Supplementary Information. A study on the chiral inversion of mandelic acid in humans
|
|
|
- Cory Montgomery
- 5 years ago
- Views:
Transcription
1 Electronic Supplementary Material (ESI) for rganic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 2014 Supplementary Information A study on the chiral inversion of mandelic acid in humans Maksims Yevglevskis, Catherine R. Bowskill, Chloe C. Y. Chan, Justin.-J. eng, Michael D. Threadgill, Timothy J. Woodman, and Matthew D. Lloyd* Medicinal Chemistry, Department of Pharmacy & Pharmacology, University of Bath, Claverton Down, Bath BA2 7AY, U. K. M.D.Lloyd@bath.ac.uk
2 Table of Contents Characterisation of synthetic compounds pages 3-8 Incubations of acyl-coa esters with recombinant human AMACR 1A pages 9-16 Kinetic plots for ACT1 pages Kinetic plots for ACT2 pages Supplementary Figure S1: Sequence alignment of AMACR and MCR page 37
3 S-2-ydroxyphenylacetyl-CoA 2S ( 1 NMR, Mz) S CoA
4 R-2-ydroxy-2-phenylacetyl-CoA 2R ( 1 NMR, Mz) S CoA
5 S-2-Methyl-2-phenylacetyl-CoA 8S ( 1 NMR, Mz) Me SCoA
6 R-2-Methyl-2-phenylacetyl-CoA 8R ( 1 NMR, Mz) Me SCoA
7 S-2-ydroxy-2-phenylacetyl-CoA 2S (as Na adduct) SCoA
8 S-2-Phenylpropanoyl-CoA 8S Me SCoA
9 Incubation of ±-Fenoprofenoyl-CoA with human recombinant AMACR 1A S CoA eat-inactivated enzyme Live enzyme
10 Incubation of S-2-hydroxy-2-phenylacetyl-CoA 2S with human recombinant AMACR 1A SCoA eat-inactivated enzyme Live enzyme
11 S-2-ydroxy-2-phenylacetyl-CoA 2S incubated with heat inactivated AMACR (full spectrum) S CoA S-2-ydroxy-2-phenylacetyl-CoA 2S incubated with active AMACR (full spectrum) S CoA
12 Incubation of R-2-hydroxy-2-phenylacetyl-CoA 2R with human recombinant AMACR 1A SCoA eat-inactivated enzyme Live enzyme
13 R-2-ydroxy-2-phenylacetyl-CoA 2R incubated with heat inactivated AMACR (full spectrum) S CoA R-2-ydroxy-2-phenylacetyl-CoA 2R incubated with active AMACR (full spectrum) S CoA
14 Stack plot showing incubation of 2R and 2S with live and heat-inactivated AMACR 2R, Live enzyme 2R, heat-inactivated enzyme 2S, Live enzyme 2S, heat-inactivated enzyme
15 Incubation of S-2-phenylpropanoyl-CoA 8S with human recombinant AMACR 1A Me SCoA eat-inactivated enzyme Live enzyme
16 Incubation of R-2-phenylpropanoyl-CoA 8R with human recombinant AMACR 1A Me SCoA eat-inactivate enzyme Live enzyme
17 ACT1, Myristoyl-CoA 11 S CoA Parameters Value ±Std. Error 95% Conf. Interval Vmax to Km to Ki to Goodness of Fit Degrees of Freedom 21 AICc R² Sum of Squares Sy.x Runs Test p Value Data Number of x values 8 Number of replicates 3 Total number of values 24 Number of missing values 0 Michaelis-Menten Rate (nmol/min/mg)
18 Lineweaver-Burk /Rate (nmol/min/mg) / Residuals 6 4 Residuals (nmol/min/mg)
19 ACT-1, S-2-hydroxy-2-phenylacetyl-CoA 2S S CoA Parameters Value ±Std. Error 95% Conf. Interval Vmax to Km to Ki to Goodness of Fit Degrees of Freedom 21 AICc R² Sum of Squares Sy.x Runs Test p Value Data Number of x values 8 Number of replicates 3 Total number of values 24 Number of missing values 0 Michaelis-Menten Rate (nmol/min/mg)
20 Lineweaver-Burk /Rate (nmol/min/mg) / Residuals 4 2 Residuals (nmol/min/mg)
21 ACT-1, R-2-hydroxy-2-phenylacetyl-CoA 2R S CoA Parameters Value ±Std. Error 95% Conf. Interval Vmax to Km to Goodness of Fit Degrees of Freedom 21 AICc R² Sum of Squares Sy.x Runs Test p Value Data Number of x values 8 Number of replicates 3 Total number of values 23 Number of missing values 1 Michaelis-Menten Rate (nmol/min/mg)
22 Lineweaver-Burk /Rate (nmol/min/mg) / Residuals 4 3 Residuals (nmol/min/mg)
23 ACT-1, S-2-Phenylpropanoyl-CoA 8S Me S CoA Parameters Value ±Std. Error 95% Conf. Interval Vmax 26, e e+7 to 1.385e+7 Km 35, e e+7 to 1.859e+7 Ki to Goodness of Fit Degrees of Freedom 21 AICc R² Sum of Squares Sy.x Runs Test p Value Data Number of x values 8 Number of replicates 3 Total number of values 24 Number of missing values 0 Michaelis-Menten Rate (nmol/min/mg)
24 Lineweaver-Burk /Rate (nmol/min/mg) / Residuals 6 4 Residuals (nmol/min/mg)
