This is a repository copy of Marginal valuations of travel time and scheduling, and the reliability premium.
|
|
- Lisa Gregory
- 5 years ago
- Views:
Transcription
1 Ths s a epostoy copy of Magal valuatos of tavel tme ad schedulg, ad the elablty pemum. Whte Rose Reseach Ole URL fo ths pape: Atcle: Batley, R.P. (2007) Magal valuatos of tavel tme ad schedulg, ad the elablty pemum. Taspotato Reseach E, 43 (4). pp ISSN Reuse See Attached Takedow If you cosde cotet Whte Rose Reseach Ole to be beach of UK law, please otfy us by emalg epts@whteose.ac.uk cludg the URL of the ecod ad the easo fo the wthdawal euest. epts@whteose.ac.uk
2 Whte Rose Reseach Ole Isttute of Taspot Studes Uvesty of Leeds Ths s a autho poduced veso of a pape ogally publshed Taspotato Reseach Pat E. It has bee pee evewed, but does ot clude the fal publshe s pagato ad fomattg. Whte Rose Repostoy URL fo ths pape: Publshed pape Batley, R.P. (2007) Magal valuatos of tavel tme ad schedulg, ad the elablty pemum - Taspotato Reseach Pat E: Logstcs ad Taspotato Revew 43(4) pp Whte Rose Cosotum epts Repostoy epts@whteose.ac.uk
3 Magalvaluatosoftaveltmeadschedulg,adthe elabltypemum RchadBatley IsttutefoTaspotStudes,UvestyofLeeds,LeedsLS29JT,UK Telephoe+44(0) Fax+44(0) Abstact Pevouswokshaveestablshedsyoymtybetweetheotosof ucetatyaduelablty,explotgthsdevgmagalvaluatos oftaveltmeadschedulgudeucetaty.whlstvaldfofoecastg demad,suchvaluatosfaltollumatethecostsofbeaguelablty heeefeedtoasthe elabltypemum.thepapedevesmagal valuatosoftaveltmeadschedulgatthecetatyeuvalet,showg thesetodvegefomthoseudeucetaty.thatdvegece,whch epesetsthemagalvaluatoofelablty,asesthepossbltyofbas shouldthecostsofuelabltyotbecludedappasal. 1
4 Keywods Relablty,Valuato,ExpectedUtlty,RskAveso,RskPemum 2
5 1.Itoducto Althoughapecseudestadghasofteseemedelusve,tswdely acceptedthattheelabltyoftaspotsystemsmaympactupothechoces oftavelles.pevouseseachhasllumatedsevealfacetsofths poposto,butoftewthouttheauthotyofcompehesveevdeceo thevalueofelabltytotavelles.thatsuchevdeceslackgcapehaps, tu,beattbutedtothedffcultyoffomulatgaeseachappaatusthat caestheoetcalvaldty,ssghtful,butemaspactcable.these aspatosaethecoceofthepesetpape. Thetaskofevewgelevatlteatueswellsevedbytheecet cotbutosofnoladadpolak(2002)addejogetal.(2004),adt wouldseemuecessaytooffefuthecommetaythsegad.suffce tosay,dejogetal.dstgushbetweetheeappoachestothevaluatoof elablty,specfcally:i)meavs.vaaceofthetaveltmedstbuto,ii) pecetlesofthetaveltmedstbuto,adiii)schedulgmodels.the pesetpapeexplotsthethdappoachpatcula,whchsfoudedo thehypothessthattavellesmayaccommodateexpectatosofuelablty thoughthetpschedulg. 3
6 Itheaalyssoftpschedulg,Small s(1982)appoachhaseceved cosdeablesuppot.smallextedsthemcoecoomctheoyoftme allocato(becke,1965;desepa,1971),supplemetgtheusualobectve poblemofutltymaxmsatosubecttomoeyadtmecostatswtha tpschedulgcostatdevgfomvckey(1969).implctsmall s appoach,howeve,stheassumptothatschedulgchocesaemade udecetaty,adthswouldseemtomposecosdeableestctoots applcablty.theusualaccommodatoofucetatyatleasttemsof mcoecoomctheoystoefomulatetheobectvepoblemfomthe maxmsatoofutltytooeofmaxmsgexpectedutlty,asfst poposedbyvoneuma&mogeste(1947).thelattesdeed explotedbynolad&small(1995),whoestablshmegebetweethewoks ofvoneuma&mogesteadsmall. Twopatcula,butelated,popetesofNolad&Small saalyssmghtbe oted.fst,boththechoce(.e.depatuetme)adpayoff(.e.avaltme) dmesosaeepesetedcotuously;thscaestheattactoof pemttgeasycalculatooftheoptmaldepatuetme.secod,teests estctedtothemogcommuteofcatavelles.cotutydepatue tmewouldappeamoeeasoablefocatavellesthafousesofpublc taspotsevces,scethelatteaetypcallycostaedbyfxedsevce tevals.batesetal.(2001)developnolad&smallfuthe,fstcosdeg 4
7 tsameabltytopublctaspotuses,adtheapplygtheaalysstoa teestmagalvaluatosoftaveltmeadschedulgude ucetaty.thesemagalvaluatosdevefomchocesbetweetwo publctaspotsevces,wheeeachsevceoffesaageofdepatue tmes,adthecoseuetavaltmesaechaactesedbyucetaty. ThepesetpapefollowsthebascthessofNolad&SmalladBatesetal., butpusuesaumbeofextesos.tmesepesetedasadscete vaablebothdepatueadavaldmesos.notolysthsmoe fathfultovoneuma&mogeste(1947),buttpemtseady accommodatoofpublctaspotuses.thedsceteepesetato, futhemoe,sameabletooeofthepcpalaalytcaltoolsoftavel demadaalyss,amelytheradomutltymodel(rum).asdefomths pesetatoaldstcto,thesubstatvecotbutoofthepapesto applythewokgsofnolad&smalladbatesetal.toateest tavelles atttudestosk.specfcally,thepapeecoclesthetaspot plae sotoofuelabltywththemcoecoomst sotoofsk(e.g. Patt,1964;Aow,1970),adsodogevealstheteatmetofskwth magalvaluatosoftaveltmeadschedulgudeucetaty.ths povokesthepopostoofafuthemetcfovalugelablty,efeedto asthe elabltypemum.theelabltypemum,whchsdawfom aalogywthpatt s skpemum,solatesthosecostsasgspecfcally 5
8 fomuelabltyad,euvaletly,thebeeftsthatwouldtaspeshould uelabltybeelmated.thepapeexplotstheelabltypemum devgafuthesetofmagalvaluatosoftaveltmeadschedulg, thstmeatthe cetatyeuvalet.thelattevaluatosaethecompaed wththosedevedudeucetaty,aexecsethatsevestoyeld magalvaluatosofelabltypese.thepapecosdestheelevaceof magalvaluatosofelabltyfobothfoecastgadecoomcappasal. 2.Theoyofdvdualchoceudeucetaty Mcoecoomctheoyofdvdualchoceudeucetatysfoudedo thepopostothattheeexstssomeelatobetweeadvdual schoces udeskoucetatyadadstbutoofoutcomes.thshasbee explotedtheelabltylteatue;thepesetpapeweshallexame thepatculapopostothattavelleschooseatmeofdepatueothe bassofadstbutoofthecoseuetavaltmes.thetepetatoof thepobabltydstbutohasbeethesouceofsomecotetothe mcoecoomclteatue,scetsemboledwththedchotomybetwee skaducetaty.keyes(1921,1936)adkght(1921)aehelpfulths egad,chaactesgskasstuatoswheepobabltesofoutcomesae kow(okowable),aducetatyasstuatoswheesuchpobabltes 6
