Nonlinear lattice dynamics as a basis for enhanced superconductivity in YBa 2 Cu 3 O 6.5
|
|
- Jodie Ward
- 6 years ago
- Views:
Transcription
1 Nonlinear lattice dynamics as a basis for enhanced superconductivity in YBa 2 Cu 3 O 6.5 R.Mankowsky 1*,A.Subedi 2*,M.Först 1,S.O.Mariager 3,M.Chollet 4,H.T.Lemke 4,J.S. Robinson 4,J.M.Glownia 4,M.P.Minitti 4,A.Frano 5,M.Fechner 6,N.A.Spaldin 6,T.Loew 5,B. Keimer 5,A.Georges 2,7,8 anda.cavalleri 1,9,1 *"These"authors"contributed"equally"to"this"work." 1"Max"Planck"Institute"for"the"Structure"and"Dynamics"of"Matter,"22761"Hamburg,"Germany" 2"Centre"de"Physique"Théorique,"École"Polytechnique,"CNRS,"91128"Palaiseau"Cedex,"France" 3"Swiss"Light"Source,"Paul"Scherrer"Institut,"5232"Villigen,"Switzerland" 4"Linac"Coherent"Light"Source,"SLAC"National"Accelerator"Laboratory,"Menlo"Park"9425,"California,"USA" 5 Max"Planck"Institute"for"Solid"State"Research,"7569"Stuttgart,"Germany "" 6"Eidgenössische+Technische+Hochschule+Zürich,+Materials+Theory,+893"Zürich,"Switzerland"" 7"Collège"de"France,"11"place"Marcelin"Berthelot,"755"Paris,"France" 8"Département"de"Physique"de"la"Matière"Condensée"MaNEP,"Université"de"Genève,"1211"Genève,"Switzerland" 9"Department"of"Physics,"Oxford"University,"Clarendon"Laboratory,"Oxford"OX1"3PU,"UK" 1"Center"for"FreebElectron"Laser"Science"CFEL"and"University"of"Hamburg,"22761"Hamburg,"Germany" " THz$frequency optical pulses can resonantly drive selected vibrational modes insolidsanddeformtheircrystalstructure 1,2,3.Incomplexoxides,thismethodhasbeenused to melt electronic orders 4,5,6, drive insulator to metal transitions 7,8 or inducesuperconductivity 9.Strikingly,coherentinterlayertransportstronglyreminiscentofsuperconductivity can be transiently induced up to room temperature in YBa2Cu3O6+x 1,11. By combining femtosecond X$ray diffraction and ab# initio densityfunctionaltheorycalculations,wedetermineherethecrystalstructureofthisexoticnon$equilibrium state. We find that nonlinear lattice excitation in normal$state YBa2Cu3O6+xat1Kcausesastaggereddilation/contractionoftheCu$O2intra/inter$ bilayer distances, accompanied by anisotropic changes in the in$plane O$Cu$O bondbuckling. Density functional theory calculations indicate that these motions cause 1
2 dramaticchangesintheelectronicstructure.amongstthese,theenhancementinthe dx2$y2characterofthein$planeelectronicstructureislikelytofavorsuperconductivity. Theresponseofacrystallatticetostrong,resonantexcitationofaninfraredWactivephonon mode can be described by separating the crystal Hamiltonian into its linear and nonlinear termsh=hlin+hnl.thelinearterm "# = " " describesharmonicoscillationsaboutthe equilibriumatomicpositions,withωirdenotingthefrequencyandqirthenormalcoordinate oftheinfraredwactivemode.inthelimitoflowestorder(cubic)couplingtoothermodeswith generic coordinate QR, the nonlinear term can be written as " = " " " ". In this expression, a12and a21 are anharmonic coupling constants. (See online MethodssectionandExtendedDataFigures1and2fordetailsonnextordercoupling).Fora centrosymmetriccrystallikeyba2cu3o6.5, " iszeroasqirisoddinsymmetrywhile is even.furthermore,as " isofevensymmetry " isnonzeroonlyifqrisevenandhence Ramanactive. Thus,thetotalHamiltonianreducesto = " " + " ",whichpredictsa shiftinthepotentialenergyminimumalongqrforanyfinitedistortion " (seefigure1a). Correspondingly, for a periodically driven QIR mode, the dynamics are described by the coupledequationsofmotion " + 2 " " + " " = + 2 " " and = " ". Figure 1b pictorially represents these dynamics. Upon resonant midwinfrared excitation of QIR,aunidirectionalforceisexertedalongthenormalcoordinateQR,whichisdisplacedbya magnitude proportional to ". This effect remains sizeable only as long as QIR oscillates coherently,typicallyforseveralpicoseconds. 2
3 We next discuss the specific case of YBa2Cu3O6.5,whichcrystallizes in a centrosymmetric orthorhombic unit cell with D2h symmetry, comprising bilayersof conducting CuO2 planes separatedbyaninsulatinglayercontainingyttriumatomsandcuwochainsthatcontrolthe doping of the planes (Fig. 2a). The YBa2Cu3O6.5 sample contained both oxygen rich and oxygen deficient chains, and exhibited shortwrange OrthoWII ordering of the vacancies(fig. 2b).NotealsothattheinWplaneOWCuWObondsarebuckled(Fig.2c). In our experiments, midwinfrared pump pulses of ~3 femtoseconds (fs) durationwere focusedtoamaximumfluenceof~4mj/cm 2 andapeakelectricfieldof~3mv/cm.these pulseswerepolarizedalongthecaxisofyba2cu3o6.5andtunedtoresonancewiththesame 67cm W1 frequency(~15µm,83mev)b1uinfraredwactivemode 12 (seefigure2a)thatwas previously shown by means of timewresolved THz spectroscopy to enhance interlayer superconductingcoupling 1,11. In analyzing the nonlinear lattice dynamics caused by this excitation, we note that the nonlinearterm isnonzeroonlyifqrisofagsymmetry,becausethesquareofthe irreduciblerepresentationofb1uisag.thus,onlyagmodescancoupletotheopticallydriven B1umotionofFigure2a.YBa2Cu3O6.5has72opticalphononmodes,ofwhich33areRaman active.thesecanbefurtherdividedinto22bgmodes,whichbreakinwplanesymmetry,and 11Agmodes,whichpreservethesymmetryoftheunitcell(seeExtendedDataFigure3).The geometries of these 11 Ag modes and their coupling strength to the driven B1u mode were computed using first principles density functional theory calculations within the local densityapproximation.at3mv/cmfieldstrengthofthemidwinfraredpumppulse,weexpect a peakamplitude for theb1u motion corresponding to 2.2pm increase in apical oxygenwcu distance,whichwasusedasabasisto calculate energy potentials of the Ag modes for a frozendistortionofthismagnitude(seefigure3a).onlyfourphononmodesag(15,21,29, 3
4 74) were found to strongly couple to the driven B1u mode, all involving a concerted distortion of the apical oxygen atoms towards the CuO2 plane and an increase in CuWO buckling (Figure 3b). The calculations also predict weak coupling to three further modes Ag(52,53,61),consistingofbreathingmotionoftheoxygenatomsintheplane(Fig.3c).The remainingfourmodesag(14,39,53,65)donotcoupletotheb1umode(seeextendeddata Table1fordetails). To experimentally determine the absolute amplitude of these distortions in the conditions relevant for enhanced superconductivity 1,11, we measured time resolved xwray diffraction using5fs,6.7kevpulsesfromthelclsfreeelectronlaser,whichwassynchronizedtothe optical laser that generated the midwinfrared pump pulses. Changes in diffraction intensity wererecordedforfourbraggpeaksatabasetemperatureof1k,abovetheequilibrium transitiontemperaturetc=52k.thesepeakswereobservedtoeitherincreaseordecrease promptly after excitation (see Figure 4) and to relax within the same timescale as the changesinthethzopticalproperties 1,11.ForeachBraggreflectionwecalculatedchangesin diffraction as function of B1u amplitude considering a displacement of only the four dominantramanmodesag(15,21,29,74)orall11modesoffigure3,takingintoaccount the relative coupling strengths. We simultaneously fitted the four experimental diffraction curvesusingonlytwofreeparameters:theamplitudeofthedirectlydrivenb1umotionand the relative contributions of two exponential relaxation components (τ1 = 1 ps, τ2 = 7 ps) extracted from the THz measurements 1,11. Very similar results were found when consideringonlythefourdominantmodesorallmodes(seegreenandredfittingcurvesin Figure4). The transient lattice structure determined from these fits involves the following elements. Firstly, we observe a decrease in the distance between the apical oxygen and the copper 4