25 ACT-1, R-2-phenylpropanoyl-CoA 8R Me S CoA Parameters Value ±Std. Error 95% Conf. Interval Vmax to Km to Goodness of Fit Degrees of Freedom 22 AICc R² Sum of Squares Sy.x Runs Test p Value Data Number of x values 8 Number of replicates 3 Total number of values 24 Number of missing values 0 Michaelis-Menten 6 5 Rate (nmol/min/mg)
26 Lineweaver-Burk /Rate (nmol/min/mg) / Residuals Residuals (nmol/min/mg)
27 ACT-2, Myristoyl-CoA 11 S CoA Parameters Value ±Std. Error 95% Conf. Interval Vmax to Km to Ki to Goodness of Fit Degrees of Freedom 20 AICc R² Sum of Squares Sy.x Runs Test p Value Data Number of x values 8 Number of replicates 3 Total number of values 23 Number of missing values 1 Michaelis-Menten Rate (nmol/min/mg)
28 Lineweaver-Burk /Rate (nmol/min/mg) / Residuals 6 4 Residuals (nmol/min/mg)
29 ACT-2, S-2-hydroxy-2-phenylacetyl-CoA 2S S CoA Parameters Value ±Std. Error 95% Conf. Interval Vmax to Km to Ki to Goodness of Fit Degrees of Freedom 21 AICc R² Sum of Squares Sy.x Runs Test p Value Data Number of x values 8 Number of replicates 3 Total number of values 24 Number of missing values 0 Michaelis-Menten Rate (nmol/min/mg)
30 Lineweaver-Burk /Rate (nmol/min/mg) / Residuals 4 2 Residuals (nmol/min/mg)
31 ACT-2, R-2-hydroxy-2-phenylacetyl-CoA 2R S CoA Parameters Value ±Std. Error 95% Conf. Interval Vmax to Km to Goodness of Fit Degrees of Freedom 18 AICc R² Sum of Squares Sy.x Runs Test p Value Data Number of x values 7 Number of replicates 3 Total number of values 20 Number of missing values 1 Michaelis-Menten Rate (nmol/min/mg)
32 Lineweaver-Burk /Rate (nmol/min/mg) / Residuals 3 2 Residuals (nmol/min/mg)
33 ACT-2, S-2-Phenylpropanoyl-CoA 8S Me S CoA Parameters Value ±Std. Error 95% Conf. Interval Vmax 33, e e+7 to 1.650e+7 Km 46, e e+7 to 2.323e+7 Ki to Goodness of Fit Degrees of Freedom 21 AICc R² Sum of Squares Sy.x Runs Test p Value Data Number of x values 8 Number of replicates 3 Total number of values 24 Number of missing values 0 Michaelis-Menten Rate (nmol/min/mg)
34 Lineweaver-Burk /Rate (nmol/min/mg) / Residuals 4 2 Residuals (nmol/min/mg)
35 ACT-2, R-2-Phenylpropanoyl-CoA 8R Me S CoA Parameters Value ±Std. Error 95% Conf. Interval Vmax to Km to Goodness of Fit Degrees of Freedom 22 AICc R² Sum of Squares Sy.x Runs Test p Value Data Number of x values 8 Number of replicates 3 Total number of values 24 Number of missing values 0 Michaelis-Menten 6 5 Rate (nmol/min/mg)
36 Lineweaver-Burk /Rate (nmol/min/mg) / Residuals Residuals (nmol/min/mg)
37 MCR AMACR MCR AMACR MCR AMACR MCR AMACR MCR AMACR MCR AMACR MCR AMACR MAGPLSGLRVVELAGIGPGPAAMILGDLGADVVRIDRPSSVDGISRDAMLRNRRIVTAD --MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSR--LGRGKRSLVLD LKSDQGLELALKLIAKADVLIEGYRPGVTERLGLGPEECAKVNDRLIYARMTGWGQTGPR LKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSF SQQAGDINYISLNGILAIGRGDERPVPPLNLVGDFGGGSMFLLVGILAALWERQSSGK CRLAGDINYLALSGVLSKIGRSGENPYAPLNLLADFAGGGLMCALGIIMALFDRTRTGK GQVVDAAMVDGSSVLIQMMWAMRATGMWTDTRGANMLDGGAPYYDTYECADGRYVAVGAI GQVIDANMVEGTAYLSSFLWKTQKSSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAI EPQFYAAMLAGLGLDAAELPPQNDRARWPELRALLTEAFASDRDWGAVFANSDACVTP EPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTP VLAFGEVNEPIIERNTFYEANG---GWQPMPAPRFSRTASSQPRPPAATIDIEAVLTD VLTFEEVVDNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGETEEILEE WDG FGFSREEIYQLNSDKIIESNKVKASL Figure S1: Sequence alignment of MCR from M. tuberculosis (06543) and human AMACR 1A (Q9UK6), showing residues involved in methyl group binding pocket (Bold).
Supplementary information
Supplementary information Chiral inversion of 2-arylpropionoyl-CoA esters by human α-methylacyl-coa racemase 1A (P504S) a potential mechanism for the anti-cancer effects of ibuprofen Timothy J. Woodman,
Supplementary Material (ESI) for Chemical Communications This journal is (c) The Royal Society of Chemistry 2010
Synthesis of substrates 2,2-[ 2 H 2 ]-Decanoyl-CoA (3) was synthesised using an extension of the method previously described by us. 1 Thus, diethyl malonate 7 (Scheme 1) was deprotonated and the resulting
ENZYME KINETICS. What happens to S, P, E, ES?