9 maybeethekowableodefable.thoughtoffesaappealgclaty, twouldotseemcucaltothesubseuetaalyssthatoecommtstoths oayothetypology.rathethetemsskaducetatywll,what follows,beusedtechageablywthoutmplcato. Moecetaltoouteeststhepecseatueoftheelatobetweea dvdual schocesudeucetatyadthedstbutoofoutcomes;ths maybefomalsedthefollowgtems: Let E beafteadexhaustvesetofmutuallyexclusve evets : { e } E =,..., 1 e K Let E beassocatedwthavecto w,whchsefeedtoasa pospect,ad gvesthepobablty payoff w k pk thateachevet e k E wlloccu,togethewththe tothedvdualshouldthatevetdeedoccu,thus: w = ( w w ; p,..., ) 1,..., 1 K p K Followgtheusualulesofpobablty,tsecessalythecasethat K p k k = 1 = 1,mplygthat 0 p 1fo k = 1,..., K. k 7
10 Let S beafteadexhaustvesetofsuchpospects,fomwhchthe dvdualsvtedtochoosehsohepefeedpospect: { w,..., } S = 1 w N ThesemalexpostoofvoNeuma&Mogeste(1947)establsheda setofecessayadsuffcetaxomsotheabovedeftossuchthata dvdualcouldbeepesetedasfchoosgthepospect w S thatyelds maxmumexpectedutlty.theseaxomshavesubseuetlybeeadapted vaousways;ofpatculaotethsegadaethecotbutosof Maschak(1950),HesteadMlo(1953)adFshbu(1970).Iwhat follows,howeve,weemafathfultotheogalexposto,whch povdesabassfothefollowgpoposto: Foaypaofpospects w, w S: w f ff Y ( ) Y ( w ) w w ( wheey w ) stheexpectedutltyofpospect w,adstselfgveby: 8
11 K ( ) = p U ( Y w w )foall w S (1) k = 1 k k ( k wheeu w ) stheutltydevgfompayoff wk. Havgsummasedthetheoy,letuscocludethssectowthdscussoof sevealssuesthatfollow.afstpottomakesthatvoneuma& Mogeste s(1947)axomsaeotsuffcettosuppotacotuous epesetatoofthepayoffdmeso,asadoptedbynolad&small(1995) adbatesetal.(2001),fowhchtheexpectatosopeato(1)would euetegato.acotuousepesetatosfactfeasble,butmust besuppotedbyasetofaxomsthatdvegesfomvoneuma& Mogeste s;seefshbu(1970)fofuthestucto. Asecodpotsthatadsceteepesetatoofthechocedmeso pomoteseadyapplcatotorum,asdemostatedbymaschaketal. (1963).Thscotastswththeheetlyambguouspocessof dscetsg acotuousdmeso(e.g.jotsakasaetal.,2004).iexplotgmaschak etal. sdemostato,tsusefultoatculatethebassfoadoptga pobablstcepesetato,whchsasfollows.cosdeadvdual facedwthaepeatedchocetaskudeucetaty.oaygveepetto ofthechocetask,heoshesabletoodeasetofpospectstemsof 9
12 expectedutlty,butosuccessveepettosthsodegmayshow vaablty.moefomally,thepobabltyofchoosgaypospect w S cabeexpessedasrum,suchthat: P ( w S) { Y ( w ) Y( w )} = P foall w S, (2) Athdpotcocesthecompaabltyofexpectedutlty Y ( w ) acossthe pospects w S.Baumol(1958)dsmssesthecovetoalwsdomthat choceudeucetatypemtsthemutatoofutltyfomaodal metctoacadaloe;thatstosay(1)elesdeedothepopostothat U ( wk ) scadal,butthsdoesotdstactfomtheeuemetthaty( w ) saetelyodalcostuct.moeove,theesobassfotepetg dffeecesexpectedutlty(oayatotheeof)acosspospects.whlst thedeftoofrum(2)adheestothseuemet,tsmpotatto esuethatapplcatosofrumtofoecastgoappasaldoot advetetlystaytocadalty.thelattepossbltyscosdeedby Batley(2006),whodemostatesthat logsum measuemetsofcosume suplusdevedfomrumcayafeeceofcadalty. Fally,tmghtbeackowledgedthatvoNeuma&Mogeste s(1947) aalysshasbeethesubectofsustaedassaultalmostevescetwas 10
13 coceved.ithecotempoaylteatue,expemetalecoomstshave beeactvecotbutos,pesetgstacesofdvdualchocesthat appaetlyvolateexpectedutltymaxmsato(kahema&tvesky s (2000)compedumcludessevealsuchwoks).Thshaspompted geealsatosofvoneuma&mogeste saalyss;foexample, sevealofthedetfedvolatosmaybeaccommodatedthougholea fomsotheevetpobabltes p k (1);seeEdwads(1955)adKahema &Tvesky(1979).Whlstmpotattoackowledge,thsctuehasotto datesucceededdeposgthepaadgmofexpectedutltymaxmsato, adtwouldtheefoeseemetelyeasoabletoadheetovoneuma& Mogestewhatfollows. 3.Thetheoyappledtotpschedulg ThecotbutosofNolad&Small(1995)adBatesetal.(2001)establsh pecedeceapplygthetheoyofdvdualchoceudeucetatyto thecotextoftpschedulg.thepuposeofthepesetsectosto explcatethsapplcato;thesubseuetaalyssfollowsthesepecedet wokseasoablyfathfully,savefotheepesetatooftmeasadscete vaable. 11
14 3.1.Pelmaydeftos Iapplygthetheoyoutledsecto2totpschedulg,twouldseem easoabletoepesetchocetemsofdepatuetmeadevetstems ofavaltme,adtopostulatethatucetatydevesfomthedstbuto ofavaltmesfoaygvedepatuetme.wthefeecetonolad& Small stypology,thsdstbutocouldfeasblydevefomecuetdelay, fomcdetelateddelay,ofombothoftheafoemetoed.moe fomally: Let A beafteadexhaustvesetofavaltmes: { a } A =,..., 1 a K Let D beafteadexhaustvesetofdepatuetmes: { d } D =,..., 1 d N Thelattecoespodstothechoceset S,asdefedsecto2: 12
15 { w,..., } S = 1 w N LettheexpectedutltyY ofaypospect w S begveby: Y K = p k = 1 k U k (3) wheeu stheutltydevgfomtheavaltme a,havgdepatedat d,ad k pk 3.2Utltyfucto stheassocatedevetpobablty. Itemastoeuputlty U k wthmoepecsefom.whlstthetheoyof k secto2wouldseemtomposefewestctososuchfom,thetp schedulglteatuedemostatescosdeablesuppotfosmall s(1982) utltyfucto,adthsfuctosstaghtfowadlyadoptedbynolad& Small(1995)adBatesetal.(2001).Iwhatfollows,weshallouselvesfollow thscoveto,butsodogdemostatethatsmall sutltyfucto mplespatculapopeteswthespecttotavelles atttudesto uelabltyavaltme. WthefeecetoSmall(1982),defeutlty: 13
16 U k = α T + βsde + γsdl + δl (4) k k k k whee: T staveltme SDE sscheduledelayealy SDLsscheduledelaylate L sadummyvaablethatsutaythecaseoflateaval,adzeo othewse HeceSmall sutltyfucto(4)cabeseetobealeafuctooffou attbutestaveltme,scheduledelayealy,scheduledelaylateada lateessdummywheethelattetheeaecodtoedbythe pefeed avaltme ( PAT )ofthetavelle,whchwetakeasgve.othsbass,let useexpesstheattbutesof(4)temsofoudmesosofteest avaltmeaddepatuetmefogve PAT : T k = a d k SDE SDL k k [( PAT a ),0] = max [( a PAT ),0] = max k k L = 1f ( a k PAT ) > 0, = 0othewse k 14
17 Nowcompletgouapplcatoofthetheoyofdvdualchoceude ucetatytothecotextoftpschedulg,letusexplcatethedeftoof thepospectvecto,thus: w = [( T SDE, SDL, L ),...,( T, SDE, SDL, L ); p,..., p ] 1, K K K K 1 K MoeovetheadoptoofSmall sutltyfuctomplesthepopostothat payoffsaegvebyaamalgamofthefouattbutesofthatfucto,thee ofwhchaemeasuedtmeuts,adthefouthasadummyvaable. ThuswhlepevousapplcatosofvoNeuma&Mogeste(1947) havefocussedheavlyomoetaypayoffs,twouldthepesetcotext seematual,adotoutsdetheemtofthetheoy,toepesetpayoffs tmeuts.iaycase,tavelcostsdootoutelyvaybyavaltme,such thattheavaltmedmesomayotbeeadlyameabletomoetsato. Thatdoesotpecludethepossbltythatavaltme(patcula,lateess) maycucdetalcosts.ratheaysuchcostswllaseasafuctoof avaltme,aswouldseemtutvethecaseoflateess,adtheatttudes oftavellestosuchcostswllmafesttheatttudestotheucetatyof avaltme. 15
