LOS urlversion=0&_userid=443835&md5=df655f7ee732c807488f9262b841bcfc Page 1 of 2 Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
8 rief History Uses of Phylogenies Why is Phylogenetics Important? It is an exaggeration to say phylogenetics are everywhere, but phylogenetic trees are used in many areas of biology beyond the obvious area of systematics. Other areas include forensics and developmental biology. rom a statistical point of view, the evolutionary history of organisms means that species should not be treated as independent samples. ven if evolutionary relationships are not of primary interest, a good statistical analysis might need to account for the phylogeny to explain some part of the dependence among observations from different species. Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
9 rief History orensic Phylogenetic Tree Uses of Phylogenies Reviews 30 HIV orensics igure 2 R RV 10% US3 31 SMHS8 P896 SMHS7 NVVG SMHS2 S YU2 NVUSR2 NY5G S14 US2 JH32 NVV WU160 JRS M1 H HX2 S128 L50 L49 SMHS1 L1 SMHS20 85WIPR54 MNG US4 89SP061 US1 S2 NVV PHI HN WR M200 G M925 M18 TH MN 3 RL42 PHI L47 L46 OYI M36 L45 L igure 2. Neighbor-joining phylogram representing the reconstruction of the phylogenetic relationships between the env (2-V5) sequences obtained from the index case (31-44), the alleged recipient (22-29), three local controls (L45 and L48; L46 and L47; and L49 and L50) and 48 sequences chosen from Genank. Ten iterations of random sequence addition were used. Scale bar represents 10% genetic distance. ootstrap values are shown at nodes with greater than 70% support. Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
10 Trees ctivity 1: xample Tree Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
11 Trees ctivity 2: ompare Trees Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
12 Trees ctivity 3: Unrooted Tree Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
13 Trees ctivity 4: Labeled Histories Genetics/otany 629 (all 2011) Phylogenetic Trees September 7, / 13
Phylogenetic Trees. Bret Larget. Departments of Botany and of Statistics University of Wisconsin Madison. September 8, 2009
Phylogenetic Trees ret Larget epartments of otany and of Statistics University of Wisconsin Madison September 8, 2009 Genetics/otany 629 (all 2009) Phylogenetic Trees September 8, 2009 1 / 13 rief History
More informationModern Phylogenetics. An Introduction to Phylogenetics. Phylogenetics and Systematics. Phylogenetic Tree of Whales
Modern Phylogenetics n Introduction to Phylogenetics ret Larget larget@stat.wisc.edu epartments of otany and of Statistics University of Wisconsin Madison January 27, 2010 Phylogenies are usually estimated
More informationPhylogenetics and Darwin. An Introduction to Phylogenetics. Tree of Life. Darwin s Trees
Phylogenetics and Darwin An Introduction to Phylogenetics Bret Larget larget@stat.wisc.edu Departments of Botany and of Statistics University of Wisconsin Madison February 4, 2008 A phylogeny is a tree
More informationTheory of Evolution Charles Darwin
Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
More informationTheory of Evolution. Charles Darwin
Theory of Evolution harles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (8-6) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
More informationStudent pages-1. Biological Evolution and Classification Scientific Evidence of Common Ancestry. Purpose. Before You Begin.
Biological Evolution and Classification Scientific Evidence of Common Ancestry Student Pages Purpose The purpose of this activity is to reinforce your understanding of the theory of evolution and some
More informationObjectives. Evolution. Darwin 5/30/2012. Pre-Darwin. Genetic change in a population over time.
Objectives Evolution What is evolution? What lead Darwin to his thoughts 4 Premises of Evolution by Natural Selection Evidence supporting Evolution Genetic change in a population over time. Unifying concept
More informationCREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
More informationDNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi
DNA Phylogeny Signals and Systems in Biology Kushal Shah @ EE, IIT Delhi Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics :
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
More informationChapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin
More informationStation 1 Fossil Record
The very first horses evolved on the North American continent over 55 million years ago. The horse fossil record is very rich in transitional species. This is a series of skulls and front leg fossils of
More informationELE4120 Bioinformatics Tutorial 8
ELE4120 ioinformatics Tutorial 8 ontent lassifying Organisms Systematics and Speciation Taxonomy and phylogenetics Phenetics versus cladistics Phylogenetic trees iological classification Goal: To develop
More informationEvolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationModels of Molecular Evolution
Models of Molecular Evolution Bret Larget Departments of Botany and of Statistics University of Wisconsin Madison September 15, 2007 Genetics 875 (Fall 2009) Molecular Evolution September 15, 2009 1 /
More informationPhylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
More information"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
More informationPhylogenetic Trees. How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species?