ENZYME KINETICS Go to lecture notes and/or supplementary handouts for the following: 1 Basic observations in enzyme inetics 2 Michaelis-Menten treatment of enzyme inetics 3 Briggs-Haldane treatment of
A First Course on Kinetics and Reaction Engineering. Class 9 on Unit 9
A First Course on Kinetics and Reaction Engineering Class 9 on Unit 9 Part I - Chemical Reactions Part II - Chemical Reaction Kinetics Where We re Going A. Rate Expressions - 4. Reaction Rates and Temperature
Chemical kinetics and catalysis
Chemical kinetics and catalysis Outline Classification of chemical reactions Definition of chemical kinetics Rate of chemical reaction The law of chemical raction rate Collision theory of reactions, transition
It is generally believed that the catalytic reactions occur in at least two steps.
Lecture 16 MECHANISM OF ENZYME ACTION A chemical reaction such as A ----> P takes place because a certain fraction of the substrate possesses enough energy to attain an activated condition called the transition
Enzymes II. Dr. Mamoun Ahram Summer, 2017
Enzymes II Dr. Mamoun Ahram Summer, 2017 Kinetics Kinetics is deals with the rates of chemical reactions. Chemical kinetics is the study of the rates of chemical reactions. For the reaction (A P), The
Time depending inhibition with atypical kinetics, what is one to do? Ken Korzekwa Temple University School of Pharmacy
Time depending inhibition with atypical kinetics, what is one to do? Ken Korzekwa Temple University School of harmacy Acknowledgements TUS Swati Nagar Jaydeep Yadav harma - Donald Tweedie - Andrea Whitcher-Johnstone
Previous Class. Today. Michaelis Menten equation Steady state vs pre-steady state
Previous Class Michaelis Menten equation Steady state vs pre-steady state Today Review derivation and interpretation Graphical representation Michaelis Menten equations and parameters The Michaelis Menten
Measurement of Enzyme Activity - ALP Activity (ALP: Alkaline phosphatase)
Measurement of Enzyme Activity - ALP Activity (ALP: Alkaline phosphatase) Measurement and analysis of enzyme activity is often used in the field of life science such as medicines and foods to investigate
It can be derived from the Michaelis Menten equation as follows: invert and multiply with V max : Rearrange: Isolate v:
Eadie Hofstee diagram In Enzymology, an Eadie Hofstee diagram (also Woolf Eadie Augustinsson Hofstee or Eadie Augustinsson plot) is a graphical representation of enzyme kinetics in which reaction velocity
Enzyme Reactions. Lecture 13: Kinetics II Michaelis-Menten Kinetics. Margaret A. Daugherty Fall v = k 1 [A] E + S ES ES* EP E + P
![Enzyme Reactions. Lecture 13: Kinetics II Michaelis-Menten Kinetics. Margaret A. Daugherty Fall v = k 1 [A] E + S ES ES* EP E + P](/thumbs/76/74341799.jpg "Enzyme Reactions. Lecture 13: Kinetics II Michaelis-Menten Kinetics. Margaret A. Daugherty Fall v = k 1 [A] E + S ES ES* EP E + P")
Lecture 13: Kinetics II Michaelis-Menten Kinetics Margaret A. Daugherty Fall 2003 Enzyme Reactions E + S ES ES* EP E + P E = enzyme ES = enzyme-substrate complex ES* = enzyme/transition state complex EP
Michaelis-Menten Kinetics. Lecture 13: Kinetics II. Enzyme Reactions. Margaret A. Daugherty. Fall Substrates bind to the enzyme s active site
Lecture 13: Kinetics II Michaelis-Menten Kinetics Margaret A. Daugherty Fall 2003 Enzyme Reactions E + S ES ES* EP E + P E = enzyme ES = enzyme-substrate complex ES* = enzyme/transition state complex EP
CHAPTER 6 ENZYME KINETICS AND THERMAL INACTIVATION OF POLYPHENOL OXIDASE
CHAPTER 6 ENZYME KINETICS AND THERMAL INACTIVATION OF POLYPHENOL OXIDASE OVERVIEW OF CHAPTER Here we report the substrate specificity and enzyme kinetics of Polyphenol oxidase enzyme of A. paeoniifolius.