18 Letusdeveaschematcepesetatooftheutltyfucto(4)foay depatuetme d D,butestctattetotoabaysubsetofavaltmes ~ A A.Ipatcula,let A ~ = { a, a },wheethefollowgelatoshold: a a < PAT < m a.thatstosay,let a betheealestfeasbleavaltme (.e.feeflowcodtos),adlet a ad a betwofutheavaltmes thataedefedabtalysavefotheeuemetthat m a fallsbefoethe PAT ad a aftethe PAT. Fgue1:Small sutltyfucto,fogvedepatuetme,wthα < β (ABOUT HERE) ThssllustatedbyFgue1,whchepesetsavaltmeothehozotal axs,adutltyothevetcal.allattbutesoftheutltyfuctoae bad,.e.α, β, γ, δ < 0 (4),adU stheefoedawtheloweghtuadat ofthefgue;otealsothatu ogatesattheealestfeasbleavaltme am.nowcosdetheutltydevedatavaltmes a ad a, espectvely: At a = a :U = α( a d ) + β ( PAT a ) At : a a = U = α ( a d ) + γ ( a PAT ) + δ 16
19 Cosdealsotheutltydevedastheavaltmeappoachesthe PAT fom a ad a,espectvely: As ( PAT a ) 0:U α ( PAT d ) α( a d ) + α( PAT ) As ( ) 0 a a PAT : α ( PAT d ) + δ α a d α a PAT + U ( ) ( ) δ WecaowestablshtheslopeoftheutltyfuctoU,whchfoaval tmesbefoethe PAT mustbe ( α β ),adfoavaltmesaftethe PAT mustbe ( α + γ ).Fopuposesofllustato,Fgue1explotsSmall s(1982) empcalfdgthatα < β,.e.thattaveltmemposesgeatedsutlty thascheduledelayealy.thsegedesthepopetythatu sstctly deceasgutlty,adsteepeaftethe PAT thabefoe.cotawse,f tsteadheldthat β < α,thethetwopotosofu wouldshowopposg slopes,wthavaltmesbefoethe PAT chaactesedbypostveslope,ad avaltmesaftethe PAT byegatveslope.ithslattecase,theabsolute slopeofthefstpotoofu maybegeatethaolessthathesecod poto,depedgotheelatvedsutltyofscheduledelayealy.fgue2 embodestheelatos β < α ad ( α β ) < ( α + γ ),suchthatthetwo potosofu showopposgslopes,wththepotobefoethe PAT caygloweabsoluteslopethathepotoaftethe PAT. 17
20 Fgue2:Small sutltyfucto,fogvedepatuetme,wth β < α (ABOUT HERE) Fally,tmghtbeobsevedthatFgues1ad2dvegefomthemoeusual pesetatoofsmall sutltyfucto,aspehapsllustatedbyfgue1of Batesetal.(2001).ThssbecauseFgues1ad2ofthepesetpape cosdebothtaveltmeadschedulgpaametes,wheeasfgue1of Batesetal.cosdesolyschedulgpaametes.Thepesetatoadopted thepesetpapesmotvatedbyadesetoclealyatculatetheelato ofthecompleteutltyfuctototheexpectedutltyfucto,ateestthat weshallpusuethefollowgsectos.moeove,tspehapshelpfulfo puposesofdstctotoefetofgue1ofbatesetal.assmall s schedulgfucto,adtofgues1ad2ofthepesetpapeassmall s utltyfucto. 3.3Expectedutltyfucto Foeasosofbevty,thsadsubseuetsectoswllfocusattetoo Small sutltyfuctowththepopetyα < β,.e.asfgue1, patculalyasthspopetycaestheempcalsuppotofsmall(1982) hmself.whlsttshouldbeeassuedthatthegeealpcplesofthe 18
21 aalyssextedalsotofuctoswththepopety β < α,.e.asfgue2, somedffeecesaalyssdoase,adtheseaeemakedupowhee elevat. Iodetopomoteexpostoalclaty,letusoceagaestct cosdeatotoabaysubsetofavaltmes ~ A A ~ = a a,,whee A {, } thstmemposg(atleastfothemomet)theestctoolythat a < Foeachdepatuetme d D,defethepospect: a. [( T, SDE, SDL, L ), ( T, SDE, SDL, L ); p,( p )] w = 1 Nowpopagatgexpectedutlty(3)wththeutltyfucto(4),letuswte theexpectedutltydevgfomtheabovepospect: Y = { p [ αt + βsde + γsdl + δl ]} + {( 1 p )[ α T + βsde + γsdl + δl ]} (5) Omoegeeally: Y ( T ) + βe( SDE ) + γe( SDL ) δe( L ) = α E + (6) 19
22 Fgue3:Utltyadexpectedutltyfuctos,fogvedepatuetme,wthα < β (ABOUTHERE) Thebaysubsetofavaltmes(5)pemtseasytaslatotothe dagammatcaalyssoffgue3,wheetheecasesmghtusefullybe detfeddepedgotheelatooftheavaltmestothe PAT,thus: Case1: a < a PAT Case2: PAT a < a Case3: a < PAT < a Letusdawsomeobsevatoselatgtoeachofthetheecases,asfollows: Case1: a < a PAT ExpectedutltylabelledY Case1 thefguewllthscasefallsomewhee othesectooftheutltyfuctou pecedgthe PAT ;pecselywhee wlldepedothepobablty p thatavaltme a actuallyoccus. Case2: PAT a < a Bycotasttothepevouscase,expectedutltyY Case 2 wllowfall somewheeothesectooftheutltyfuctou thatcomesaftethe PAT. Sceutltysstctlydeceasgtaveltme,tmustholdthat Case 2 Case1 Y < Y ;hececase1domatescase2. 20
23 Case3: a < PAT < a AgawthefeecetoFgue3,cosdethepaofavaltmes Case 3 a ad Case3 a,whchsatsfytheeuemetsofcase3,butaeothewsedefed Case 3 Case3 abtaly.ifwedetfythepotatwhch ad tesectthe a a utltyfuctou,theexpectedutltyy Case 3 wllfallsomewheeothe staghtleogthesetwopots.thedscotutyofu toduces somecomplextes,howeve,asweshallseeduecouse. 3.4Chocebetweepospects Havgdevedexpectedutltyfoaydepatuetme d D,letus cosdethechocebetweeapaofpospects w, w tothedepatuetmes d S,whchcoespod, d D.Futhemoe,let d < d,suchthat d s theealeofthetwodepatues.scevoneuma&mogeste s(1947) axomsefeetelytothepopetesofpas,abaychocewouldot seemueasoablyestctve.itmghtalsobeemakedthatbaychoce wouldseempatculalyameabletomplemetatowthstated Pefeece(SP). Followgsecto2,tmustholdthat: 21
24 w f ffy Y 0 w w f ffy Y 0 w w ~ ffbothy Y 0 ady Y 0 w Scethesetheepefeeceelatosaedctatedbythedffeece expectedutlty,letusdeve: Y Y ( d d ) + [( p p )( α a + β SDE + γ SDL + δ L) ] = α (7) whee: a = SDE = SDL = ( a a ) > 0 ( SDE SDE ) 0 ( SDL SDL ) 0 L = 1f a < PAT <, = 0othewse a Itmaytheefoebesee,wthefeeceto(7),thatthedffeeceexpected utltysafuctoofthedffeecedepatuetme,aswellasdffeeces expectedavaltme,expectedscheduledelayealy,expectedschedule delaylateadtheexpectedlateessdummy(wheethelattemayothewse beefeedtoasthepobabltyoflateess). 22