Why? Phylogenetic Trees How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species? The saying Don t judge a book by its cover. could be applied
More informationCopyright notice. Molecular Phylogeny and Evolution. Goals of the lecture. Introduction. Introduction. December 15, 2008
opyright notice Molecular Phylogeny and volution ecember 5, 008 ioinformatics J. Pevsner pevsner@kennedykrieger.org Many of the images in this powerpoint presentation are from ioinformatics and Functional
More informationI. Short Answer Questions DO ALL QUESTIONS
EVOLUTION 313 FINAL EXAM Part 1 Saturday, 7 May 2005 page 1 I. Short Answer Questions DO ALL QUESTIONS SAQ #1. Please state and BRIEFLY explain the major objectives of this course in evolution. Recall
More informationBINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
More informationBiodiversity. The Road to the Six Kingdoms of Life
Biodiversity The Road to the Six Kingdoms of Life How the 6 kingdoms came about At first, only two kingdoms were recognized Then Haeckel proposed a third kingdom Protista (where protists had both plant
More informationCopyright (c) 2008 Daniel Huson. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation
Copyright (c) 2008 Daniel Huson. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.2 or any later version published
More informationPhylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying
More informationAlgorithmic Methods Well-defined methodology Tree reconstruction those that are well-defined enough to be carried out by a computer. Felsenstein 2004,
Tracing the Evolution of Numerical Phylogenetics: History, Philosophy, and Significance Adam W. Ferguson Phylogenetic Systematics 26 January 2009 Inferring Phylogenies Historical endeavor Darwin- 1837
More informationChapter 16: Reconstructing and Using Phylogenies
Chapter Review 1. Use the phylogenetic tree shown at the right to complete the following. a. Explain how many clades are indicated: Three: (1) chimpanzee/human, (2) chimpanzee/ human/gorilla, and (3)chimpanzee/human/
More informationEvolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies Anatomical features were the dominant
More information1. Construct and use dichotomous keys to identify organisms.
OBJECTIVE SHEET SYSTEMATICS AND CLASSIFICATION 1. Construct and use dichotomous keys to identify organisms. 2. Clarify the purpose behind systematics and phylogeny. 3. Identify the structures of a phylogenetic
More informationBiodiversity. The Road to the Six Kingdoms of Life
Biodiversity The Road to the Six Kingdoms of Life How the 6 kingdoms came about At first, only two kingdoms were recognized Then Haeckel proposed a third kingdom Protista (where protists had both plant
More informationRecent Advances in Phylogeny Reconstruction
Recent Advances in Phylogeny Reconstruction from Gene-Order Data Bernard M.E. Moret Department of Computer Science University of New Mexico Albuquerque, NM 87131 Department Colloqium p.1/41 Collaborators
More informationPhylogenetic inference: from sequences to trees
W ESTFÄLISCHE W ESTFÄLISCHE W ILHELMS -U NIVERSITÄT NIVERSITÄT WILHELMS-U ÜNSTER MM ÜNSTER VOLUTIONARY FUNCTIONAL UNCTIONAL GENOMICS ENOMICS EVOLUTIONARY Bioinformatics 1 Phylogenetic inference: from sequences
More informationSTAAR Biology: Assessment Activities. Biological Evolution and Classification. The Charles A. Dana Center at The University of Texas at Austin
Biological Evolution and Classification Scientific Evidence of Common Ancestry 211 212 Biological Evolution and Classification Teacher Pages Purpose The purpose of this activity is to reinforce students
More informationAdditive distances. w(e), where P ij is the path in T from i to j. Then the matrix [D ij ] is said to be additive.
Additive distances Let T be a tree on leaf set S and let w : E R + be an edge-weighting of T, and assume T has no nodes of degree two. Let D ij = e P ij w(e), where P ij is the path in T from i to j. Then
More informationChapter 26. Phylogeny and the Tree of Life. Lecture Presentations by Nicole Tunbridge and Kathleen Fitzpatrick Pearson Education, Inc.
Chapter 26 Phylogeny and the Tree of Life Lecture Presentations by Nicole Tunbridge and Kathleen Fitzpatrick Investigating the Tree of Life Phylogeny is the evolutionary history of a species or group of
More informationBioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
More informationProperties of Life. Levels of Organization. Levels of Organization. Levels of Organization. Levels of Organization. The Science of Biology.