Chemistry 112 Chemical Kinetics. Kinetics of Simple Enzymatic Reactions: The Case of Competitive Inhibition
Chemistry Chemical Kinetics Kinetics of Simple Enzymatic Reactions: The Case of Competitive Inhibition Introduction: In the following, we will develop the equations describing the kinetics of a single
Lecture 15 (10/20/17) Lecture 15 (10/20/17)
Reading: Ch6; 98-203 Ch6; Box 6- Lecture 5 (0/20/7) Problems: Ch6 (text); 8, 9, 0,, 2, 3, 4, 5, 6 Ch6 (study guide-facts); 6, 7, 8, 9, 20, 2 8, 0, 2 Ch6 (study guide-applying); NEXT Reading: Ch6; 207-20
Lecture 13: Data Analysis for the V versus [S] Experiment and Interpretation of the Michaelis-Menten Parameters
![Lecture 13: Data Analysis for the V versus [S] Experiment and Interpretation of the Michaelis-Menten Parameters](/thumbs/89/100978514.jpg "Lecture 13: Data Analysis for the V versus [S] Experiment and Interpretation of the Michaelis-Menten Parameters")
Biological Chemistry Laboratory Biology 3515/Chemistry 3515 Spring 2018 Lecture 13: Data Analysis for the V versus [S] Experiment and Interpretation of the Michaelis-Menten Parameters 20 February 2018
Molecular motion of Donor-Acceptor catenanes in water
Electronic Supplementary Material (ESI) for Organic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 2015 Supporting Information for: Molecular motion of Donor-Acceptor catenanes
CYP Time Dependent Inhibition Atypical Kinetics. Ken Korzekwa Temple University School of Pharmacy and Kinetics & Simulation, LLC
CYP Time Dependent Inhibition Atypical Kinetics Ken Korzekwa Temple University School of Pharmacy and Kinetics & Simulation, LLC Acknowledgements TUSP Swati Nagar Jaydeep Yadav Pharma - Donald Tweedie
Michaelis-Menten Kinetics
Michaelis-Menten Kinetics Two early 20th century scientists, Leonor Michaelis and Maud Leonora Menten, proposed the model known as Michaelis-Menten Kinetics to account for enzymatic dynamics. The model
Chem Lecture 4 Enzymes Part 2
Chem 452 - Lecture 4 Enzymes Part 2 Question of the Day: Is there some easy way to clock how many reactions one enzyme molecule is able to catalyze in an hour? Thermodynamics I think that enzymes are molecules
CHEM April 10, Exam 3
Name CHEM 3511 April 10, 2009 Exam 3 Name Page 1 1. (12 points) Give the name of your favorite Tech professor and in one sentence describe why you like him/her. 2. (10 points) An enzyme cleaves a chemical
Biochemistry. Lecture 8 Enzyme Kinetics
Biochemistry Lecture 8 Enzyme Kinetics Why Enzymes? igher reaction rates Greater reaction specificity Milder reaction conditions Capacity for regulation C - - C N 2 - C N 2 - C - C Chorismate mutase -
A First Course on Kinetics and Reaction Engineering Example 9.4
Example 9.4 Problem Purpose This problem illustrates the use of a Lineweaver-Burk plot to determine the values of the constants in a Michaelis-Menten rate expression. Problem Statement Suppose the enzyme-catalyzed
Bioreactor Engineering Laboratory
Bioreactor Engineering Laboratory Determination of kinetics parameters of enzymatic hydrolysis of lactose catalyzed by β-galactosidase. Supervisor: Karolina Labus, PhD 1. THEROETICAL PART Enzymes are macromolecular,
BIOCHEMISTRY - CLUTCH REVIEW 2.
!! www.clutchprep.com CONCEPT: BINDING AFFINITY Protein-ligand binding is reversible, like a chemical equilibrium [S] substrate concentration [E] enzyme concentration Ligands bind to proteins via the same
CHM333 LECTURES 14 & 15: 2/15 17/12 SPRING 2012 Professor Christine Hrycyna
ENZYME KINETICS: The rate of the reaction catalyzed by enzyme E A + B P is defined as -Δ[A] or -Δ[B] or Δ[P] Δt Δt Δt A and B changes are negative because the substrates are disappearing P change is positive
Enzymes II: kinetics الفريق الطبي األكاديمي. Done By: - AHMAD ALSAHELE. Corrected By:-Bushra saleem
Enzymes II: kinetics الفريق الطبي األكاديمي Done By: - AHMAD ALSAHELE Corrected By:-Bushra saleem لكية الطب البرشي البلقاء التطبيقية / املركز و من أحياها 6166 6102/ و من أحياها Specific aims: 1. Know what
Previous Class. Today. Cosubstrates (cofactors)
Previous Class Cosubstrates (cofactors) Today Proximity effect Basic equations of Kinetics Steady state kinetics Michaelis Menten equations and parameters Enzyme Kinetics Enzyme kinetics implies characterizing
Biochemistry Enzyme kinetics
1 Description of Module Subject Name Paper Name Module Name/Title Enzyme Kinetics Dr. Vijaya Khader Dr. MC Varadaraj 2 1. Objectives 2. Enzymes as biological catalyst 3. Enzyme Catalysis 4. Understanding
Biochemical Kinetics: the science that studies rates of chemical reactions An example is the reaction (A P), The velocity, v, or rate, of the
Biochemical Kinetics: the science that studies rates of chemical reactions An example is the reaction (A P), The velocity, v, or rate, of the reaction A P is the amount of P formed or the amount of A consumed
Class Business. I will have Project I graded by the end of the week. The discussion groups for Project 2 are cancelled
Quiz 1 Class Business I will have Project I graded by the end of the week. Project 2 is due on 11/15 The discussion groups for Project 2 are cancelled There is additional reading for classes held on 10/30
Lecture # 3, 4 Selecting a Catalyst (Non-Kinetic Parameters), Review of Enzyme Kinetics, Selectivity, ph and Temperature Effects
1.492 - Integrated Chemical Engineering (ICE Topics: Biocatalysis MIT Chemical Engineering Department Instructor: Professor Kristala Prather Fall 24 Lecture # 3, 4 Selecting a Catalyst (Non-Kinetic Parameters,
Structural basis for catalytically restrictive dynamics of a high-energy enzyme state
Supplementary Material Structural basis for catalytically restrictive dynamics of a high-energy enzyme state Michael Kovermann, Jörgen Ådén, Christin Grundström, A. Elisabeth Sauer-Eriksson, Uwe H. Sauer
Supporting material for Chiral Sensing using a Blue Fluorescent Antibody
Supporting material for Chiral Sensing using a Blue Fluorescent Antibody ana Matsushita, oboru Yamamoto, Michael M. ijler, Peter Wirsching, Richard A. Lerner, Masayuki Matsushita and Kim D. Janda Synthesis
Catalysis. v 0 no catalyst v c -- catalyst present. v c. dt with no catalyst) (v c = -d[a]/dt dt with a catalyst)
![Catalysis. v 0 no catalyst v c -- catalyst present. v c. dt with no catalyst) (v c = -d[a]/dt dt with a catalyst)](/thumbs/87/95598212.jpg "Catalysis. v 0 no catalyst v c -- catalyst present. v c. dt with no catalyst) (v c = -d[a]/dt dt with a catalyst)")
Catalysis Catalysis provides an additional mechanism by which reactants can be converted to products. The alternative mechanism has a lower activation energy than the reaction in the absence of a catalyst.