5 atomsofthesuperconductingplanes(figure5).thismotionisfarsmallerandoppositein sign than the difference in the static apical oxygen positions between LaW and HgWbased cuprates,forwhichtcincreasesatequilibrium 13.Therefore,thetransientenhancementof superconducting transport cannot be explained by this analogy. More suggestively, the copperatomsaredrivenawayfromoneanotherwithinthebilayersandtowardoneanother betweendifferentbilayers.thisstaggeredmotionisofapproximately.63%(seefigure5a) and qualitatively follows the decrease in intrawbilayer tunneling and the enhancement of interwbilayer tunneling 1,11. Finally, an anisotropic.32 increase in the inwplane OWCuWO buckling(differentalongaandbaxes)isobserved(seeextendeddatatable2). AlthoughtheJosephsoncouplinginlayeredcupratesinvolvesmanymicroscopicparameters thatarenotkeptintoaccounthere 14,15,16,DFTcalculationsinthedistortedcrystalstructure wereusedtoassessthesalienteffectsontheelectronicproperties (see Extended Data Figures 4 to 6). Our calculations predict an energy lowering of the oxygen deficient chain bandsbyfewtensofmev.becauseatequilibriumthesebandsareveryclosetothefermi level, this small shift strongly reduces the hybridization of the chains with the plane CuW orbital,leadingtoadftfermisurfacewithastrongercu characterandhigherhole doping. This effect is likely to favor superconductivity. We also speculate that as the DFT Fermisurfacechangesshapeandsize,itisquitepossiblethatthatchargedensitywaveorder may also be destabilized 17,18,19, which would also aid superconductivity. The present calculations will serve as a starting point for a full manywbody treatment, to be complemented by more exhaustive experimental characterizations of the transient electronicstructure. Moregenerally,weseenonlinearphononicsasanewtoolfordynamicalmaterialsdiscovery, withopticallatticecontrolprovidingaperturbationwwanalogoustostrain,fieldsorpressure 5
6 WW thatcaninduceexoticcollectiveelectronicbehaviors. KnowledgeofthenonWequilibrium atomic structure byultrafastxwray crystallography, which we provide for the first time in this work, is the essential next step towards engineering these induced behaviors at equilibrium. ReferencesMainText 1 Först,M.etal.Nonlinearphononicsasanultrafastroutetolatticecontrol,Nature"Physics7, 854W856(211). 2 Först, M. et al. Displacive lattice excitation through nonlinear phononics viewed by femtosecondxwraydiffraction,solid"state"communications169,24 27(213) 3 Subedi, A., Cavalleri, A. & Georges, A. Theory of nonlinear phononics for coherent light controlofsolids,physical"review"b89,2231(214) 4 Tobey, R.I. et al. Ultrafast Electronic Phase Transition in La1/2Sr3/2MnO4 by Coherent Vibrational Excitation: Evidence for Nonthermal Melting of Orbital Order, Physical" Review" Letters11,19744(28) 5 Först,M.etal.Drivingmagneticorderinamanganitebyultrafastlatticeexcitation,Physical" Review"B84,24114(211) 6 Först,M.etal.MeltingofChargeStripesinVibrationallyDrivenLa1.875Ba.125CuO4: AssessingtheRespectiveRolesofElectronicandLatticeOrderinFrustrated Superconductors,Physical"Review"Letters112,1572(214) 6
7 7 Caviglia,A.D.etal.UltrafastStrainEngineeringinComplexOxideHeterostructures,Physical" Review"Letters18,13681(212) 8 Rini,M.etal.ControloftheelectronicphaseofamanganitebymodeWselectivevibrational excitation,nature449,72w74(27) 9 Fausti,D.etal.LightWInducedSuperconductivityinaStripeWOrderedCuprate,Science331, 189W191(211) 1 Kaiser, S. et al. Optically induced coherent transport far above Tc in underdoped YBa2Cu3O6+δ,Physical"Review"B89,184516(214) 11 Hu, W. et al. Optically enhanced coherent transport in YBa2Cu3O6.5 by ultrafast redistributionofinterlayercoupling,nature"materials13,75w711(214) 12 Homes,C.C.etal.OpticalpropertiesalongthecWaxisofYBa2Cu3O6+x,forx=.5W>.95 Evolutionofthepseudogap,Physica"C254,265W28(1995).(1995). 13 Pavarini,E.etal.BandWStructureTrendinHoleWDopedCupratesandCorrelationwithTcmax Physical"Review"Letters87,473(211) 14 Shah,N.&Millis,A.J.Superconductivity,phasefluctuationsandthecWaxisconductivityin biwlayerhightemperaturesuperconductors."physical"review"b65,2456(21) 15 Chaloupka,J.,Bernhard,C.&Munzar,D.MicroscopicgaugeinvarianttheoryofthecWaxis infraredresponseofbiwlayercupratesuperconductorsandtheoriginofthe superconductivitywinducedabsorptionbandsphysical"review"b79,184513(29) 7
8 16 Yu,L.etal.EvidenceforTwoSeparateEnergyGapsinUnderdopedHighWTemperature CuprateSuperconductorsfromBroadbandInfraredEllipsometryPhysical"Review"Letters 1,1774(28) 17 Ghiringhelli,G.etal.LongWRangeIncommensurateChargeFluctuationsin (Y,Nd)Ba2Cu3O6+x,Science337,821W825(212). 18 BlancoWCanosa, S. et al. Resonant XWray Scattering Study of Charge Density Wave CorrelationsinYBa2Cu3O6+x.Physical"Review"B9,54513(214) 19 Chang,J.etal.Directobservationofcompetitionbetweensuperconductivityandcharge densitywaveorderinyba2cu3o6.67,nature"physics8,871w876(212) 8
9 A.C. conceived this project. R.M. and M.F. lead the diffraction experiment, supported by S.O.M., M.C., H.T.L., J.S.R., J.M.G., M.P.M., and A.F.. R.M. and A.S. analyzed the data. A.S. performed the DFT calculations, with support from A.G., M.F. and N.A.S.. The sample was grown by T.L and B.K.. R.M. and A.C. wrote the manuscript, with feedback from all coauthors. Acknowledgements The research leading to these results has received funding from the European Research Council under the European Union's Seventh Framework Programme (FP7/27W213) / ERCGrantAgreementn (QMAC).FundingfromthepriorityprogramSFB925ofthe GermanScienceFoundation(DFG)isgratefullyacknowledged. PortionsofthisresearchwerecarriedoutattheLinacCoherentLightSource(LCLS)atthe SLACNationalAcceleratorLaboratory.LCLSisanOfficeofScienceUserFacilityoperatedfor the U.S. Department of Energy Office of Science by Stanford University. This work was supported by the Swiss National Supercomputing Centre (CSCS) un der project ID s44. This work was supported by the Swiss National Science Foundation through its National CenterofCompetencesinResearchMUST. AuthorContributions AuthorInformation CorrespondenceandrequestsformaterialsshouldbeaddressedtoAndreaCavalleri (andrea.cavalleri@mpsd.mpg.de)orromanmankowsky(roman.mankowsky@mpsd.mpg.de) 9
10 Figures a 15 b Q IR V R (a.u.) 1 5 Q R Q R amplitude (a.u.) 3 t Figure1 Coherentnonlinearlatticedynamicsinthelimitofcubiccoupling.a)Astatic distortion " shiftstheequilibriumpotential(dashedline)ofallmodesqr thatarecoupled through " coupling,displacingtheequilibriumpositiontowardsanewminimum(solid line). b) The dynamical response of the two modes involves an oscillatory motion of the infraredmode(redline)andadirectional"displacementofqr (blueline).thedisplacementis proportionalto " andsurvivesaslongasqiriscoherent. 1
11 a Intra Bilayer b c Inter Bilayer c c a Intra Bilayer c a O Cu Y Ba a Figure2 StructureofYBa2Cu3O6.5(a)StructureoforthorhombicYBa2Cu3O6.5andmotions oftheopticallyexcitedb1umode.theschematicontheleftshowsthetwotunnelingregions withinandbetweenthebilayers.(b)cuwochains,whichareeitherfilled(rightcu)orempty (leftcu)intheorthowiistructure.(c)superconductingcuo2planes(blue). 11
12 Figure 3 First principle calculations of cubic coupling between 11 Ag modes anddriven B1u mode. (a) Energy potentials of all Ag modes for a frozen B1u displacement of.14a,correspondingtoachangeinapicaloxygen copperdistanceof2.2pm.thexwaxisis the amplitude of the Ag Eigenvector (u is the atomic mass unit). Arrows indicate the potentialminima.(b)strongcouplingoccurstotheag(15,21,29,74)modes,thatcomprise a decrease in apical oxygenwcopper distance and an increase in inwplane buckling. (c) The Ag(52, 61, 63) modes are weakly coupled and govern a breathing motion of the oxygen atomsinthecuo2plane. 12