25 NowdectgattetotoFgue4,letustaslatethepecedgalgebac aalysstoadagammatcoe.theeade sattetosfstdawtothe utltyfuctosu ad U,whchpetatothedepatuetmes d ad d espectvely.wthefeecetothehozotalaxs,otethatthetwo depatueswll,assumgcostatfeeflowtaveltme,havedffeettmes ( ) ( ) fotheealestfeasbleavals(.e. am d < am d ).Thetwoutlty fuctosogate,theefoe,fomdffeetpotsotheavaltmeaxs. Wthefeecetothevetcalaxs,thetwofuctosaesepaatedbythe costat α ( d ) d,whchepesetstheutltydffeeceasgfomthe dffeecetheespectvedepatuetmes.othewsethetwofuctos caythesamepopetes,wthcommoschedulgpaametesad PAT. Fgue4:Chocebetweedepatuetmes,wthα < β (ABOUTHERE) Havgdefedtheelevatevets,wecaowdevetheexpectedutlty fuctoselatgtothepospects w ad w ;thesefuctosaelabelledy ad Y espectvelythefgue.pecselywheeexpectedutltyfallso thesefuctoswllbedetemedbytheexpectedavaltmes E E( a ).Ifhowevetholdsthat ( ) a ad a a,.e.theealeavaltmewththe m pospectsfallsatoaftetheealestfeasbleavaltme,twouldseem ucotovesaltomaketheassetothat p > p,.e.theealedepatue 23
26 d smoelkelytoaveat a thathelatedepatue d.thoughtsleft pactcetoempcalvestgatotodetfytheexpectedavaltmes ( ) a ( ) E ( ) ( ) a E ad,thefguellustatesastuatowhee E a < PAT < E, a wthaoutcomethat Y >.Ithsstuato,theefoe,pospect w would bechoseovepospect Y w. 4.Magalvaluatosoftaveltmeadschedulg,adtheelablty pemum Thepevoussectoappledthetheoyofdvdualchoceude ucetatytotpschedulg.thseupsuswththeecessaytheoyto owdevelopthepcpalteestofthepape,whchsthevalueof elabltytoadvdualtavelle.whlstackowledggthatthevalueof elabltyhasbeevaouslydefed(seedejogetal.,2004),thefollowg aalysswllexplotadextedbatesetal. s(2001)defto,whchs goudedthetheoyofsecto3.letusfstsummasebatesetal. s defto,befoecosdegtsexteso. 4.1Batesetal. smagalvaluatosoftaveltmeadschedulgudeucetaty 24
27 FollowgBatesetal.,theelabltyofavaltmemaybeepeseted temsoftheevetpobabltesofvoneuma&mogeste s(1947) aalyss;wthefeeceto(5),foexample,aychageelablty(.e. p ad p )wllmpactupoexpectedavaltmead,bymplcato,expected taveltme,expectedscheduledelayealy,expectedscheduledelaylate,ad theexpectedlateessdummy.applygthsepesetatoofelabltyto empcalvestgato,batesetal.devseadmplemetabaychocesp expemet,adfomthsdatafemagalvaluatosofexpectedtavel tme,expectedscheduledelayealy,expectedscheduledelaylateadthe expectedlateessdummy. LetusllustatetheubofBatesetal. sempcalvestgato,butwththe cotextofouowwokg.webegbysupplemetgtheexpectedutlty fucto(5)wthavaableepesetgtavelcost,otgmpotatlythat costsdexedbydepatuetmebutotbyavaltme.moefomally,fo aypospect w S let: Yˆ = Y + φc (8) whee c sthetavelcostofpospect w.adoptg(8),letusetutothe chocebetweethepa w, w S.Ctcaltothschocesthepotat 25
28 whchthedvdualsdffeetbetweethepospects;ewokg(7)we caestablshthat: IfYˆ ˆ Y = 0 the: ( c c ) = α ( d d ) + [( p p )( α a + β SDE + γ SDL + δ L) ] φ (9) Thepopostoowemegesthatadvdualtavellemghtbewllgto exchageaadustmetcostdffeece,.e.thelefthadsdeof(9),fo adustmetsoeomoeofthetaveltmeadschedulgdffeeces,.e. theghthadsdeof(9).acceptgthspopostoofexchage,twould seemaelatvelysmallextesotosolatetheateofexchagebetwee tavelcostadeachcosttuetofexpectedutlty,adtheebydeve magalvaluatosofexpectedtaveltme,expectedscheduledelayealy, expectedscheduledelaylate,adtheexpectedlateessdummy.fo example,letusdevemagalvaluatoofexpectedtaveltme Vo E T thus: IfYˆ ˆ = 0 the: φ Y β, γ, δ = 0 ( c c ) = α{ [ E( a ) E( a )] + ( d d )} Vo ( E( T )) α = = φ ( c c ) [ E( a ) E( a )] + ( d d ) ( ( )) (10), 26
29 Magalvaluatosofexpectedscheduledelayealy Vo ( E( SDE) ),expected scheduledelaylate Vo ( E( SDL)),adtheexpectedlateessdummyVo( E( L) ) cabedevedaalogously,asshowappedxa. 4.2Atttudestouelablty Theexpostoofsecto3would,applygthetheoyofdvdualchoce udeucetatytotheelabltyofavaltme,seemtoestablsh syoymtybetweethemcoecoomst sotoofucetaty(osk)ad thetaspotplae sotoofuelablty.thstupovokesa teestecoclgbatesetal. smagalvaluatosoftaveltmead schedulgudeucetatywthestablshedmcoecoomcmethodsfo valugtheskheetpospects.ipusugthsteestoemght, ekdlgtheealedscussosecto3.2,dstgushbetweeatttudes toskymoetayoutcomesadatttudestoskytmeoutcomes.whlstthe fomehaveattactedcosdeableeseachatteto,thelattehaveot, hecetheoppotutyfofuthevestgato. Tothsed,letuscosdethepatculacoceptofthe skpemum (Patt, 1964),whchcaesaappealgtutoadcommadscosdeable 27
30 suppotacossthemcoecoomccommuty.theskpemumasesfom theelatobetweetheexpectedutltyfuctoadtsudelygutlty fucto,adscucallydctatedbythedvdual satttudetowadssk. Befoepoceedgtotheskpemum,letusthecosdeatttudestoskas theyapplytoouteesttheelabltyofavaltme.webegby devgtheutltyoftheexpectedavaltme,thus: U ( E( a )) = α [ E( a ) d ] + β max[ ( PAT E( a )),0] + γ max[ ( E( a ) PAT ), 0] + δl( E( a )) whee: E ( a ) p a + ( p ) a = 1 (11) L( E( )) = 1f ( ( a ) PAT ) > 0 a E, = 0othewse Thecompagtheutltyoftheexpectedavaltmetoexpectedutlty, Jese seualty(seefoexamplejohasso,1991)povdesabassfothe followgfeeces: IfY = U E( a )) thethetavelles skeutalavaltme IfY > U IfY < U ( ( E ( a )) ( E ( a )) thethetavelles skpefeedavaltme thethetavelles skaveseavaltme Itemastoestablshthepevaleceofthesetheeelatos,whchaga vokesthesametheecasesassecto3.3: 28
31 Case1: a < a PAT Thsalwaysyeldstheeualty Y = U ( E( )) skeutalty. Case2: PAT a < a a,suchthatthetavelleexhbts TheeualtyY = U E( a )) agaholds,adafeeceofskeutaltymay theefoebedaw. ( Case3: a < PAT < a Thscasesmoeambguous,adtsstuctvetotoducethefuthe dchotomy: ( a ) PAT Case3.1: E < WheeCase3holdsadtheexpectedavaltmesealethathe PAT,the dffeecebetweeexpectedutltyadutltyoftheexpectedavaltmes gvebytheuatty: Y [ β + δl ] ( E( a )) = ( p ) ( a PAT ) + γ ( a PAT ) U 1 Sce β, γ, δ < 0 ad 0 1bydefto,ad p ( PAT ) > 0 assumpto,tmustbethecasethat Y < U ( E( )) a a by.thetavelletheefoe 29
32 exhbtsskaveso.thscabecofmedthoughefeecetofgue3, wheetheutltyfuctou lesabovetheexpectedutltyfuctoy thoughouttheteval[ a, PAT ]. Case3.2 PAT < E( ) a WheeCase3cotuestoholdbuttheexpectedavaltmesowlatetha the PAT,thedffeecebetweeexpectedutltyadutltyoftheexpected avaltmebecomes: Y U ( E( a )) = p [ β ( PAT a ) + γ ( PAT a ) δl] whee L L = L( E( )) = a Iasmlamaetobefoe, β, γ, δ < 0 ad 0 p 1bydefto,ad ( PAT a ) > 0 byassumpto.ulkecase3.1,howeve,tcaotbe detemedapowhchofy adu ( E( )) wllbethegeate.ratheoe mustdefetotheempcaloutcome,whchwllbedctatedbythepoxmty oftheavaltmes a ad a tothe PAT.WthefeecetoFgue3,fo example,theutltyfuctou lesabovetheexpectedutltyfuctoy fo ayavaltmetheteval [ PAT, ] a a ;.e.skaveso.cotastthswth Fgue5,wheetheexpectedutltyfuctotesectsthevetcalsegmet 30