Enzyme Kinetics. Michaelis-Menten Theory Dehaloperoxidase: Multi-functional Enzyme. NC State University
Enzyme Kinetics Michaelis-Menten Theory Dehaloperoxidase: Multi-functional Enzyme NC State University Michaelis-Menton kinetics The rate of an enzyme catalyzed reaction in which substrate S is converted
Michaelis-Menton kinetics
Michaelis-Menton kinetics The rate of an enzyme catalyzed reaction in which substrate S is converted into products P depends on the concentration of the enzyme E even though the enzyme does not undergo
Lab training Enzyme Kinetics & Photometry
Lab training Enzyme Kinetics & Photometry Qing Cheng Qing.Cheng@ki.se Biochemistry Division, MBB, KI Lab lecture Introduction on enzyme and kinetics Order of a reaction, first order kinetics Michaelis-Menten
Supporting Information. A fluorogenic assay for screening Sirt6 modulators
This journal is The Royal Society of Chemistry 213 Supporting Information A fluorogenic assay for screening Sirt6 modulators Jing Hu, Bin He, Shiva Bhargava, Hening Lin* Department of Chemistry and Chemical
Effect of Temperature Increasing the temperature increases the energy in the system. Two effects kinetic. denaturing
Effect of Temperature Increasing the temperature increases the energy in the system Two effects kinetic denaturing Kinetic effect Increased motion of molecules Increased collisions between enzyme/substrate
Enzymes Part III: Enzyme kinetics. Dr. Mamoun Ahram Summer semester,
Enzymes Part III: Enzyme kinetics Dr. Mamoun Ahram Summer semester, 2015-2016 Kinetics Kinetics is deals with the rates of chemical reactions. Chemical kinetics is the study of the rates of chemical reactions.
Lecture 13: Data Analysis and Interpretation of the Michaelis-Menten Parameters
Biological Chemistry Laboratory Biology 3515/Chemistry 3515 Spring 2019 Lecture 13: Data Analysis and Interpretation of the Michaelis-Menten Parameters 19 February 2019 c David P. Goldenberg University
Exam 3 Review (4/12/2011) Lecture note excerpt covering lectures (Exam 3 topics: Chapters 8, 12, 14 & 15)
Exam 3 Review (4/12/2011) Lecture note excerpt covering lectures 17-23 (Exam 3 topics: Chapters 8, 12, 14 & 15) Enzyme Kinetics, Inhibition, and Regulation Chapter 12 Enzyme Kinetics When the concentration
Ali Yaghi. Gumana Ghashan. Mamoun Ahram
21 Ali Yaghi Gumana Ghashan Mamoun Ahram Kinetics The study of Kinetics deals with the rates of chemical reactions. Chemical kinetics is the study of the rate of chemical reactions. For the reaction (A
BCMB 3100 Chapters 6,7,8 Enzyme Basics. Six Classes (IUBMB) Kinetics Michaelis-Menten Equation Vo, Km, Vmax, Kcat Lineweaver-Burk Plot
BCMB 3100 Chapters 6,7,8 Enzyme Basics Six Classes (IUBMB) Kinetics Michaelis-Menten Equation Vo, Km, Vmax, Kcat Lineweaver-Burk Plot Enzymes are biological macromolecules that increase the rate of the
BCMB 3100 Chapters 6,7,8 Enzyme Basics. Six Classes (IUBMB) Kinetics Michaelis-Menten Equation Vo, Km, Vmax, Kcat Lineweaver-Burk Plot
BCMB 3100 Chapters 6,7,8 Enzyme Basics Six Classes (IUBMB) Kinetics Michaelis-Menten Equation Vo, Km, Vmax, Kcat Lineweaver-Burk Plot Enzymes are biological macromolecules that increase the rate of the
BCMB 3100 Chapters 6,7,8 Enzyme Basics. Six Classes (IUBMB) Kinetics Michaelis-Menten Equation Vo, Km, Vmax, Kcat Lineweaver-Burk Plot
BCMB 3100 Chapters 6,7,8 Enzyme Basics Six Classes (IUBMB) Kinetics Enzymes are biological macromolecules that increase the rate of the reaction. Six major groups of enzymes (pgs. 94-95/98-99) Oxidoreductases:
Lecture 16 (10/23/17) Lecture 16 (10/23/17)
Lecture 16 (10/23/17) Reading: Ch6; 207-210 Ch6; 192-193, 195-196, 205-206 Problems: Ch6 (text); 18, 19, 20, 21, 22 Ch6 (study guide-facts); 9, 11 Ch6 (study guide-applying); 2 NEXT Reading: Ch6; 213-218