13 (211) 1K.4 (14) 1K di/i in %.2. di/i in % time in ps time in ps (211) 1K.4 (24) 1K di/i in %.2. di/i in % time in ps time in ps 2 4 Figure 4 Time dependent diffracted peak intensity for four Bragg reflections. A displacive lattice distortion is observed. The experimental data is fitted (solid curves) by adjustingtheb1uamplitudeandtherelativestrengthofthetworelaxationchannels(τ1=1ps and τ2=7 ps) extracted from the optical experiments of Refs. 1 and 11. The relative amplitudesandsignsofthecurvesaredeterminedfromthecalculatedstructureusingonly thefourstrongestcoupledmodes(green)orallagmodes(red).theerrorbarsareextracted fromthemeasurementsas1wσ(67%)confidenceinterval. 13
14 a b c a c c a b d 2.6 e 6 d (pm) 1 1 intrabilayer interbilayer d/d (%) Buckling (Deg) along a along b 4 2 α/α (%) Time Delay (ps) Time Delay (ps) 8 1 Figure5 Transientlatticestructure.(a)Wefindaconcerteddisplacivelatticedistortion (b,c)withadecreaseintheapicaloxygen Cudistancesby2.4pmatoxygendeficientsites andanincreaseinowcuwobuckling.(d)theintrawbilayerdistanceincreases,whiletheinterw bilayerdistancedecreases.here,thecopperatomsoftheplanesatoxygendeficientchain sites(lefthandsidein(a))areusedtodefinethepositionoftheplanes.(e)theinplaneow CuWObucklingincreasesby5%bothalongaandbatoxygendeficientsites. 14
15 Online$OnlyMethods ExperimentalDetails ThexWraydiffractionmeasurementswerecarriedoutwith6.7keVpulsesattheXWrayPump Probe(XPP) beamline of the Linac Coherent Light Source(LCLS). The energy of the xwrays was selected using a channelwcut Si (111) monochromator with a resolution of 1 ev. The diffractionfromeachpulsewasrecordedindividuallywithoutaveragingusingadiode. ShotW towshotnormalizationtotheintensitymonitorafterthemonochromatorwasusedtocorrect the detected signals for intensity and wavelength fluctuations of the xwray pulses. The experimentwascarriedoutingrazingincidencegeometrywithanangleof5 betweenthexw raysandthesamplesurface. The YBa2Cu3O6.5 sample was excited with midwinfrared pulses pulses of ~3 fs duration, generated by optical parametric downwconversion and differencewfrequency generation of nearwinfrared pulses from a TitaniumWSapphirelaser. These pulses were tuned to 15µm wavelengthwith2µmbandwidth,chosentobeinresonancewiththeb1uphononmode.the measurementwascarriedoutatarepetitionrateof12hz,whiletherepetitionrateofthe midwinfrared pulseswassetto6 Hz. This allowed measuring the equilibrium and excited stateforeachtimedelaytocorrectforanydriftsofthefreeelectronlaser. StructureFactorCalculations Todeducetheamplitudes oftheatomicdisplacementsalongtheeigenvectors oftheag coordinatesfromthechangesinscatteredintensity~ wecalculatedthecorresponding modulation of the structure factors. Specifically, we quantified = exp( ), withbeingthereciprocallatticevectorofthecorrespondingdiffractionpeak,fjtheatomic scattering factor and rj the positions of the jwth atom in the unit cell. By calculating the structure factors for the equilibrium atomic positions = () and the transient structure = () + ", the relative change in diffracted intensity was evaluated as / = /. ThechangesinsignalamplitudearecalculatedforAgamplitudes aspredictedbydensity functionaltheorycalculationsforacertaininfraredamplitude andcomparedwiththe experimentalfindingstodeterminethequantitativevalues. 15
16 Densityfunctionaltheorycalculations The phonon modes and the nonlinear phonon couplings were obtained using density functional theory calculations with planewwave basis sets and projector augmented wave pseudopotentials 2,21 as implemented in the VASP software package 22. The local density approximationwasusedfortheexchangeandcorrelations.weusedacutwoffenergyof95 ev for planewwave expansion and a4 8 4kWpoint grid for the Brillouin zone integration during selfwconsistency. We used the experimental lattice parameters of the YBa2Cu3O6.5 OrthoWII structure, but relaxed the internal coordinates. The interatomic force constants werecalculatedusingthefrozenwphononmethod 23,andthePHONOPYsoftwarepackagewas usedtocalculatethephononfrequenciesandnormalmodes 24.Afterthenormalmodeswere identified,totalenergycalculationswereperformedasafunctionofinfraredqirandraman phononmodeqramplitudestoobtaintheenergysurfaces.thenonwlinearcouplingbetween theirandramanmodeswereobtainedbyfittingtheenergysurfacestothepolynomial: = 1 2 " " " " CouplingstrengthsoftheAgtotheB1umodes TheenergypotentialofanAgRamanmodeinthepresenceofacubicnonWlinearcouplingto aninfraredmodeis = " ".Atequilibrium,whentheIRmodeisnot excited,thepotentialoftheramanmodehasaminimumatqr=becausethestructureis stableatequilibrium.however,whentheirmodeisexcitedexternally,theminimumofthe Ramanmodeshiftsbyanamount " " /.TheminimaoftheAgmodesenergypotentials asobtainedfromdftcalculationsforafrozendisplacementoftheb1umodeof.14a are reportedinextendeddatatable1.themodedisplacementsaregiveninamplitudes of thedimensionlesseigenvectorsofthemodeandhavetheunita,withubeingtheatomic massunit.theatomicdisplacementsduetoanamplitude ofamodeisgivenby =,where isthedisplacementofthejwthatom, isthemassofthisatom,and isthe correspondingcomponentofthenormalwmodevector.notethat isnormalizedand dimensionless. 16
17 ThestaticcrystalstructureofYBa2Cu3O6.5(OrthoWII)isgiveninExtendedDataTable2.The latticeconstants are (a= A, b =3.8722A, c =11.725A ) as determined bysingle crystalxwraydiffractionat1k.thelightinduceddisplacementsoftheatomicpositionsat peakchangeindiffractedintensityarereportedinextendeddatatable2. Transientcrystalstructure Changestotheelectronicstructure The changes of the electronic structure due to the lightwinduced distortions were studied using the generalized fullwpotential method within the local density approximation as implementedinthewien2kpackage 25.ThemuffinWtinradiiof2.35,2.5,1.78,and1.53bohrs wereusedfory,ba,cu,ando,respectively,anda2 4 12kWpointgridwasusedforthe Brillouinzoneintegration.Theplanewavecutoffwassetat "# = 7.,where "# isthe planewavecutoffandisthesmallmuffinwtinradius,i.e.1.53bohrs.thedensityofstates (DOS) was generated with a kWpoint grid. Calculations are presented for the equilibrium structure and the transient displaced structure for three B1u amplitudes: the amplitude.3 A as determined here, the amplitude.8 A as estimated in the experimentofreference1and11aswellasalargeramplitudeof1.2a. Our calculated electronic structure of the equilibrium YBa2Cu3O6.5 (orthowii), shown in Figure2ofthemaintext,issimilartotheonecalculatedpreviously 26,27.Thebandsnearthe Fermi level are derived from the Cu 3d" states from both the planes and chains. The four bands that disperse highly along the path Γare due to the planar Cu states.thebroadbandthatdispersesverylittlealong isduetothecu statesfrom thefilled chain. The oxygen deficient chains that control the hole doping give rise to fairly flatelectronicbandswithdominantcu " and " characterthatareveryclosetothefermi level at the point. The electronic structure calculations predict some hybridization between these bands and the planar Cu bands that creates an antiwcrossing nearin the equilibrium structure, this antiwcrossing is close to the Fermi level, giving rise to pockets withunfilledchaincucharacterinthefermisurface.(seeextendeddatafigures4and5). Thedisplacementsduetothenonlinearcouplingscausenoticeablechangestotheelectronic structurearoundthefermilevel.therearethreemaineffects: (i) The lightwinduced displacements reduce the width of the planar Cu bands, which leadstoanincreaseintheplanarcucontributiontothedosatthefermilevel. (ii) The atomic displacements cause a charge transfer from the planes to the oxygen deficientchains.astheunfilledcuchainbandslowerinenergyandmovebelow thefermilevelwithincreasinglightwinduceddisplacements,theplanarcustates increase in energy, becoming more unoccupied. I.e., there is an effective hole doping of the planar Cu states due to the lightwinduced displacements (see ExtendedDataFigure6). 17