The Science of Biology Chapter 1 Properties of Life Living organisms: are composed of cells are complex and ordered respond to their environment can grow and reproduce obtain and use energy maintain internal
More information1 In 2006, the scientific journal, Nature, reported the discovery of a fossil from around 380 million
1 In 2006, the scientific journal, Nature, reported the discovery of a fossil from around 380 million years ago. It was given the name Tiktaalik roseae. This fossil has some features in common with fish
More informationLecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
More informationOMICS Journals are welcoming Submissions
OMICS Journals are welcoming Submissions OMICS International welcomes submissions that are original and technically so as to serve both the developing world and developed countries in the best possible
More informationThe Science of Biology. Chapter 1
The Science of Biology Chapter 1 Properties of Life Living organisms: are composed of cells are complex and ordered respond to their environment can grow and reproduce obtain and use energy maintain internal
More informationBayesian Estimation of Ancestral Character States on Phylogenies
Syst. Biol. 53(5):673 684, 2004 Copyright c Society of Systematic Biologists ISSN: 1063-5157 print / 1076-836X online DOI: 10.1080/10635150490522232 Bayesian Estimation of Ancestral Character States on
More informationChapter 19 Organizing Information About Species: Taxonomy and Cladistics
Chapter 19 Organizing Information About Species: Taxonomy and Cladistics An unexpected family tree. What are the evolutionary relationships among a human, a mushroom, and a tulip? Molecular systematics
More informationPhylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
More informationClassification, Phylogeny yand Evolutionary History
Classification, Phylogeny yand Evolutionary History The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize
More informationOutline. Classification of Living Things
Outline Classification of Living Things Chapter 20 Mader: Biology 8th Ed. Taxonomy Binomial System Species Identification Classification Categories Phylogenetic Trees Tracing Phylogeny Cladistic Systematics
More informationA (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
More informationNJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees
NJMerge: A generic technique for scaling phylogeny estimation methods and its application to species trees Erin Molloy and Tandy Warnow {emolloy2, warnow}@illinois.edu University of Illinois at Urbana
More informationName: Class: Date: ID: A
Class: _ Date: _ Ch 17 Practice test 1. A segment of DNA that stores genetic information is called a(n) a. amino acid. b. gene. c. protein. d. intron. 2. In which of the following processes does change
More informationPhylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
More informationBioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony
ioinformatics -- lecture 9 Phylogenetic trees istance-based tree building Parsimony (,(,(,))) rees can be represented in "parenthesis notation". Each set of parentheses represents a branch-point (bifurcation),
More informationGenerating phylogenetic trees with Phylomatic and dendrograms of functional traits in R
Generating phylogenetic trees with Phylomatic and dendrograms of functional traits in R Zhang Jinlong IBCAS 2010-8-1 Contents 1. Introduction 2. Phylomatic: a step by step guide 3. Import phylogentic trees
More informationPhylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
More informationBiology 211 (2) Week 1 KEY!
Biology 211 (2) Week 1 KEY Chapter 1 KEY FIGURES: 1.2, 1.3, 1.4, 1.5, 1.6, 1.7 VOCABULARY: Adaptation: a trait that increases the fitness Cells: a developed, system bound with a thin outer layer made of
More informationIntroduction to characters and parsimony analysis
Introduction to characters and parsimony analysis Genetic Relationships Genetic relationships exist between individuals within populations These include ancestordescendent relationships and more indirect
More informationChapter 19: Taxonomy, Systematics, and Phylogeny
Chapter 19: Taxonomy, Systematics, and Phylogeny AP Curriculum Alignment Chapter 19 expands on the topics of phylogenies and cladograms, which are important to Big Idea 1. In order for students to understand
More informationSequential Monte Carlo Algorithms
ayesian Phylogenetic Inference using Sequential Monte arlo lgorithms lexandre ouchard-ôté *, Sriram Sankararaman *, and Michael I. Jordan *, * omputer Science ivision, University of alifornia erkeley epartment
More informationCS5238 Combinatorial methods in bioinformatics 2003/2004 Semester 1. Lecture 8: Phylogenetic Tree Reconstruction: Distance Based - October 10, 2003
CS5238 Combinatorial methods in bioinformatics 2003/2004 Semester 1 Lecture 8: Phylogenetic Tree Reconstruction: Distance Based - October 10, 2003 Lecturer: Wing-Kin Sung Scribe: Ning K., Shan T., Xiang
More informationEvidence of Common Ancestry Stations
Stations Scientists have long wondered where organisms came from and how they evolved. One of the main sources of evidence for the evolution of organisms comes from the fossil record. Thousands of layers
More informationBayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies
Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies 1 What is phylogeny? Essay written for the course in Markov Chains 2004 Torbjörn Karfunkel Phylogeny is the evolutionary development
More information150 years after the Origin. Does Evolution Make Big Changes? Progressive Creationism. Idea goes back at least to And was discussed in 1866
150 years after the Origin Does Evolution Make Big Changes? Alan R Rogers January 11, 2014 Most modern evolution skeptics acknowledge that evolution makes small changes They maintain that it does not make
More informationSCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of
More informationBIOL 1010 Introduction to Biology: The Evolution and Diversity of Life. Spring 2011 Sections A & B
BIOL 1010 Introduction to Biology: The Evolution and Diversity of Life. Spring 2011 Sections A & B Steve Thompson: stthompson@valdosta.edu http://www.bioinfo4u.net 1 ʻTree of Life,ʼ ʻprimitive,ʼ ʻprogressʼ
More informationTUTOR WORLD ASHFORD GCSE MATHEMATICS. Sample Test 1 (Non-Calculator)
TUTOR WORLD ASHFORD GCSE MATHEMATICS Sample Test 1 (Non-Calculator) Time: 1 hour 30 minutes Higher Tier Read the following carefully. ----------------------------------------------------------------------------------------------
More informationAdv. Biology: Classification Unit Study Guide
Adv. Biology: Classification Unit Study Guide Chapter 17 and 24.1-24.2 All notes/handouts/activities from class Early taxonomists: Aristotle/Linnaeus o Aristotle (394-32 B.C.) a Greek Philosopher, who
More informationAmira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
More informationFig. 26.7a. Biodiversity. 1. Course Outline Outcomes Instructors Text Grading. 2. Course Syllabus. Fig. 26.7b Table
Fig. 26.7a Biodiversity 1. Course Outline Outcomes Instructors Text Grading 2. Course Syllabus Fig. 26.7b Table 26.2-1 1 Table 26.2-2 Outline: Systematics and the Phylogenetic Revolution I. Naming and
More informationModern cellular organisms. From
Modern cellular organisms From http://www.ucmp.berkeley.edu/exhibit/phylogeny.html Endothelial cell Lysosomes, mitochondria and nucleus See the cellular cytoskeleton, ER and nucleus Modern cells are complex
More informationConcept Modern Taxonomy reflects evolutionary history.
Concept 15.4 Modern Taxonomy reflects evolutionary history. What is Taxonomy: identification, naming, and classification of species. Common Names: can cause confusion - May refer to several species (ex.
More informationChapter 22: Evolution
Chapter 22: Evolution BIOL 1020 CHAPTER 22 LECTURE NOTES 1. Describe the major ideas on evolution and related topics that had a significant influence on Charles Darwin as he developed the concept of evolution
More informationPhylogenetics Topic 1: An overview
Phylogenetics Topic 1: An overview Introduction The affinities of all beings of the same class have sometimes been represented by a great tree. I believe this simile largely speaks the truth. The green
More informationExamining the Fossil Record
Examining the Fossil Record Objectives: analyze characteristics of fossils compare placement of fossils and determine relative ages develop a model evolutionary tree based on the morphology and age of
More informationLecture 6 Phylogenetic Inference
Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,
More informationPhylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
More informationDr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
More informationPhylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
More informationPhylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
More informationThe practice of naming and classifying organisms is called taxonomy.
Chapter 18 Key Idea: Biologists use taxonomic systems to organize their knowledge of organisms. These systems attempt to provide consistent ways to name and categorize organisms. The practice of naming
More informationChapter 22: Descent with Modification 1. BRIEFLY summarize the main points that Darwin made in The Origin of Species.
AP Biology Chapter Packet 7- Evolution Name Chapter 22: Descent with Modification 1. BRIEFLY summarize the main points that Darwin made in The Origin of Species. 2. Define the following terms: a. Natural
More informationPhylogeny and Molecular Evolution. Introduction
Phylogeny and Molecular Evolution Introduction 1 2/62 3/62 Credit Serafim Batzoglou (UPGMA slides) http://www.stanford.edu/class/cs262/slides Notes by Nir Friedman, Dan Geiger, Shlomo Moran, Ron Shamir,
More informationEssence of Darwin s ideas. LaMarckian vs. Darwinian view. Convergent Evolution. Natural selection in action 9/7/2015
Essence of Darwin s ideas Variation exists in natural populations Many more offspring are born each season than can possibly survive to maturity As a result, there is a struggle for existence competition
More informationPhylogeny. Properties of Trees. Properties of Trees. Trees represent the order of branching only. Phylogeny: Taxon: a unit of classification
Multiple sequence alignment global local Evolutionary tree reconstruction Pairwise sequence alignment (global and local) Substitution matrices Gene Finding Protein structure prediction N structure prediction
More informationIntegrating Fossils into Phylogenies. Throughout the 20th century, the relationship between paleontology and evolutionary biology has been strained.