2. Under what conditions can an enzyme assay be used to determine the relative amounts of an enzyme present?
Chem 315 In class/homework problems 1. a) For a Michaelis-Menten reaction, k 1 = 7 x 10 7 M -1 sec -1, k -1 = 1 x 10 3 sec -1, k 2 = 2 x 10 4 sec -1. What are the values of K s and K M? K s = k -1 / k
4. What is the general expression Keq (the equilibrium constant) in terms of product and reactant concentration? tell us about the enzyme.
Section 8 Enzyme Kinetics Pre-Activity Assignment 1. Produce a reading log for the sections in your text that discuss the Michaelis-Menten equation and including kcat. 2. Focus on the derivation of the
Topic 4 Correlation and Regression. Transformed Variables
Topic 4 Correlation and Regression Transformed Variables 1 / 13 Outline Worldwide Oil Production Lineweaver-Burke double reciprocal plot 2 / 13 Worldwide Oil Production Example. The modern history of petroleum
Rate laws, Reaction Orders. Reaction Order Molecularity. Determining Reaction Order
Rate laws, Reaction Orders The rate or velocity of a chemical reaction is loss of reactant or appearance of product in concentration units, per unit time d[p] = d[s] The rate law for a reaction is of the
Supporting Information
Supporting Information In Situ Ratiometric Quantitative Tracing Intracellular Leucine Aminopeptidase Activity via an Activatable Near- Infrared Fluorescent Probe Kaizhi Gu, Yajing Liu, Zhiqian Guo,*,,#
New sesquiterpenoids from the rhizomes of Acorus tatarinowii
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 214 New sesquiterpenoids from the rhizomes of Acorus tatarinowii Xiao-Lin Feng, a Yang Yu, *a Hao
CHEM 251 (4 credits): Description
CHEM 251 (4 credits): Intermediate Reactions of Nucleophiles and Electrophiles (Reactivity 2) Description: An understanding of chemical reactivity, initiated in Reactivity 1, is further developed based
Kinetics of RapA inhibition by PhrA pentapeptide curve fits -
Kinetics of RapA inhibition by PhrA pentapeptide curve fits - Competitive Full Competitive full Uncompetitive Full Uncompetitive Full 0. 0. 0. 0 1 1 1 1 - -1 0 1 3 0. 0. 0. 0 1 1 1 1 Vmax = Km = 9 Ki =.
13 Determining the Efficiency of the Enzyme Acetylcholine Esterase Using Steady-State Kinetic Experiment
13 Determining the Efficiency of the Enzyme Acetylcholine Esterase Using Steady-State Kinetic Experiment 131 Learning Objective This laboratory introduces you to steady-state kinetic analysis, a fundamental
Learning Outcomes. k 1
Module 1DHS - Data Handling Skills Unit: Applied Maths Lecturer: Dr. Simon Hubbard (H13), Email: Simon.Hubbard@umist.ac.uk Title: Equilibria & Michaelis-Menten This lecture and problem class will introduce
Homework 5 Organic Chemistry MCAT Review Summer 2012 Brent Iverson
omework 5 rganic Chemistry MCAT Review Summer 2012 ent Iverson 1 1. For the following reactions, draw the predominant product or products. When a new chiral center is created, mark it with an asterisk
Bioengineering Laboratory I. Enzyme Assays. Part II: Determination of Kinetic Parameters Fall Semester
Bioengineering Laboratory I Enzyme Assays Part II: Determination of Kinetic Parameters 2016-2017 Fall Semester 1. Theoretical background There are several mathematical models to determine the kinetic constants
Two requirements for life: Self-replication and appropriate catalysis. A. Most enzymes (def.: biological catalysts) are proteins
Enzymes We must be able to enhance the rates of many physical and chemical processes to remain alive and healthy. Support for that assertion: Maladies of genetic origin. Examples: Sickle-cell anemia (physical)
Supplementary Information
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2015 Supplementary Information Dynamics of the thumb-finger regions in GH11 xylanase Bacillus circulans:
ENZYME KINETICS. Medical Biochemistry, Lecture 24
ENZYME KINETICS Medical Biochemistry, Lecture 24 Lecture 24, Outline Michaelis-Menten kinetics Interpretations and uses of the Michaelis- Menten equation Enzyme inhibitors: types and kinetics Enzyme Kinetics
Chem 204. Mid-Term Exam I. July 21, There are 3 sections to this exam: Answer ALL questions
Chem 204 Mid-Term Exam I July 21, 2009 Name: Answer Key Student ID: There are 3 sections to this exam: Answer ALL questions Section I: Multiple-Choice 20 questions, 2 pts each Section II: Fill-in-the-Blank
Affinity labels for studying enzyme active sites. Irreversible Enzyme Inhibition. Inhibition of serine protease with DFP
Irreversible Enzyme Inhibition Irreversible inhibitors form stable covalent bonds with the enzyme (e.g. alkylation or acylation of an active site side chain) There are many naturally-occurring and synthetic
Biochemistry. Lecture 8