18 (iii) Thechangesintherelativeoccupationsofthebandsalsocauseatopologicalchange in the Fermi surface. The lightwinduced displacements increase the filling of the unfilled chain Cu bands, which decreases the size of the pockets in the Fermi surface. Above a threshold of.8a, the oxygen deficient chain Cu bands become fully filled and the Fermi surface consists solely of twowdimensional planarcuandonewdimensionalfilledchaincusheets. Quarticordercoupling Toverifythatthenonlinearphononcouplingisdominatedbythirdorder,asdiscussedinthe maintext,wecheckedforsignalsfromthenext(fourth)order,describedbytheterm " inthenonlinearhamiltonian: " = 1 2 " " " Asnotedinthetext,whenthedirectlydriveninfraredmodeisofB1usymmetry,thirdorder coupling is nonzero only to modes of Ag symmetry. However, coupling to any mode Qj is allowedthroughq 2 Q 2 coupling,inparticulartoinwplanebgmodes. NotefirstthatsmallamplitudeB1uexcitationswouldsimplyrenormalizethefrequencyofa secondmodeqj.thiscandirectlybededucedfromtheequationofmotion,wherethedriving forceisgivenbythecouplingterm ",whichislinearinqj = 2 " UponQIRdisplacement,theanharmonicallycoupledmodeexperiencesarenormalizationof itsfrequency = 1 2 " /. However, above a thresholdwamplitude ", the frequency of the second mode Qj becomes imaginary 3 andthelatticebecomesunstable.importantly,suchinstabilitycantakeplacein two directions, depending on the random instantaneous state of the system (mode amplitudeqjanditsvelocitydqj"/dt.thismanifestsinachangefromaparabolictoadouble wellenergypotentialasshownintheextendeddatafigure1. Hence, fourth order effects need to be identified by analyzing the diffraction of each individualxwraypulse,whereastheunsortedaverageisexpectedtobezeroevenifquartic 18
19 couplingissizeable.intheexperiment,wesortedallpositiveandnegativedeviationsfrom theaveragesignalofallshotstoobtaintheq 2 Q 2 responseataspecifictimedelay.averaging them separately and subtracting negative from positive deviations then gives the intensity changesfromq 2 Q 2 only. TimeWresolvedxWraydiffractionwasmeasuredforfourBraggreflections,sensitivetoAgand tob2gdisplacements.theresultsoftheseexperimentsareshowninextendeddatafigure2. Within our resolution, we find no evidence of quartic contributions. The amplitude of the infraredmotionisbelowthethresholdbeyondwhichfourthordercouplinginduceslattice displacements. 19
20 ReferencesOnline$OnlyMethods 2 P.E.Blöchl,ProjectoraugmentedWwavemethod,Physical"Review"B5,17953(1994). 21 G.KresseandD.Joubert,FromultrasoftpseudopotentialstotheprojectoraugmentedW wavemethod,physical"review"b59,1758(1999). 22 G.KresseandJ.Furthmüller,EfficientiterativeschemesforabinitiototalWenergy calculationsusingaplanewwavebasisset,physical"review"b54,11169(1996). 23 K.Parlinski,Z.Li,andY.Kawazoe,FirstWPrinciplesDeterminationoftheSoftModeinCubic ZrO2,Physical"Review"Letters78,463(1997). 24 A.Togo,F.Oba,andI.Tanaka,FirstWprinciplescalculationsoftheferroelastictransition betweenrutilewtypeandcacl2wtypesio2athighpressures,physical"review"b78,13416 (28). 25 P.Blaha,K.Schwarz,G.Madsen,D.Kvasnicka,andJ.Luitz,WIEN2k,AnAugmentedPlane Wave+LocalOrbitalsProgramforCalculatingCrystalProperties(K.Schwarz,Tech.Univ. Wien,Austria,21). 26 A.CarringtonandE.A.Yelland,BandWstructurecalculationsofFermiWsurfacepocketsin orthowiiyba2cu3o6.5,physical"review"b76,1458(r)(27). 27 I.S.Elfimov,G.A.Sawatzky,andA.Damascelli,TheoryofFermiWsurfacepocketsand correlationeffectsinunderdopedyba2cu3o6.5physical"review"b77,654(r)(28). 2
21 a 15 b 15 V R (a.u.) 1 5 V j (a.u.) Q R amplitude (a.u.) Q j amplitude (a.u.) ExtendedDataFigureandTableLegends ExtendedDataFigure1 Nonlinearlatticedynamicsinthelimitofcubicandquarticcoupling.Dashedlines:PotentialenergyofamodeQasafunctionofmodeamplitude.a)A static distortion " shifts the potential of all modes QRthat are coupled through a " coupling,(solidline)displacingtheequilibriumpositiontowardsanewminimum.b)dueto quartic " coupling,theenergypotentialofacoupledmodeqjisdeformedsymmetrically upon static distortion ". The frequency of the mode first softens until it is destabilized, whichmanifestsinadoublewellpotential(solidline). 21
22 (211) 1K.4 (14) 1K di/i in %.2. di/i in % time in ps time in ps (211) 1K.4 (24) 1K di/i in %.2. di/i in % time in ps time in ps 2 4 Extended Data Figure 2 Changes in diffracted intensity of specific Bragg reflections fromfourthordercouplingfordifferenttimedelaysbetweenpumpandprobepulse. Wefindnoevidenceoflatticedistortionsoriginatingfromfourthordercontributionstothe phonon coupling. The amplitude of the infrared mode QIR is below the threshold beyond whichfourthordereffectsdestabilizecoupledphononmodes.theerrorbarsareextracted fromthemeasurementsas1wσ(67%)confidenceinterval. 22
23 A g cm 1 A g cm 1 A g cm 1 A g cm 1 A g cm 1 A g cm 1 A g cm 1 A g cm 1 A g cm 1 A g cm 1 A g cm 1 B 1u cm 1 ExtendedDataFigure3 PhononmodesofOrtho$IIYBa2Cu3O6.5.Shownaresketchesof the resonantly excited B1u mode and all 11 Ag modes to which the coupling strengths (reportedinextendeddatatable1)havebeencalculated. 23
24 a 2 b 2 Energy (ev) 1 E F Energy (ev) 1 E F 1 1 Γ X S Y Γ Z Γ X S Y Γ Z ExtendedDataFigure4 Bandstructureoftheequilibrium(blackline)andtransientcrystal structure. The band structure is plotted along Γ,,.5,,.5,.5,,.5, Γ,, Z(,,.5) a) for.8 A, which is the amplitudeestimatedforthegeometryofreference1and11andb)1.2a B1u. 24
25 π b π b k y k y π π b π k π b π x k π a a a x a ExtendedDataFigure5 kz=cutofthefermisurfaceoftheequilibrium(blackline) andtransientcrystalstructure(reddashedline).intheequilibriumstructure,thebands of the unfilled chain Cu give rise to pockets in the Fermi surface. The light induced displacements shift the density of states of these bands to lower energies, increasing the filling andreducingthepockets. Above a threshold of.8a, the oxygen deficient chain bands become fully filled, the pockets close and the Fermi surface consists solely of twow dimensionalplanarcuandonewdimensionalfilledchainstates.thefermisurfaceisshown inthedisplacedstateforb).8a andb)1.2a B1uamplitude. 25
26 a b DOS (a.u.) Empty chain Cu Equilibrium.3 B1u.8 B1u 1.2 B1u DOS (a.u.) Inplane Cu empty chain Equilibrium.3 B1u.8 B1u 1.2 B1u Energy (ev) Energy (ev) c d DOS (a.u.) Filled chain Cu Equilibrium.3 B1u.8 B1u 1.2 B1u DOS (a.u.) Equilibrium.3 B1u.8 B1u 1.2 B1u Energy (ev) Energy (ev) ExtendedDataFigure6 ChangesinthedensityofstatesintheCuO2planeandtheCu O chains. These are obtained from a projection of the density of states onto the copper muffinwtin spheres. a, b, In the lightwinduced state, the density of states of the OWdeficient chainlowersinenergy(a),whereastheoppositeeffectisobservedforthecuintheplane below (b). This corresponds to charge transfer from the planes to the chains. c, d, The density of states of the filled chain Cu is not strongly affected(c). The bands of the planar Cuatoms narrow, which leads to an increase in the density of states near the Fermi level both at sites with filled (d) and empty chains (b). The effect is already visible for a QB1u amplitude of.3a (blue) but becomes more prominent for larger displacements of.8a (purple)and1.2a (green). 26
27 Mode Displacement Ag14.2 Ag15.31 Ag21.38 Ag29.23 Ag39. Ag52.7 Ag53. Ag61.7 Ag63.7 Ag65.1 Ag74.2 A u ExtendedDataTable1 Modedisplacements A EnergypotentialminimaoftheAg modesasobtainedfromdftcalculationsforafrozendisplacementoftheb1umodeof.14a,whichcorrespondstoachangeinapicaloxygen copperdistanceof2.2pm. 27
28 Equilibrium Structure (Å) Displacements (pm).3å u Displacements (pm).8å u Displacements (pm) 1.2Å u Atom x y z x y z x y z x y z Y Y Ba Ba Ba Ba Cu Cu Cu Cu Cu Cu O O O O O O O O O O O O O Extended Data Table 2 Equilibrium structure of YBa2Cu3O6.5 and light induceddisplacements. Atomic positions are given in Ångström (x,y,z), thelightwinduced atomic displacementsinpm. 28
Optically enhanced coherent transport in YBa 2 Cu 3 O 6.5 by ultrafast redistribution of interlayer coupling