33 oftheutltyfucto,adtheutltyfuctotheefoelesbelowthe expectedutltyfuctothoughouttheteval[ PAT, ];.e.skpefeece. a Fgue5:Utltyadexpectedutltyfuctos,fogvedepatuetme,wthα < β (ABOUTHERE) Befoemovgo,tshouldbeackowledgedthatPolak(1987)pusues smlateeststotheabove,albetwthdffeetfocus.polakdevotes caefulattetotothefomofhsutltyfucto,postulatgthatthe fuctoshouldbemootocallydeceasgtavelcostaddemostatea costatdegeeofskavesototavelcost(seepatt(1964)adaow (1970)fodscussoofmeasuesofskaveso);cotastthswththe pesetpape,whchsfoudedoatttudestotmeskathethacostsk. Adoptgaexpoetalfomasawokgepesetatoofthepostulated popetes,polakseekstodetfy,asmlamaetosecto3.4above, thepefeeddepatuetmeofadvdualtavelle.thedevelopg deasfuthe,hetoducestheotoofthe safetymag,aspoposedby Gave(1968)adKght(1974),adestablshesaelatoshpbetweethe magtudeofthesafetymagadthedegeeofskaveso. 4.3Theelabltypemum 31
34 Retugtoouowaalyss,letusowdevelopPatt s(1964)coceptof theskpemumthecotextoftpschedulg.asapecuso,letusfst toducethecoceptofa cetatyeuvalet,whchthepesetcotext maybedefedasfollows.thecetatyeuvaletelatgtoaypospect w S stheavaltme a ~ thatyeldsthesameutltywthcetatyasthe expectedutltyofthepospect.icases1ad2ofthepevoussecto,both ofwhchmplyskeutalty,utltyadexpectedutltyaeoeadthe same,adtheotoofacetatyeuvaletstheefoesomewhat tautologcal. OfathemoeteestsCase3,scetcaesapotetalfoskaveso. Subseuetdscussowllevealatutothat,developgthe cetatyeuvaletfocase3,thecetatyeuvaletshouldbecostaed tofallwththetevalofavaltmesdefedbythepospect,.e. a a ~ a.letusfothemometsmplyacceptthseuemetad,by aalogytocases3.1ad3.2,dstgushbetweecaseswheethecetaty euvaletfallsbefoeadaftethe PAT,asfollows: Case3.3: a a ~ < PAT 32
35 Idevelopgthscase,letusestablshbywayofassetoeuvalece betweeexpectedutltyadtheutltydevgfomthecetaty euvalet,.e. Y α ~ ~ ),whee a a ~ PAT Let = ( a d ) + β ( PAT a < Reaagg,wecathedetfythecetatyeuvalet: Y + αd βpat a~ = (12) ( α β ) Case3.4: PAT < a ~ a Nowepeatgthesameexecse,butfoacetatyeuvaletlatethathe PAT : Y = ~ ~ δ ~ Let α ( a d ) + γ ( a PAT ) + L( a ) ~ = whee L( ) 1f ( PAT ) 0 a a~ >, = 0othewse,ad PAT < a ~ a Reaagg: 33
36 Y + αd + γpat δl( a~ ) a~ = ( α + γ ) Notethat,wthefeecetoealedscussosecto3,thedeomatoof thecetatyeuvaletfocases3.3ad3.4sgvebytheslopeofthe elevatsectooftheutltyfucto.whlsttheabovewokgcaesa appaetclaty,tmghthowevebecautoedthatthepopetesofthe fuctomoepatculaly,tsdscotutycaythemplcatothata exactcetatyeuvaletsotempcallyguaateed.nevetheless,letus poceedtothedeftooftheskpemum. Igeealtems,theskpemummeasuesthedvdual swllgessto pay,utsofthepayoff,toavodtheskofchoosgauceta pospect.omoesuccctly,theskpemummeasuesthe costofsk beag.applygthesedeftostoouteesttheelabltyofaval tme,theskpemumopesetpalace,the elabltypemum measues,foagvedepatuetme,thedelayavaltme(wthts coseuetmpactsotaveltme,scheduledelayealy,scheduledelaylate adthelateessdummy)thatthedvdualwouldbewllgtopay exchagefoelmatgtheuelablty.theelabltypemumthus measuesthecostsboebythetavellethatasespecfcallyfom uelabltyavaltme. 34
37 Nowadoptggeatefomalty,defetheelabltypemum: K [( a~ E( a )), 0] = max (13) Scethepayoffsthsstacedefedoabad(.e.avaltme),the expectedpayoffmustbesubtactedfomthecetatyeuvaletodeto yeldtheelabltypemum K.Notetheeuemetothesgof K, whchmplesthataozeoelabltypemumsepesetatveofsk avesebehavou.theelabltypemumsllustateddagammatcally Fgues6ad7,agawthα < β.fgue6cosdesaexpectedlateaval, addemostatesthatatavellewouldyeldeualutltyfomthepospect Y adthecetaavaltme a ~,theebydetfygtheelabltypemum tobethedstace a ~ E a ). Fgue7applesaalogouslytothecaseofa ( expectedealyaval,wthsmlaesult;thetavellewouldbedffeet betweethepospectadacetaavaltmeustealyofthe PAT.Whlst Fgues6ad7wouldseemeasoablyclea,thedscotutyofU toducessomecomplextes;fpatculay tesectsthevetcal segmetofu themaeoffgue5,thethecetatyeuvaletmay fallbefoetheexpectedavaltme,suchthattheskpemumbecomeszeo accodacewth(13). 35
38 Fgue6:Theelabltypemumofaexpectedlateaval,fogvedepatuetme, wthα < β (ABOUTHERE) Fgue7:Theelabltypemumofaexpectedealyaval,fogvedepatue tme,wthα < β (ABOUTHERE) Ifweowexteddscussooftheelabltypemumtocosdethe elato β < α,thetsappaetthatfuthecomplextesase.wth efeecetofgue8,whchomtssomelabellgthehopeofpomotg claty,theopposgslopesofthetwosegmetsofu yeldthepaof cetatyeuvalets a ~ ad a ~.Itmghtbeotedthat,wheeas a ~ falls wththeteval [ ] a a,, a ~ doesot.futhemoe,whlst a ~ fallsaftethe expectedavaltmeadtheefoeyeldsthepossbltyofaozeo elabltypemum(ackowledggagathepossbltyofazeoelablty pemumshouldy tesectthevetcalsegmetofu ), a ~ fallsbefoethe expectedavaltmeadwllevetheefoeyeldaozeoelablty pemum.hece,weaveatatutofothecostat a a ~ a toducedattheoutsetofthssecto. 36
39 Fgue8:Theelabltypemumofaexpectedealyaval,fogvedepatue tme,wth β < α Befoepoceedg,tsusefultodstgushtheotooftheelablty pemumfomtheafoemetoedotoofthesafetymag,thateach devesfomadffeetefeecepot.wheeastheelabltypemum devesfomtheefeecepotofthecetatyeuvalet,thesafetymag devesfomtheefeecepotofthe PAT.Thspovokesthempotat dstctothatthesafetymagpetasolytoealyavals,wheeasthe elabltypemummaypetatoetheealy(.e.fgue7)olate(.e. Fgue6)avals.Ideed,theecessalytheoetcaldscussoabovemght beembellshedwththeemakthattheelabltypemumoffesatoale foapactcethatswdelyappledthepublctaspotdusty,thus.a opeato,ffacedwththestuatopesetedfgue6,couldtoducea ceasedoueytme(.e. a~,suchthatthedvdualcusalate d aval)adstllmatamaketshae(.e.matathedvdual slevelof utltyat Y ),povdedtcouldesuefullelabltyofsevce(.e.movefom theexpectedutltyfuctoy totheutltyfucto U ). 4.4RecoclgtheelabltypemumwthBatesetal. 37