Biochemistry Lecture 8 Why Enzymes? igher reaction rates Greater reaction specificity Milder reaction conditions Capacity for regulation C - - C N 2 - C N 2 - C - C Chorismate mutase - C - C - C Metabolites
Supporting Information. Chemo-enzymatic Synthesis of Isotopically Labeled Nicotinamide Ribose
Electronic Supplementary Material (ESI) for Organic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 2018 Supporting Information Chemo-enzymatic Synthesis of Isotopically Labeled
Enzyme Kinetics: How they do it
Enzyme Kinetics: How they do it (R1) Formation of Enzyme-Substrate complex: (R2) Formation of Product (i.e. reaction): E + S ES ES -> E + P (R3) Desorption (decoupling/unbinding) of product is usually
STUDY GUIDE #2 Winter 2000 Chem 4540 ANSWERS
STUDY GUIDE #2 Winter 2000 Chem 4540 ANSWERS R. Merrill 1. Sketch the appropriate plots on the following axes. Assume that simple Michaelis- Menten kinetics apply. 2. The enzyme-catalyzed hydrolysis of
/ / MET Day 000 NC1^ INRTL MNVR I E E PRE SLEEP K PRE SLEEP R E
05//0 5:26:04 09/6/0 (259) 6 7 8 9 20 2 22 2 09/7 0 02 0 000/00 0 02 0 04 05 06 07 08 09 0 2 ay 000 ^ 0 X Y / / / / ( %/ ) 2 /0 2 ( ) ^ 4 / Y/ 2 4 5 6 7 8 9 2 X ^ X % 2 // 09/7/0 (260) ay 000 02 05//0
Supporting Information
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2014 Supporting Information Rh 2 (Ac) 4 -Catalyzed 2,3-Migration of -rrocenecarboxyl -Diazocarbonyl
After lectures by. disappearance of reactants or appearance of. measure a reaction rate we monitor the. Reaction Rates (reaction velocities): To
Revised 3/21/2017 After lectures by Dr. Loren Williams (GeorgiaTech) Protein Folding: 1 st order reaction DNA annealing: 2 nd order reaction Reaction Rates (reaction velocities): To measure a reaction
Supporting Information
Electronic Supplementary Material (ESI) for rganic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 201 Supporting Information Phenalenones: Insight into the biosynthesis of polyketies
Elementary reactions. stoichiometry = mechanism (Cl. + H 2 HCl + H. ) 2 NO 2 ; radioactive decay;
Elementary reactions 1/21 stoichiometry = mechanism (Cl. + H 2 HCl + H. ) monomolecular reactions (decay: N 2 O 4 some isomerisations) 2 NO 2 ; radioactive decay; bimolecular reactions (collision; most
Highly Specific near-infrared Fluorescent probe for the Real-Time Detection of β-glucuronidase in Various Living Cells and Animals
Supplementary information Highly Specific near-infrared Fluorescent probe for the Real-Time Detection of β-glucuronidase in Various Living Cells and Animals Yinzhu Jin,, Xiangge Tian,, Lingling Jin, Yonglei
2013 W. H. Freeman and Company. 6 Enzymes
2013 W. H. Freeman and Company 6 Enzymes CHAPTER 6 Enzymes Key topics about enzyme function: Physiological significance of enzymes Origin of catalytic power of enzymes Chemical mechanisms of catalysis
MITOCW enzyme_kinetics
MITOCW enzyme_kinetics In beer and wine production, enzymes in yeast aid the conversion of sugar into ethanol. Enzymes are used in cheese-making to degrade proteins in milk, changing their solubility,
ENZYMES 2: KINETICS AND INHIBITION. HLeeYu Jsuico Junsay Department of Chemistry School of Science and Engineering Ateneo de Manila University
ENZYMES 2: KINETICS AND INHIBITION HLeeYu Jsuico Junsay Department of Chemistry School of Science and Engineering Ateneo de Manila University 1 REVIEW OF KINETICS (GEN CHEM II) 2 Chemical KineCcs How fast
Enzyme reaction example of Catalysis, simplest form: E + P at end of reaction No consumption of E (ES): enzyme-substrate complex Intermediate
V 41 Enzyme Kinetics Enzyme reaction example of Catalysis, simplest form: k 1 E + S k -1 ES E at beginning and ES k 2 k -2 E + P at end of reaction No consumption of E (ES): enzyme-substrate complex Intermediate
Metal-Free Oxidative Cleavage of C-C bond in α-hydroxy-βoxophosphonates
Electronic Supplementary Material (ESI) for rganic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 25 Supporting Information Metal-Free xidative Cleavage of C-C bond in α-hydroxy-βoxophosphonates
Supporting Information
Supporting Information Tandem Mass Spectrometry for the Direct Assay of Lysosomal Enzymes in Dried Blood Spots: Application to Screening Newborns for Mucopolysaccharidosis VI (Maroteaux- Lamy Syndrome)
Membrane Proteins: 1. Integral proteins: 2. Peripheral proteins: 3. Amphitropic proteins:
Membrane Proteins: 1. Integral proteins: proteins that insert into/span the membrane bilayer; or covalently linked to membrane lipids. (Interact with the hydrophobic part of the membrane) 2. Peripheral
Lecture 12: Burst Substrates and the V vs [S] Experiment
![Lecture 12: Burst Substrates and the V vs [S] Experiment](/thumbs/95/124907449.jpg "Lecture 12: Burst Substrates and the V vs [S] Experiment")