Optically enhanced coherent transport in YBa 2 Cu 3 O 6.5 by ultrafast redistribution of interlayer coupling W. Hu 1*, S. Kaiser 1*, D. Nicoletti 1*, C.R. Hunt 1,4*, I. Gierz 1, M. C. Hoffmann 1, M. Le
More informationYBCO. CuO 2. the CuO 2. planes is controlled. from deviation from. neutron. , blue star for. Hg12011 (this work) for T c = 72
Supplementary Figure 1 Crystal structures and joint phase diagram of Hg1201 and YBCO. (a) Hg1201 features tetragonal symmetry and one CuO 2 plane per primitive cell. In the superconducting (SC) doping
More informationSUPPLEMENTARY INFORMATION
doi:1.138/nature9829 Supplementary Information S1: Movie of the photo-induced phase transition: Figures 2b-e show four selected XUV ARPES snapshots illustrating the most pronounced changes in the course
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/331/6014/189/dc1 Supporting Online Material for Light-Induced Superconductivity in a Stripe-Ordered Cuprate D. Fausti,* R. I. Tobey, N. Dean, S. Kaiser, A. Dienst, M.
More informationElectronic Squeezing by Optically Pumped Phonons: Transient Superconductivity in K 3 C 60. With: Eli Wilner Dante Kennes Andrew Millis
Electronic Squeezing by Optically Pumped Phonons: Transient Superconductivity in K 3 C 60 With: Eli Wilner Dante Kennes Andrew Millis Background: Mean-Field Theory of Simple Superconductivity If the effective
More informationTransient lattice dynamics in fs-laser-excited semiconductors probed by ultrafast x-ray diffraction
Transient lattice dynamics in fs-laser-excited semiconductors probed by ultrafast x-ray diffraction K. Sokolowski-Tinten, M. Horn von Hoegen, D. von der Linde Inst. for Laser- and Plasmaphysics, University
More informationLight Induced High Temperature Superconductivity
Light Induced High Temperature Superconductivity Daniele Nicoletti Hamburg, Germany SYNQUANT Designer Quantum Systems Out of Equilibrium KITP Santa Barbara November 15 th 016 Outline o Resonant excitation
More informationSupporting information for the manuscript. Excited state structural evolution during charge-transfer reactions in Betaine-30
Electronic Supplementary Material (ESI) for Physical Chemistry Chemical Physics. This journal is the Owner Societies 2015 Supporting information for the manuscript Excited state structural evolution during
More informationDynamics of fluctuations in high temperature superconductors far from equilibrium. L. Perfetti, Laboratoire des Solides Irradiés, Ecole Polytechnique
Dynamics of fluctuations in high temperature superconductors far from equilibrium L. Perfetti, Laboratoire des Solides Irradiés, Ecole Polytechnique Superconductors display amazing properties: Dissipation-less
More informationTime-resolved Diffuse Scattering: phonon spectoscopy with ultrafast x rays
Time-resolved Diffuse Scattering: phonon spectoscopy with ultrafast x rays David A. Reis PULSE Institute, Departments of Photon Science and Applied Physics, Stanford University SLAC National Accelerator
More informationNonlinear phononics: A new ultrafast route to lattice control
Nonlinear phononics: A new ultrafast route to lattice control M. Först 1*, C. Manzoni 1#, S. Kaiser 1, Y. Tomioka, Y. Tokura 3, R. Merlin 4, and A. Cavalleri 1* 1) Max-Planck Research Group for Structural
More informationSECOND PUBLIC EXAMINATION. Honour School of Physics Part C: 4 Year Course. Honour School of Physics and Philosophy Part C C3: CONDENSED MATTER PHYSICS
A11046W1 SECOND PUBLIC EXAMINATION Honour School of Physics Part C: 4 Year Course Honour School of Physics and Philosophy Part C C3: CONDENSED MATTER PHYSICS TRINITY TERM 2015 Wednesday, 17 June, 2.30
More informationNovember 16, 2015 ISS 2015 (Funabori, Tokyo) Road to Higher T. S. Uchida, Univ of Tokyo, 2. AIST, Tsukuba, 3. IOP-CAS, Beijing
Road to Higher T November 16, 2015 ISS 2015 (Funabori, Tokyo) S. Uchida, 1 Univ of Tokyo, 2 AIST, Tsukuba, 3 IOP-CAS, Beijing T c stopped rising in 1993 (more than 20 years silence ), but signatures of
More informationAstronomy, The Johns Hopkins University, Baltimore, Maryland 21218, USA
Cuprate superconductors: Dynamic stabilization? Enhancing the temperature at which superconductivity is observed is a long-standing objective for materials scientists. Recent tantalizing experiments suggest
More informationUltrafast Dynamics in Complex Materials
Ultrafast Dynamics in Complex Materials Toni Taylor MPA CINT, Center for Integrated Nanotechnologies Materials Physics and Applications Division Los Alamos National Laboratory Workshop on Scientific Potential
More informationDensity-matrix theory for time-resolved dynamics of superconductors in non-equilibrium
Max Planck Institute for Solid State Research Density-matrix theory for time-resolved dynamics of superconductors in non-equilibrium co-workers and papers: (1) (2) (3) (4) Dirk Manske A. Knorr (TU Berlin),
More informationWhat's so unusual about high temperature superconductors? UBC 2005
What's so unusual about high temperature superconductors? UBC 2005 Everything... 1. Normal State - doped Mott insulator 2. Pairing Symmetry - d-wave 2. Short Coherence Length - superconducting fluctuations
More informationMulti-Dimensional IR Spectroscopy of Acetic Acid Dimers and Liquid Water
Multi-Dimensional IR Spectroscopy of Acetic Acid Dimers and Liquid Water N. Huse 1, J. Dreyer 1, E.T.J.Nibbering 1, T. Elsaesser 1 B.D. Bruner 2, M.L. Cowan 2, J.R. Dwyer 2, B. Chugh 2, R.J.D. Miller 2
More informationUltrafast X-ray Spectroscopy of Solvated Transition-metal Complexes and Oxide Materials
Ultrafast X-ray Spectroscopy of Solvated Transition-metal Complexes and Oxide Materials Robert Schoenlein Materials Sciences Division Chemical Sciences Division - UXSL Matteo Rini ils Huse F. Reboani &
More informationNonlinear Electrodynamics and Optics of Graphene
Nonlinear Electrodynamics and Optics of Graphene S. A. Mikhailov and N. A. Savostianova University of Augsburg, Institute of Physics, Universitätsstr. 1, 86159 Augsburg, Germany E-mail: sergey.mikhailov@physik.uni-augsburg.de
More informationNeutron scattering from quantum materials
Neutron scattering from quantum materials Bernhard Keimer Max Planck Institute for Solid State Research Max Planck UBC UTokyo Center for Quantum Materials Detection of bosonic elementary excitations in
More informationSECOND PUBLIC EXAMINATION. Honour School of Physics Part C: 4 Year Course. Honour School of Physics and Philosophy Part C C3: CONDENSED MATTER PHYSICS
2753 SECOND PUBLIC EXAMINATION Honour School of Physics Part C: 4 Year Course Honour School of Physics and Philosophy Part C C3: CONDENSED MATTER PHYSICS TRINITY TERM 2011 Wednesday, 22 June, 9.30 am 12.30
More informationCoherent Lattice Vibrations in Mono- and Few-Layer. WSe 2. Supporting Information for. 749, Republic of Korea
Supporting Information for Coherent Lattice Vibrations in Mono- and Few-Layer WSe 2 Tae Young Jeong, 1,2 Byung Moon Jin, 1 Sonny H. Rhim, 3 Lamjed Debbichi, 4 Jaesung Park, 2 Yu Dong Jang, 1 Hyang Rok
More informationResonant Inelastic X-ray Scattering on elementary excitations
Resonant Inelastic X-ray Scattering on elementary excitations Jeroen van den Brink Ament, van Veenendaal, Devereaux, Hill & JvdB Rev. Mod. Phys. 83, 705 (2011) Autumn School in Correlated Electrons Jülich
More informationSUPPLEMENTARY INFORMATION
Supplementary Methods Materials Synthesis The In 4 Se 3-δ crystal ingots were grown by the Bridgeman method. The In and Se elements were placed in an evacuated quartz ampoule with an excess of In (5-10
More informationSimple strategy for enhancing terahertz emission from coherent longitudinal optical phonons using undoped GaAs/n-type GaAs epitaxial layer structures
Presented at ISCS21 June 4, 21 Session # FrP3 Simple strategy for enhancing terahertz emission from coherent longitudinal optical phonons using undoped GaAs/n-type GaAs epitaxial layer structures Hideo