40 Havgtoducedtwoalteatveotosofthevalueofelabltythe elabltypemum(secto4.3)adbatesetal. s(2001)magalvaluatos oftaveltmeadschedulgudeucetaty(secto4.1)letusowseek toecoclethem.tothsed,adexplotgtheaalyssofthepevous secto,wecaeexpessexpectedutltyastheutltyatthecetaty euvalet: ( a ~ ) = α ( a~ d ) + β max[ ( PAT a~ ),0] + γ max[ ( a~ PAT ),0] + δ L( a ) Y = U ~ Ifthedvdualtavellesskavesethewecasubsttutefo a ~ usgthe skpemum K,thus: Y = α [ E( a ) + K d ] + β max[ ( PAT E( a ) K ),0] + γ max[ ( E( a ) + K PAT ),0] + δ L( E( a ) + K ) (14) Shouldweowtoducetavelcostto(14)themaeof(8),theweca deveafuthesetofmagalvaluatos,butthstmeatthecetaty euvalet.foexample,letusdevemagalvaluatooftaveltmeatthe cetatyeuvalet: IfYˆ ˆ = 0 the: Y β, γ, δ = 0 38
41 φ ( c c ) = α {( K K ) + [ E( a ) E( a )] + ( d d )} Vo ( T ) α = = φ ( c c ) ( K K ) + [ E( a ) E( a )] + ( d d ) (15) Magalvaluatosatthecetatyeuvaletofscheduledelayealy, scheduledelaylateadthelateessdummyaemoecomplcated.whlstt seasoabletoestctattetotocase3(.e. a < PAT < a ),emembeg thattheelabltypema K ad K aepetetolytocodtosofsk aveso,thsdoesotcostathecetatyeuvalets a ~ ad a ~ tofall ethesdeofthe PAT.Rathetsecessaytodefetheefuthe possbltes,asextesosofcases3.3ad3.4,thus: Case3.5: a~, a~ PAT Case3.6: PAT a~, a~ Case3.7: a ~ < PAT < a~ TableIdsplaysthecompletesetofmagalvaluatosatthecetaty euvalet,wththefsttheecolumsdscmatgbytheabovethee cases.ofpatculateestswhethethesemagalvaluatosatthe cetatyeuvaletaccodwththosepevouslydevedudeucetaty. Fopuposesofthscompaso,tsusefultocosdehow(10)ad(A1)to (A3)applytoCase3,adtheseaegvethefalcolumofTableI. 39
42 TableI:Magalvaluatosoftaveltmeadschedulgudeucetatyadat thecetatyeuvalet(abouthere) WthefeecetoTableI,compasoofthemagalvaluatosoftavel tmeudeucetatyadatthecetatyeuvalet,whchaegveby α φ (.e.fomeuato(15))adα φ (.e.fomeuato(10))espectvely, evealsthatthedeomatosofthetwovaluatosdffebytheuatty ( ) K K.Thesevaluatoswlltheefoebeeualolyf K =.Whlst K thelatteeualtymayfeasblyhold,theesoapobassfoecessaly expectgthsesult,adtwouldseemutepossblethatmagal valuatooftaveltmeudeucetatywlldffefomthatatthecetaty euvalet. Nowcosdemagalvaluatoofthelateessdummy.ICases3.5ad 3.6,themagalvaluatosudeucetatyadatthecetatyeuvalet (.e.δ φ adδ φ espectvely)wllbeeualf c = c.icase3.7,smla eualtywllasefboth p = 1ad p = 0.Notepassgthat,assecto 3.4hasaleadycosdeed,oewouldpactceexpecttheeualty p > p tohold,whchwouldbecosstetwtheualtybetweemagal 40
43 valuatosofthelateessdummyudeucetatyadatthecetaty euvalet., ad Fally,themagalvaluatosofscheduledelayealy ( β φ β φ) scheduledelaylate ( γ φ γ φ), showsmladffeecesthefomulae whecompagucetatywththecetatyeuvalet.itwouldhoweve seemmoedffculttopedcttheoutcomeapo,adoemuststeaddefe toempcalvestgato. Thatotwthstadg,thepecedgtheoetcalagumethasllumatedthe possbltythatmagalvaluatosoftaveltmeadschedulgatthe cetatyeuvaletwllshowdscepacyfomthesamevaluatosude ucetaty.whethetheoetcaldscepacyesultsempcaldscepacy emastobesee,adthspovokesacallfofutuewokaddessgsuch mattes.shouldthedscepacybecofmedempcally,thetcaes mpotattepetatoasthedvdualtavelle swllgesstopay(ow moetayuts)toelmateuelabltyavaltme.foexample,the uatty ( α φ α φ) epesetsthedvdual swllgesstopayto elmateuelabltyavaltme,specfcallyastmpactsupotavel tme;tmghttheefoebeefeedtoasthe magalvaluatoofelablty taveltme.smlatepetatosapplytotheothecosttuetsof 41
44 Small s(1982)utltyfucto;theuatty ( β φ β φ) mghtbeefeedto asthe magalvaluatoofelabltyscheduledelayealy,adsoo. 5.Thepevaleceaddstbutoofbeeftsfomtheelabltypemum Whlstmagalvaluatosoftaveltmeadschedulgudeucetaty aethemselvespefectlyadeuatefopuposesoffoecastgdvdual choceudeucetaty,tsolythoughthecompasotomagal valuatosoftaveltmeadschedulgatthecetatyeuvaletthatthe effectofuelabltyavaltmeochocecabeevealed.suchsght mghtusefullyfompublctaspotopeatosastotheeffectsofchages elabltyothedvdualtavelle schoceofdepatuetme.moe geeally,themmsatoofskmaybeampotatpolcyaspato,ad magalvaluatosofelabltycould,tothsed,offeausefulmeasof dscmatgbetweealteatvevestmetoptos. Thoughtsctomagalvaluatosofelablty,aguablythemoe sgfcatcotbutooftheelabltypemumstoecoomcappasal. AsPeaceadNash(1981)obseve,thepoectedbeeftsofaytaspot schemewhchmaycludebeeftsfommpovedelabltyshould mtgatefothecostofheetsk,adfaluetodosotoducesthe 42
45 possbltyofbas.hecetwouldseemcucaltomakeexplctstatemetof thecostofuelabltyavaltmetothedvdualtavelle(o euvaletly,thebeeftofelmatgthatuelablty),whchfoay pospect w S sgveby: Vo ( K ) = α φ *[ a~ E( a )] + β φ *{ max[ ( PAT a~ ),0] max[ ( PAT E( a )),0]} γ φ *{ max[ ( a~ PAT ),0] max[( E( a ) PAT ),0]} δ φ *[ L( a~ ) L( E( a ))] + (16) + Notgmpotatlythatthepotetalbeeftofelmatguelablty mafestsolyudeccumstacesofskaveso,letuscosdethe pevaleceofsuchbeeftelatotothesametheecasescosdeed eale. Case1: a < a PAT Ithscase,theewouldbelbeeft(.e. Vo( ) = 0 K (16))tothetavelle fomtheelmatoofuelablty;thssbecausethetavelleexhbtssk eutalty. Case2: PAT a < a ThswouldyeldthesameoutcomeasCase1. 43
46 Case3: a < PAT < a Thetavellemghtomghtotealsebeeftfomtheelmatoof uelablty,asfollows: ( a ) PAT Case3.1: E < Theewouldbeuambguousbeeft(.e. Vo ( ) > 0 K ),scethetavelle exhbtsskaveso. Case3.2 PAT < E( ) a Thepevaleceofbeeftwoulddepedothepoxmtyoftheavaltmes a ad a tothe PAT,adthecoseueteffectoatttudesto uelablty. Scetheaboveoutcomesaedctatedbytheelatooftheavaltmes a ad a tothe PAT,oecouldtheefoeexpectthepevaleceofbeeftto vaybythedepatuetmes d D.Thatstosay,oemghteasoably expectelatvelyealydepatuestopetatocase1,elatvelylate depatuestocase2,adtemedatedepatuestocase3. 44