Biological Chemistry Laboratory Biology 3515/Chemistry 3515 Spring 2019 Lecture 12: Burst Substrates and the V vs [S] Experiment 14 February 2019 c David P. Goldenberg University of Utah goldenberg@biology.utah.edu
C a h p a t p e t r e r 6 E z n y z m y e m s
Chapter 6 Enzymes 4. Examples of enzymatic reactions acid-base catalysis: give and take protons covalent catalysis: a transient covalent bond is formed between the enzyme and the substrate metal ion catalysis:
Reversible reactions
Reversible reactions A reversible enzymic reaction (e.g. the conversion of glucose to fructose, catalysed by glucose isomerase) may be represented by the following scheme where the reaction goes through
Reading for today: Chapter 16 (selections from Sections A, B and C) Friday and Monday: Chapter 17 (Diffusion)
Lecture 29 Enzymes Reading for today: Chapter 6 (selections from Sections, B and C) Friday and Monday: Chapter 7 (Diffusion) 4/3/6 Today s Goals Michaelis-Menten mechanism for simple enzyme reactions:
Enzyme Kinetics. Jonathan Gent and Douglas Saucedo May 24, 2002
Enzyme Kinetics Jonathan Gent and Douglas Saucedo May 24, 2002 Abstract This paper consists of a mathematical derivation of the Michaelis-Menten equation, which models the rate of reaction of certain enzymatic
BMB Lecture 9
BMB 178 2018 Lecture 9 Class 11, November 7, 2018 Steady-state kinetics (I) Case 3. Viscosity Variation If k cat /K m decreases with increasing viscosity, then the reaction is diffusion-limited (S binding
Tetrahydroquinolines by multicomponent Povarov reaction in water: Calix[n]arene-catalysed and mechanistic insights
![Tetrahydroquinolines by multicomponent Povarov reaction in water: Calix[n]arene-catalysed and mechanistic insights](/thumbs/94/118698633.jpg "Tetrahydroquinolines by multicomponent Povarov reaction in water: Calix[n]arene-catalysed and mechanistic insights")
Electronic Supplementary Material (ESI) for Organic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 219 Tetrahydroquinolines by multicomponent Povarov reaction in water: Calix[n]arene-catalysed
EDC/NHS activation mechanism of polymethacrylic acid: anhydride
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2015 Electronic Supplementary Information (ESI) EDC/NHS activation mechanism of polymethacrylic
Organic Chemistry, Third Edition. Chapter 24 Carbonyl condensations
rganic Chemistry, Third Edition Chapter 24 Carbonyl condensations 1 Review: enolates LDA, -78 C TF kinetic RX R = Me, 1 alkyl R Na TF, RT RX R = Me, 1 alkyl thermodynamic R enolates = nucleophiles React
Proteins Act As Catalysts
Proteins Act As Catalysts Properties of Enzymes Catalyst - speeds up attainment of reaction equilibrium Enzymatic reactions -10 3 to 10 17 faster than the corresponding uncatalyzed reactions Substrates
Enzymes and Enzyme Kinetics I. Dr.Nabil Bashir
Enzymes and Enzyme Kinetics I Dr.Nabil Bashir Enzymes and Enzyme Kinetics I: Outlines Enzymes - Basic Concepts and Kinetics Enzymes as Catalysts Enzyme rate enhancement / Enzyme specificity Enzyme cofactors
Supplementary Information for
Supplementary Information for Structural basis for the inhibition of Mycobacterium tuberculosis L,D-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains Hyoun Sook Kim
(Supplementary Information)
(Supplementary Information) Peptidomimetic-based Multi-Domain Targeting Offers Critical Evaluation of Aβ Structure and Toxic Function Sunil Kumar 1*, Anja Henning-Knechtel 2, Mazin Magzoub 2, and Andrew
4. The Michaelis-Menten combined rate constant Km, is defined for the following kinetic mechanism as k 1 k 2 E + S ES E + P k -1
Fall 2000 CH 595C Exam 1 Answer Key Multiple Choice 1. One of the reasons that enzymes are such efficient catalysts is that a) the energy level of the enzyme-transition state complex is much higher than
Aminoacid Based Chiral N-Amidothioureas. Acetate Anion. Binding Induced Chirality Transfer
Aminoacid Based Chiral -Amidothioureas. Acetate Anion Binding Induced Chirality Transfer Fang Wang, a Wen-Bin He, a Jin-He Wang, a Xiao-Sheng Yan, a Ying Zhan, a Ying-Ying Ma, b Li-Cai Ye, a Rui Yang,
Synthesis of Biginelli dihydropyrimidinone derivatives with various substituents on aluminum-planted mesoporous silica catalyst
Supplementary Material (ESI) for rganic & Biomolecular Chemistry This journal is The Royal Society of Chemistry 2010 Supplementary Information for Synthesis of Biginelli dihydropyrimidinone derivatives
Electronic Supplementary Information
Electronic Supplementary Material (ESI) for New Journal of Chemistry. This journal is The Royal Society of Chemistry and the Centre National de la Recherche Scientifique 2018 Electronic Supplementary Information