More informationSet-up for ultrafast time-resolved x-ray diffraction using a femtosecond laser-plasma kev x-ray-source
Set-up for ultrafast time-resolved x-ray diffraction using a femtosecond laser-plasma kev x-ray-source C. Blome, K. Sokolowski-Tinten *, C. Dietrich, A. Tarasevitch, D. von der Linde Inst. for Laser- and
More informationIdentify two CDW amplitude modes with extremely small energy scales in LaAgSb2 by ultrafast pump-probe measurement
IMPACT 2016, Cargese, France ICQM International Center for Quantum Materials Identify two CDW amplitude modes with extremely small energy scales in LaAgSb2 by ultrafast pump-probe measurement Nan-Lin Wang
More informationSUPPLEMENTARY INFORMATION
An effective magnetic field from optically driven phonons T. F. Nova 1 *, A. Cartella 1, A. Cantaluppi 1, M. Först 1, D. Bossini 2 #, R. V. Mikhaylovskiy 2, A.V. Kimel 2, R. Merlin 3 and A. Cavalleri 1,
More informationNanoacoustics II Lecture #2 More on generation and pick-up of phonons
Nanoacoustics II Lecture #2 More on generation and pick-up of phonons Dr. Ari Salmi www.helsinki.fi/yliopisto 26.3.2018 1 Last lecture key points Coherent acoustic phonons = sound at nanoscale Incoherent
More informationUltrafast study of Dirac fermions in out of equilibrium Topological Insulators
Ultrafast study of Dirac fermions in out of equilibrium Topological Insulators Marino Marsi Laboratoire de Physique des Solides CNRS Univ. Paris-Sud - Université Paris-Saclay IMPACT, Cargèse, August 26
More informationUltrafast surface carrier dynamics in topological insulators: Bi 2 Te 3. Marino Marsi
Ultrafast surface carrier dynamics in topological insulators: Bi 2 Te 3 Marino Marsi Laboratoire de Physique des Solides CNRS UMR 8502 - Université Paris-Sud IMPACT, Orsay, September 2012 Outline Topological
More informationParametric amplification of optical phonons
Parametric amplification of optical phonons A. Cartella 1, T. F. Nova 1,2, M. Fechner 1, R. Merlin 3 and A. Cavalleri 1,2,4 * 1Max Planck Institute for the Structure and Dynamics of Matter, Hamburg, Germany
More informationTime-Resolved and Momentum-Resolved Resonant Soft X-ray Scattering on Strongly Correlated Systems
Time-Resolved and Momentum-Resolved Resonant Soft X-ray Scattering on Strongly Correlated Systems Wei-Sheng Lee Stanford Institute of Material and Energy Science (SIMES) SLAC & Stanford University Collaborators
More informationLast Lecture. Overview and Introduction. 1. Basic optics and spectroscopy. 2. Lasers. 3. Ultrafast lasers and nonlinear optics
Last Lecture Overview and Introduction 1. Basic optics and spectroscopy. Lasers 3. Ultrafast lasers and nonlinear optics 4. Time-resolved spectroscopy techniques Jigang Wang, Feb, 009 Today 1. Spectroscopy
More informationPhonon calculations with SCAN
Workshop on the SCAN density functional: Fundamentals, practices, and extensions Temple university, Philadelphia May 18th, 2017 Hands-on tutorial 3 Phonon calculations with SCAN Yubo Zhang and Jianwei
More informationSupplementary Information
Supplementary Information Supplementary Figure 1: Electronic Kohn-Sham potential profile of a charged monolayer MoTe 2 calculated using PBE-DFT. Plotted is the averaged electronic Kohn- Sham potential
More informationExcitation of Coherent Phonons in Crystalline Bi: Theory for Driving Atomic Vibrations by Femtosecond Pulses
Mater. Res. Soc. Symp. Proc. Vol. 116 27 Materials Research Society 116-CC6-3 Excitation of Coherent Phonons in Crystalline Bi: Theory for Driving Atomic Vibrations by Femtosecond Pulses Davide Boschetto
More informationGeneration of Thermal Scattering Laws for YH 2 using Ab Initio Methods
Generation of Thermal Scattering Laws for YH 2 using Ab Initio Methods Michael L. Zerkle Bettis Atomic Power Laboratory WPEC SG42 Meeting May 18, 2015 May 18-19, 2015 WPEC SG42 Slide 1 Outline Motivation
More informationFYS Vår 2017 (Kondenserte fasers fysikk)
FYS3410 - Vår 2017 (Kondenserte fasers fysikk) http://www.uio.no/studier/emner/matnat/fys/fys3410/v16/index.html Pensum: Introduction to Solid State Physics by Charles Kittel (Chapters 1-9, 11, 17, 18,
More informationTopological band-order transition and quantum spin Hall edge engineering in functionalized X-Bi(111) (X = Ga, In, and Tl) bilayer
Supplementary Material Topological band-order transition and quantum spin Hall edge engineering in functionalized X-Bi(111) (X = Ga, In, and Tl) bilayer Youngjae Kim, Won Seok Yun, and J. D. Lee* Department
More informationReal time observation of cuprates structural dynamics by Ultrafast Electron Crystallography
Advances in Condensed Matter Physics, vol. 2010, Article ID 958618, 27 pages, (2010). doi:10.1155/2010/958618. Real time observation of cuprates structural dynamics by Ultrafast Electron Crystallography
More informationSfb 658 Colloquium 11 May Part II. Introduction to Two-Photon-Photoemission (2PPE) Spectroscopy. Martin Wolf
Sfb 658 Colloquium 11 May 2006 Part II Introduction to Two-Photon-Photoemission (2PPE) Spectroscopy Martin Wolf Motivation: Electron transfer across interfaces key step for interfacial and surface dynamics
More informationDynamics of electrons in surface states with large spin-orbit splitting. L. Perfetti, Laboratoire des Solides Irradiés
Dynamics of electrons in surface states with large spin-orbit splitting L. Perfetti, Laboratoire des Solides Irradiés Outline Topology of surface states on the Bi(111) surface Spectroscopy of electronic
More informationPhysics with Neutrons I, WS 2015/2016. Lecture 11, MLZ is a cooperation between:
Physics with Neutrons I, WS 2015/2016 Lecture 11, 11.1.2016 MLZ is a cooperation between: Organization Exam (after winter term) Registration: via TUM-Online between 16.11.2015 15.1.2015 Email: sebastian.muehlbauer@frm2.tum.de
More informationDoctor of Philosophy
FEMTOSECOND TIME-DOMAIN SPECTROSCOPY AND NONLINEAR OPTICAL PROPERTIES OF IRON-PNICTIDE SUPERCONDUCTORS AND NANOSYSTEMS A Thesis Submitted for the degree of Doctor of Philosophy IN THE FACULTY OF SCIENCE
More informationScientific opportunities with ultrafast electron diffraction & microscopy
Scientific opportunities with ultrafast electron diffraction & microscopy Jim Cao Frontier of ultrafast science MeV UED Transition pathways Rate and time scale Elementary steps Probe dynamics on the atomic
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11231 Materials and Methods: Sample fabrication: Highly oriented VO 2 thin films on Al 2 O 3 (0001) substrates were deposited by reactive sputtering from a vanadium target through reactive
More informationSOLID STATE PHYSICS. Second Edition. John Wiley & Sons. J. R. Hook H. E. Hall. Department of Physics, University of Manchester
SOLID STATE PHYSICS Second Edition J. R. Hook H. E. Hall Department of Physics, University of Manchester John Wiley & Sons CHICHESTER NEW YORK BRISBANE TORONTO SINGAPORE Contents Flow diagram Inside front
More informationSupplementary Materials
Supplementary Materials Sample characterization The presence of Si-QDs is established by Transmission Electron Microscopy (TEM), by which the average QD diameter of d QD 2.2 ± 0.5 nm has been determined
More informationQuantum Condensed Matter Physics Lecture 9
Quantum Condensed Matter Physics Lecture 9 David Ritchie QCMP Lent/Easter 2018 http://www.sp.phy.cam.ac.uk/drp2/home 9.1 Quantum Condensed Matter Physics 1. Classical and Semi-classical models for electrons
More informationThe Hubbard model out of equilibrium - Insights from DMFT -
The Hubbard model out of equilibrium - Insights from DMFT - t U Philipp Werner University of Fribourg, Switzerland KITP, October 212 The Hubbard model out of equilibrium - Insights from DMFT - In collaboration
More informationQuantum Condensed Matter Physics Lecture 5