IB 200B Principals of Phylogenetic Systematics Spring 2011 Integrating Fossils into Phylogenies Throughout the 20th century, the relationship between paleontology and evolutionary biology has been strained.
More information1. Wings 5.. Jumping legs 2. 6 Legs 6. Crushing mouthparts 3. Segmented Body 7. Legs 4. Double set of wings 8. Curly antennae
Biology Cladogram practice Name Per Date What is a cladogram? It is a diagram that depicts evolutionary relationships among groups. It is based on PHYLOGENY, which is the study of evolutionary relationships.
More informationEvidence of Evolution by Natural Selection. Dodo bird
Evidence of Evolution by Natural Selection Dodo bird 2007-2008 Evidence supporting evolution Fossil record transition species Anatomical record homologous & vestigial structures embryology & development
More informationChapter 18 Systematics: Seeking Order Amidst Diversity
Chapter 18 Systematics: Seeking Order Amidst Diversity Bird Diversity in Indonesia Chapter 18 At a Glance 18.1 How Are Organisms Named and Classified? 18.2 What Are the Domains of Life? 18.1 How Are Organisms
More information9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
More informationIntroduction to Bioinformatics Introduction to Bioinformatics
Dr. rer. nat. Gong Jing Cancer Research Center Medicine School of Shandong University 2012.11.09 1 Chapter 4 Phylogenetic Tree 2 Phylogeny Evidence from morphological ( 形态学的 ), biochemical, and gene sequence
More informationScience Department. 1 st Primary. First & Second Term Booklet
Science Department 1 st Primary First & Second Term Booklet 1 Unit 1 Living and Non-living organisms Kindly watch these videos: http://youtube.com/watch?v=bn0vwkqorhk https://www.youtube.com/watch?v=p51fipo2_kq
More informationCharacteristics of Life
UNIT 2 BIODIVERSITY Chapter 4- Patterns of Life Biology 2201 Characteristics of Life All living things share some basic characteristics: 1) living things are organized systems made up of one or more cells
More informationCommon Descent with Modification Evolution and Its Core Principles. Common Descent with Modification. Natural Selection
16.1 Evolution and Its Core Principles Common Descent with Modification Descent with modification A key theory of evolution Describes the process by which species of living things can undergo modification
More information15 Darwin's Theory of Natural Selection 15-1 The Puzzle of Life's Diversity
15-1 The Puzzle of Life's Diversity Study the photo of leaves... What else do you see? How did the Leaf Mantis come to look like decaying leaves? Define evolution in its simplest meaning? Review the meaning
More informationThursday, January 14. Teaching Point: SWBAT. assess their knowledge to prepare for the Evolution Summative Assessment. (TOMORROW) Agenda:
Thursday, January 14 Teaching Point: SWBAT. assess their knowledge to prepare for the Evolution Summative Assessment. (TOMORROW) Agenda: 1. Show Hinsz your completed Review WS 2. Discuss answers to Review
More informationConstructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
More informationBiology. Slide 1 of 25. End Show. Copyright Pearson Prentice Hall
Biology 1 of 25 2 of 25 Macroevolution Macroevolution refers to large-scale evolutionary patterns and processes that occur over long periods of time. 3 of 25 Macroevolution What are six important patterns
More informationFor Classroom Trial Testing
For Classroom Trial Testing Video Description Secrets of the Sequence, Show 141, Episode 2 From Slime to Sublime approximately 10 minutes viewing time While we are similar to our fellow man in size, shape,
More informationStatus of Living and Extinct Taxa. Mammals Amphibians Birds. Nearly 1/3 (31%) is globally threatened or extinct. DRAFT
Status of Living and Extinct Taxa Mammals Amphibians Birds Nearly 1/4 (22%) is globally threatened or extinct. Nearly 1/3 (31%) is globally threatened or extinct. 1/7 (14%) is globally threatened or extinct.
More informationEvidence of Evolution Background
Evidence of Evolution Background When Charles Darwin first proposed the idea that all new species descend from an ancestor, he performed an exhaustive amount of research to provide as much evidence as
More informationHow should we organize the diversity of animal life?
How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)
More informationLaboratory. Phylogenetics
Laboratory 11 Phylogenetics Biology 171L SP18 Lab 11: Phylogenetics Student Learning Outcomes 1. Discover Darwin s contribution to biology. 2. Understand the importance of evolution in the study of biology.
More information