47 Itshouldbeemphassed,howeve,thattheabovecoclusosapply specfcallytothecaseofadvdualtavelle.if,assmoecommo pactce,oesteestedasampleoftavelles, saytheusesofa patculapublctaspotdepatue,thethesamplewouldtypcally demostatesomeheteogeetyespectofthe PAT.Themplcato followsthat,foaympovemettheelabltyofavaltmefothat sevce,someusesmghtealseabeeftfomthatmpovemet,whlst othesmghtot.thetotalbeefttothesamplewouldtheefoedepedo theumbeofbeefcaes,adthedvdualvaluatosoftheelablty pemum.wthefeeceto(2),teestasampleofdvdualssofte developedthoughaetepetatoofrum,wth epettos becomg dvduals,adpobabltesofchocedevgfomdffeecesthe pefeecesofdvdualsacossthesample.iespectveofwhethet devesfomtadvdualotedvdualvaabltypefeeces, extesooftheelabltypemumtoaccommodaterumwouldgveseto dstbutedmagalvaluatosoftaveltmeadschedulg,aswellasto dstbutedmagalvaluatosofelabltytaveltmeadschedulg. Asdefomthematteofaggegato,afutheestctooftheabove aalyssstoabaysubsetofavaltmes,adtsappopateto ackowledgethattheclatyofcase3becomescompomsedocethesetof avaltmessextededbeyodthebay.isuchccumstaces,the 45
48 elatobetweetheutltyoftheexpectedavaltmeadexpectedutlty emaspetetbutmustbeevealedempcally.thatsad,adwth efeecetotheaspatosoutledthetoductotothspape,tmght beaguedthatabaysubsetofavaltmeswouldbgappealg coveecetospaalyssoftheelabltypemum.ishot,thebay casesfafomabstact.icotasttocase3,theuambguousesultsof Cases1ad2eadlyextedtotomalolageavaltmesets. 6.Wokedexampleoftheelabltypemum Letusowllustatethetheoetcalexpostooftheelabltypemumby measofawokedexample,otgthatwewllestctattetotoasgle dvdualadtheefoeavodthecomplcatosofaggegatoust metoed.wthefeecetotableii,whchuatfesalltmesmutes aftemdght,cosdeaoewaycommutewthadepatuetmepofleof 420 (.e.7:00am)to 495 (.e.8:15am),cemetsof5mutes.aval tmesaesmlalydefedcemetsof5mutes,adevealammum oueytmeof30mutes(.e. a = m 450 ).Thscouldbeepesetatveofa hghfeuecyscheduledpublctaspotsevce;alteatvely,tcouldbea dsceteappoxmatotoacabasedouey.thebodyofthetabledsplays theevetpobabltesbydepatueadavaltmes.itmghtbeobseved 46
49 thatthesubsetofavaltmesvaesbydepatuetme,adcotas betweetwoadfvepossbleavals.scethepoblemsmoegeeal thathebaysubsetofavaltmescosdeedabove,aalyssofcase3 musttheefoedefetotheempcalesultsthatfollow. TableII:Payoffmatxfowokedexample(ABOUTHERE) Ifocussgotheelabltypemum,tsuecessaytoexplctlycosde tavelcost,adwetheefoepoceedwththefomulatosofutltyad expectedutltygveby (4)ad(6)espectvely. Letuspopulatethesewth theestmatesofα, β, γ adδ fommodel(1)ofsmall(1982),specfcally α = 0.106, β = ,γ = adδ = 0. 58,otgthatα < β.letus assumealsothat PAT = 525 (.e.8:45am).fgue9plotsthevaousattbutes ofexpectedutltyexpectedtaveltme,expectedscheduledelayealy, expectedscheduledelaylate,adtheexpectedlateessdummyagast expectedavaltme.thepopetesofthsfgueaccodwththoseof pevouspesetatosthelteatue,foexamplefgue2ofbatesetal.( 2001),adcofmthepostoofthe PAT at525. Fgue9:Expectedtaveltme,SDE,SDLadlateessdummyvs.expectedaval tme(abouthere) 47
50 Fgue10plots,foeachdepatuetme,expectedutltyY adutltyofthe expectedavaltme U ( E( a) ).Itmghtbeemakedthatmayofthe depatuetmesaefeo,thatthemaxmumutltyfallsshotofthe mmumutltyofothedepatues.othsbass,wecaestctatteto todepatuetmestheage450to475.ideedexpectedutltys maxmsedwththsage,specfcallyat465.compagtheplotsofy ad U ( E( a) ),tcabeobsevedthatexpectedutltyadutltyofthe expectedavaltmecocdefothevastmaotyofdepatuetmes;these depatuespetatocases1ad2(.e.theespectveavaltmesfall ethealwaysbefoeoalwaysaftethe PAT ).Bycotast,thetwoplots dvegefothe465,470ad475depatues,eachofwhchpetastocase3 (.e.theespectveavaltmesstaddlethe PAT ).Moespecfcally, expectedutltyslessthatheutltyoftheexpectedavaltmefothe465 ad470depatues,wheeastheeveseapplesfothe475depatue.hece wthefeecetothedscussoofsecto4.2,tmaybeseethatthe pefeeddepatuetmeof465selatvelyskycompasotoothe avalabledepatues. Fgue10:Expectedutltyadutltyofexpectedavaltme,bydepatuetme (ABOUTHERE) 48
51 Fally,letuscosdeaexampleoftheelabltypemum,takgthe patculacaseofthe465depatue(scethsdepatueschaactesedby skaveso).theempcalutltyfuctofothsdepatuesshow Fgue11;thsfollowsthechaactestcshapeofthetheoetcalutlty fuctosfgues1ad3to7,wthdstctsectosbefoeadaftethe PAT,adα < β.theempcalexpectedutltyfucto,bycotast,caot beshowthemaeofthetheoetcalexamples,scewehaveexpaded thesetofavaltmesbeyodthebay.suffcetosay,thea valtme wdowextedsfom510to530,hecethepotslabelledy. Fgue11:Utltyadexpectedutltyfuctosfo d = 465 (ABOUTHERE) Fothe465depatue,wecacalculatetheexpectedavaltme(11),gvg ( a 465 ) = E,adthecetatyeuvalet(12),gvg a ~465 = The applygthesetotheelabltypemum(13),wecacalculate K = a~ E a ( ) =,suchthatacetaavaltme2.65muteslate thatheexpectedavaltmewouldyeldthesameutltyastheexpected utltyofthepospect.fally,thevalueofthselabltypemums,wth efeeceto(16),gveby: 49
52 Vo α β φ ( K ) = 65 Cotastthswththe460depatue,whee U ( E( )) Y = ad Vo K 460 = a 460 ( ) Heceelmatoofuelabltyavaltmewouldfothe465depatue (.e.case3)yeldaaddtoalbeefttothedvdual,buttheeso possbltyofsmlabeeftfothe460depatue(.e.case1). 7.Summayadcocluso Uelabltysedemcmaytaspotsystems,adthsstmulates teestwhetheadhowuelabltympactsupothechocesof tavelles.thepapepusuedspecfcteesttheeffectofuelablty avaltmeoschedulgchoce.followgthepecedetofnolad& Small(1995)adBatesetal.(2001),thswasdevelopedthoughthemaage ofsmall s(1982)utltyfuctowthvoneuma&mogeste s(1947) theoyofdvdualchoceudeucetaty.asgfomthelatteuo sthepopostothatuelabltymposesdsutltyothetavelle.hece thepotetalfobeeftshoulduelabltybeeducedodeedelmated. 50
53 Icotasttothepecedetwoksoelablty,thepesetpapeadopteda dsceteepesetatooftme,motvatedpatculabyadesetopomote mplemetatowththeappaatusofrumadsp.thesubstatve cotbutoofthepape,howeve,wasthescopeofthetheoetcal exposto,whchoffeedsgfcatextesosbeyodtheextatelablty lteatue.wthefeecetothetheoetcallteatueoatttudestosk(e.g. Patt,1964;Aow,1970),thepapecosdeedthemplcatosofSmall s utltyfuctofotavelles atttudestouelabltyavaltme,ad patculadetfedccumstacesudewhchtavelleswouldbesk avese.iesposetothelatteobsevato,addawgaalogywth Patt s(1964)coceptoftheskpemum,thepapetoducedtheotoof the elabltypemum.thsmeasues,foagvedepatuetme,thedelay avaltmethatthedvdualwouldbewllgtopayexchagefo elmatguelabltyavaltme. Thepapethesoughttoecoclethscosdeatoofatttudestoskwth Batesetal. s(2001)magalvaluatosoftaveltmeadschedulgude ucetaty.thelatteasefomthepopostothatadvdualtavelle would,choosgbetweepospects,bewllgtoexchagetavelcostfo expectedtaveltme,expectedscheduledelayealy,expectedscheduledelay late,adthepobabltyoflateaval.explotgtheelabltypemum,the papeestablshedabassfocompasobetweemagalvaluatosof 51