Quantum Condensed Matter Physics Lecture 5 detector sample X-ray source monochromator David Ritchie http://www.sp.phy.cam.ac.uk/drp2/home QCMP Lent/Easter 2019 5.1 Quantum Condensed Matter Physics 1. Classical
More informationUltrafast Spectroscopy of Semiconductors and Semiconductor Nanostructures
Springer Series in Solid-State Sciences 115 Ultrafast Spectroscopy of Semiconductors and Semiconductor Nanostructures Bearbeitet von Jagdeep Shah erweitert 1999. Buch. xvi, 522 S. Hardcover ISBN 978 3
More informationGeneral theory of diffraction
General theory of diffraction X-rays scatter off the charge density (r), neutrons scatter off the spin density. Coherent scattering (diffraction) creates the Fourier transform of (r) from real to reciprocal
More informationA theoretical study of the single-molecule transistor
A theoretical study of the single-molecule transistor B. C. Friesen Department of Physics, Oklahoma Baptist University, Shawnee, OK 74804 J. K. Ingersent Department of Physics, University of Florida, Gainesville,
More informationPlan of the lectures
Plan of the lectures 1. Introductory remarks on metallic nanostructures Relevant quantities and typical physical parameters Applications. Linear electron response: Mie theory and generalizations 3. Nonlinear
More informationSuperconductivity Induced Transparency
Superconductivity Induced Transparency Coskun Kocabas In this paper I will discuss the effect of the superconducting phase transition on the optical properties of the superconductors. Firstly I will give
More informationrequires going beyond BCS theory to include inelastic scattering In conventional superconductors we use Eliashberg theory to include the electron-
MECHANISM requires going beyond BCS theory to include inelastic scattering In conventional superconductors we use Eliashberg theory to include the electron- A serious limitation of BCS theory is that it
More informationThe Initial Process of Photoinduced Phase Transition in an Organic Electron-Lattice Correlated System using 10-fs Pulse
The Initial Process of Photoinduced Phase Transition in an Organic Electron-Lattice Correlated System using 1-fs Pulse S. Koshihara, K. Onda, Y. Matsubara, T. Ishikawa, Y. Okimoto, T. Hiramatsu, G. Saito,
More informationTime-Resolved X-Ray Diffraction Study on Superconducting YBa 2 Cu 3 O 7 Epitaxially Grown on SrTiO 3
Time-Resolved X-Ray Diffraction Study on Superconducting YBa 2 Cu 3 O 7 Epitaxially Grown on SrTiO 3 Dissertation zur Erlangung des akademischen Grades doctor rerum naturalium (Dr. rer. nat.) vorgelegt
More informationOptical Spectroscopy of Advanced Materials
Phys 590B Condensed Matter Physics: Experimental Methods Optical Spectroscopy of Advanced Materials Basic optics, nonlinear and ultrafast optics Jigang Wang Department of Physics, Iowa State University
More informationPhonon Dispersion, Interatomic Force Constants Thermodynamic Quantities
Phonon Dispersion, Interatomic Force Constants Thermodynamic Quantities Umesh V. Waghmare Theoretical Sciences Unit J N C A S R Bangalore ICMR OUTLINE Vibrations and interatomic force constants (IFC) Extended
More informationNeutron and x-ray spectroscopy
Neutron and x-ray spectroscopy B. Keimer Max-Planck-Institute for Solid State Research outline 1. self-contained introduction neutron scattering and spectroscopy x-ray scattering and spectroscopy 2. application
More informationUltrafast Structural Dynamics in Solids Klaus Sokolowski-Tinten
Ultrafast Structural Dynamics in Solids Klaus Sokolowski-Tinten Institut für Experimentelle Physik STI Round-Table Meeting, Hamburg, 22. - 24. Juni 2004 Outline motivation: why short pulses and the XFEL
More informationThe MID instrument.
The MID instrument International Workshop on the Materials Imaging and Dynamics Instrument at the European XFEL Grenoble, Oct 28/29, 2009 Thomas Tschentscher thomas.tschentscher@xfel.eu Outline 2 History
More informationHigh-Speed Quadratic Electrooptic Nonlinearity in dc-biased InP
Vol. 107 (2005) ACTA PHYSICA POLONICA A No. 2 Proceedings of the 12th International Symposium UFPS, Vilnius, Lithuania 2004 High-Speed Quadratic Electrooptic Nonlinearity in dc-biased InP L. Subačius a,,
More informationHarald Ibach Hans Lüth SOLID-STATE PHYSICS. An Introduction to Theory and Experiment
Harald Ibach Hans Lüth SOLID-STATE PHYSICS An Introduction to Theory and Experiment With 230 Figures Springer-Verlag Berlin Heidelberg New York London Paris Tokyo Hong Kong Barcelona Budapest Contents
More informationSI 1. Figure SI 1.1 CuCl 4
Electronic Supplementary Material (ESI) for Dalton Transactions. This journal is The Royal Society of Chemistry 2014 SI 1 FFT analysis of residuals was carried out. The residuals were obtained by fitting
More information1 Mathematical description of ultrashort laser pulses
1 Mathematical description of ultrashort laser pulses 1.1 We first perform the Fourier transform directly on the Gaussian electric field: E(ω) = F[E(t)] = A 0 e 4 ln ( t T FWHM ) e i(ω 0t+ϕ CE ) e iωt
More informationA Twisted Ladder: Relating the Iron Superconductors and the High-Tc Cuprates
A Twisted Ladder: Relating the Iron Superconductors and the High-Tc Cuprates arxiv:0905.1096, To appear in New. J. Phys. Erez Berg 1, Steven A. Kivelson 1, Doug J. Scalapino 2 1 Stanford University, 2
More informationSupporting information for Metal-semiconductor. nanoparticle hybrids formed by self-organization: a platform to address exciton-plasmon coupling
Supporting information for Metal-semiconductor nanoparticle hybrids formed by self-organization: a platform to address exciton-plasmon coupling Christian Strelow, T. Sverre Theuerholz, Christian Schmidtke,
More informationUltra-fast photoinduced gigantic metallization in quarter filled organic A 2 B salts: (EDO-TTF) 2 PF 6
Ultra-fast photoinduced gigantic metallization in quarter filled organic A 2 B salts: (EDO-TTF) 2 PF 6 Laurent Guérin, Matthieu Chollet, N. Uchida, S. Fukaya, T. Ishikawa,S. Koshihara, Tokyo Institute
More informationBrookhaven National Laboratory, Upton, NY. Abstract. We report femtosecond resonant soft X-ray diffraction measurements of the dynamics of
Melting of Charge Stripes in Vibrationally Driven La 1.875 Ba 0.125 CuO 4 : Assessing the Respective Roles of Electronic and Lattice Order in Frustrated Superconductors M. Först 1*, R.I. Tobey 2, H. Bromberger
More informationImpact of charge order on the electronic properties of underdoped cuprates Cyril PROUST
Impact of charge order on the electronic properties of underdoped cuprates Cyril PROUST Laboratoire National des Champs Magnétiques Intenses Toulouse, France Collaborations F. Laliberté W. Tabis D. Vignolles
More informationPersistent spin helix in spin-orbit coupled system. Joe Orenstein UC Berkeley and Lawrence Berkeley National Lab
Persistent spin helix in spin-orbit coupled system Joe Orenstein UC Berkeley and Lawrence Berkeley National Lab Persistent spin helix in spin-orbit coupled system Jake Koralek, Chris Weber, Joe Orenstein
More informationSupplementary Materials for
www.advances.sciencemag.org/cgi/content/full/1/5/e1400173/dc1 Supplementary Materials for Exploration of metastability and hidden phases in correlated electron crystals visualized by femtosecond optical
More informationSearch for conducting stripes in lightly hole doped YBCO
Search for conducting stripes in lightly hole doped YBCO András Jánossy 1, Titusz Fehér 1,2 Kálmán Nagy 1 Andreas Erb 3 László Mihály 4 1 Budapest University of Technology and Economics, Institute of Physics
More informationProbing and Driving Molecular Dynamics with Femtosecond Pulses
Miroslav Kloz Probing and Driving Molecular Dynamics with Femtosecond Pulses (wavelengths above 200 nm, energies below mj) Why femtosecond lasers in biology? Scales of size and time are closely rerated!
More informationELEMENTARY BAND THEORY
ELEMENTARY BAND THEORY PHYSICIST Solid state band Valence band, VB Conduction band, CB Fermi energy, E F Bloch orbital, delocalized n-doping p-doping Band gap, E g Direct band gap Indirect band gap Phonon
More informationValley-Specific Hot Phonon and Carrier Relaxation Pathways in Si(100) Determined by Transient Extreme Ultraviolet Spectroscopy
Valley-Specific Hot Phonon and Carrier Relaxation Pathways in Si(100) Determined by Transient Extreme Ultraviolet Spectroscopy Scott K. Cushing 1,2, Michael Zürch 1, Peter M. Kraus 1, Lucas M. Carneiro
More informationPossible phonon-induced electronic bi-stability in VO 2 for ultrafast memory at room temperature
arxiv:1901.08139v1 [cond-mat.str-el] 23 Jan 2019 Possible phonon-induced electronic bi-stability in VO 2 for ultrafast memory at room temperature Cédric Weber, 1 Swagata Acharya, 1 Brian Cunningham 2,
More informationRichard Miles and Arthur Dogariu. Mechanical and Aerospace Engineering Princeton University, Princeton, NJ 08540, USA
Richard Miles and Arthur Dogariu Mechanical and Aerospace Engineering Princeton University, Princeton, NJ 08540, USA Workshop on Oxygen Plasma Kinetics Sept 20, 2016 Financial support: ONR and MetroLaser
More informationLattice Vibrations. Chris J. Pickard. ω (cm -1 ) 200 W L Γ X W K K W
Lattice Vibrations Chris J. Pickard 500 400 300 ω (cm -1 ) 200 100 L K W X 0 W L Γ X W K The Breakdown of the Static Lattice Model The free electron model was refined by introducing a crystalline external
More informationNature, Vol 458, 2009 Leon Camenzind FMM University of Basel,
Nature, Vol 458, 2009 Leon Camenzind University of Basel, 17.6.2011 Outlook Part I: Transient (Spin)-Grating Spectroscopy Part II: Theory of Persistent Spin Helix (PSH) Experimental results Part I Transient
More informationProbing dynamics in quantum materials with femtosecond x-rays
Probing dynamics in quantum materials with femtosecond x-rays M. Buzzi, M. Först, R. Mankowsky, A. Cavalleri Max Planck Institute for the Structure and Dynamics of Matter, Hamburg, Germany Optical pulses
More informationTheory of selective excitation in stimulated Raman scattering
Theory of selective excitation in stimulated Raman scattering S. A. Malinovskaya, P. H. Bucksbaum, and P. R. Berman Michigan Center for Theoretical Physics, FOCUS Center, and Department of Physics, University
More informationGraphene for THz technology
Graphene for THz technology J. Mangeney1, J. Maysonnave1, S. Huppert1, F. Wang1, S. Maero1, C. Berger2,3, W. de Heer2, T.B. Norris4, L.A. De Vaulchier1, S. Dhillon1, J. Tignon1 and R. Ferreira1 1 Laboratoire
More informationSupporting Materials
Supporting Materials Figure S1 Experimental Setup Page Figure S (a) (b) (c) Feynman Diagrams Page 3-6 Figure S3 D IR Spectra Page 7 Figure S4 Kinetic Model Page 8 Figure S5 Van t Hoff Plots Page 9 1 k
More informationThis manuscript was submitted first in a reputed journal on Apri1 16 th Stanene: Atomically Thick Free-standing Layer of 2D Hexagonal Tin
This manuscript was submitted first in a reputed journal on Apri1 16 th 2015 Stanene: Atomically Thick Free-standing Layer of 2D Hexagonal Tin Sumit Saxena 1, Raghvendra Pratap Choudhary, and Shobha Shukla
More informationIntraband emission of GaN quantum dots at λ =1.5 μm via resonant Raman scattering
Intraband emission of GaN quantum dots at λ =1.5 μm via resonant Raman scattering L. Nevou, F. H. Julien, M. Tchernycheva, J. Mangeney Institut d Electronique Fondamentale, UMR CNRS 8622, University Paris-Sud
More informationRoger Johnson Structure and Dynamics: Displacive phase transition Lecture 9
9.1. Summary In this Lecture we will consider structural phase transitions characterised by atomic displacements, which result in a low temperature structure that is distorted compared to a higher temperature,
More information5.74 Introductory Quantum Mechanics II
MIT OpenCourseWare http://ocw.mit.edu 5.74 Introductory Quantum Mechanics II Spring 2009 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms. p. 10-0 10..
More informationLecture 3: Optical Properties of Insulators, Semiconductors, and Metals. 5 nm
Metals Lecture 3: Optical Properties of Insulators, Semiconductors, and Metals 5 nm Course Info Next Week (Sept. 5 and 7) no classes First H/W is due Sept. 1 The Previous Lecture Origin frequency dependence
More informationUltrafast X-ray Studies of Complex Materials: Science Challenges and Opportunities
Ultrafast X-ray Studies of Complex Materials: Science Challenges and Opportunities Lawrence Berkeley National Laboratory Robert Schoenlein Materials Sciences Division - Chemical Sciences Division Ultrafast
More informationarxiv:cond-mat/ v1 8 Mar 1995
Model of C-Axis Resistivity of High-T c Cuprates Yuyao Zha, S. L. Cooper and David Pines Department of Physics, University of Illinois at Urbana-Champaign, 1110 West Green Street, Urbana, IL 61801 arxiv:cond-mat/9503044v1
More informationAn Introduction to Diffraction and Scattering. School of Chemistry The University of Sydney
An Introduction to Diffraction and Scattering Brendan J. Kennedy School of Chemistry The University of Sydney 1) Strong forces 2) Weak forces Types of Forces 3) Electromagnetic forces 4) Gravity Types
More informationPredicting New BCS Superconductors. Marvin L. Cohen Department of Physics, University of. Lawrence Berkeley Laboratory Berkeley, CA
Predicting New BCS Superconductors Marvin L. Cohen Department of Physics, University of California, and Materials Sciences Division, Lawrence Berkeley Laboratory Berkeley, CA CLASSES OF SUPERCONDUCTORS
More informationMolecular dynamics simulations of coherent optical photon emission from shock waves in crystals
Molecular dynamics simulations of coherent optical photon emission from shock waves in crystals Evan J. Reed, 1,2, * Marin Soljačić, 2 Richard Gee, 1 and J. D. Joannopoulos 2 1 Lawrence Livermore National
More informationUvA-DARE (Digital Academic Repository) Charge carrier dynamics in photovoltaic materials Jensen, S.A. Link to publication
UvA-DARE (Digital Academic Repository) Charge carrier dynamics in photovoltaic materials Jensen, S.A. Link to publication Citation for published version (APA): Jensen, S. A. (2014). Charge carrier dynamics
More information