54 taveltmeadschedulgudeucetaty,adaalogousvaluatos devedatthecetatyeuvalet.thscompasoevealedthetheoetcal possbltythatthetwosetsofvaluatosmghtshowdscepacy.should thstheoetcaldscepacymafestempcaldscepacywhch emastobeseethetcaesmpotattepetatoasthemagal valuatoofelabltyavaltme. Whlstmagalvaluatosoftaveltmeadschedulgudeucetaty aeadeuatefodemadfoecastg,ecoomcappasalshouldmtgatethe poectedbeeftsofaschemeagastthecostsofskbeag,adthss wheetheelabltypemumbecomespetet.itscucaltoackowledge thatelabltybeeftsaseolyudethepatculaccumstacesofsk aveso,adthatskavesos,thetemsoftheutltyfucto,dctated bytheelatoofthepossbleavaltmestothepefeedavaltme. Moeove,thepevaleceofbeeftwlllkelyvaybydepatuetmefo gvepefeedavaltme.thsassumesasgledvdualhoweve;oce theaalysssextededtoasampleofdvduals,theoutcomewllbe complcatedbyheteogeetythepefeedavaltmead,tfollows, heteogeetythepevaleceadmagtudeofelabltybeefts.thus foaypatculadepatuetme,ampovemettheelabltyofaval tmemghtyeldbeeftfosometavellesbutobeeftfoothes. 52
55 Ackowledgemets TheauthowassuppotedbyaDepatmetalReseachFellowshpatthe IsttutefoTaspotStudes(ITS),UvestyofLeeds,adbythePlatfom GatGR/S46291/01 Towadsaufedtheoetcalfamewokfotaspot etwokadchocemodellg,whchsfudedbytheukegeegad PhyscalScecesReseachCoucladalsoheldatITS.Theautho gatefullyackowledgesthecommetsofpofessodavdwatlg,pofesso GeaddeJogadMJamesLadoealedafts,aswellasthecommets oftwoaoymousefeees.ayemageosaethesoleesposblty oftheautho. 53
56 AppedxA:Devatoof Vo ( E( SDE) ), Vo( E( SDL) ) ad Vo( E( L) ) IfYˆ ˆ = 0 the: (A1) Y α, γ, δ = 0 Vo ( E( SDE) ) β = = φ ( c c ) ( p p ) SDE IfYˆ ˆ = 0 the: (A2) Y α, β, δ = 0 Vo ( E( SDL) ) γ = = φ ( c c ) ( p p ) SDL IfYˆ ˆ = 0 the: (A3) Y α, β, γ = 0 Vo ( E( L) ) δ = = φ ( c c ) ( p p ) L 54
57 Refeeces Aow,K.J.(1970)EssaystheTheoyofRskBeag.NothHollad, Amstedam. Bates,J.,Polak,J.,Joes,P.adCook,A.(2001)Thevaluatoofelabltyfo pesoaltavel.taspotatoreseachpate,37(23), Batley,R.(2006)Oodalutlty,cadalutlty,adadomutlty. Wokgpape,IsttutefoTaspotStudes,UvestyofLeeds. Baumol,W.(1958)Thecadalutltywhchsodal.TheEcoomc Joual,68(272), Becke,G.S.(1965)Atheoyoftheallocatooftme.TheEcoomcJoual, 75(299), DeJog,G.,Koes,E.,Plasmee,R.,Sades,P.adWaffemus,P.(2004) Thevalueofelablty.PapepesetedattheEuopeaTaspot Cofeece,Stasboug,46Octobe
58 DeSepa,A.C.(1971)Atheoyoftheecoomcsoftme.TheEcoomc Joual,81(324), Edwads,W.(1955)Thepedctoofdecsosamogbets.Joualof ExpemetalPsychology,50(3), Fshbu,P.C.(1970)UtltyTheoyfoDecsoMakg.JohWley&Sos, NewYok. Gave,D.P.J.(1968)Headstatstategesfocombatgcogesto. TaspotatoScece,2(2), Heste,I.N.adMlo,J.(1953)Aaxomatcappoachtomeasuable utlty.ecoometca,21(2), Johasso,P.O.(1991)AItoductotoModeWelfaeEcoomcs. CambdgeUvestyPess,Cambdge. Jotsakasa,A.,Hess,S.adPolak,J.W.(2004)Otheeffectsofalteatve dscetsatostategesdepatuetmechocemodellg.papepeseted atthe36 th AualCofeeceoftheUvestes TaspotStudyGoup, UvestyofNewcastleupoTye,57Jauay
59 Kahema,D.adTvesky,A.(1979)Pospecttheoy:aaalyssofdecso udesk.ecoometca,47(2), Kahema,D.adTvesky,A.(2000)Choces,ValuesadFames. CambdgeUvestyPess,Cambdge. Keyes,J.M.(1921)ATeatseoPobablty.Macmlla,Lodo. Keyes,J.M.(1936)TheGeealTheoyofEmploymet,IteestadMoey. Macmlla,Lodo. Kght,F.H.(1921)Rsk,UcetatyadPoft.HoughtoMffl,Bosto. Kght,T.E.(1974)Aappoachtotheevaluatoofchagestavel uelablty:a safetymag hypothess.taspotato,3(4), Maschak,J.(1950)Ratoalbehavou,ucetapospectsadmeasuable utlty.ecoometca,18(2),pp
60 Maschak,J.,Becke,G.M.adDeGoot,M.H.(1963)Stochastcmodelsof chocebehavo.imaschak,j.(1974)ecoomcifomato,decsoad Pedcto:SelectedEssays(Volume1).D.Redel,Dodecht. Nolad,R.B.adPolak,J.W.(2002)Taveltmevaablty:aevewof theoetcaladempcalssues.taspotrevews,22(1),3954. Nolad,R.adSmall,K.(1995)Taveltmeucetaty,depatuetme choceadthecostofthemogcommute.wokgpapeuciitswp95 1,IsttuteofTaspotatoStudes,UvestyofCalfoa,Ive. Peace,D.W.adNash,C.A.(1981)TheSocalAppasalofPoects:AText CostBeeftAalyss.Macmlla,Lodo. Polak,J.(1987)Taveltmevaabltyaddepatuetmechoce.Taspot StudesGoupDscussoPapeNo.15,PolytechcofCetalLodo. Patt,J.W.(1964)Rskavesothesmalladthelage.Ecoometca,32 (12), Small,K.(1982)Theschedulgofcosumeactvtes:woktps.Ameca EcoomcRevew,72(3),
61 Vckey,W.S.(1969)Cogestotheoyadtaspotvestmet.Ameca EcoomcRevew,59(2), voneuma,j.admogeste,o.(1947)theoyofgamesadecoomc Behavo(SecodEdto).PcetoUvestyPess,Pceto. 59
62 Fgue1:Small sutltyfucto,fogvedepatuetme,wthα < β aval tme a m a PAT a Slope = α β utlty Slope = α + γ U 60
63 Fgue2:Small sutltyfucto,fogvedepatuetme,wth β < α aval tme a m a PAT a utlty Slope = α β Slope = α + γ U 61
64 Fgue3:Utltyadexpectedutltyfuctos,fogvedepatuetme,wthα < β aval tme Case 3 a PAT Case 3 a utlty Case 3 Y U, Y Cases1& 2 62
65 Fgue4:Chocebetweedepatuetmes,wthα < β aval tme ( ) d a m d a m ( ) E ( ) ( ) a a PAT E a a α ( d ) d utlty ( Y Y ) Y Y U U 63
66 Fgue5:Utltyadexpectedutltyfuctos,fogvedepatuetme,wthα < β aval tme PAT Case 3 a Case 3 a Case 3 Y utlty U 64
67 Fgue6:Theelabltypemumofaexpectedlateaval,fogvedepatuetme, wthα < β aval tme E a a a PAT ( ) a ~ K U utlty Y Y U U 65
68 Fgue7:Theelabltypemumofaexpectedealyaval,fogvedepatue tme,wthα < β aval tme ( ) E a a a a ~ PAT K U Y utlty Y U U 66
69 Fgue8:Theelabltypemumofaexpectedealyaval,fogvedepatue tme,wth β < α aval tme a ~ E( a ) a ~ K K utlty Y Y U 67
70 Fgue9:Expectedtaveltme,SDE,SDLadlatepealtyvs.expectedavaltme 80 E(T), E(SDE), E(SDL), E(L) E(a) E(T) E(SDE) E(SDL) E(L) 68
71 Fgue10:Expectedutltyadutltyofexpectedavaltme,bydepatuetme utlty U(E(a)) Y depatue tme 69
72 Fgue11:Utltyadexpectedutltyfuctosfo d = utlty U U Y aval tm e 70
73 TableI:Magalvaluatosoftaveltmeadschedulgudeucetatyadatthecetatyeuvalet CERTAINTYEQUIVALENT UNCERTAINTY Case3.5: Case3.6: Case3.7: Case3: a~, a~ PAT < PAT < a~, a~ a ~ < PAT < ~ a a < PAT < a α ( c c ) φ ( K K ) + [ E( a ) E( a )] + ( d d ) β ( c c ) φ ( K K ) + [ E( a ) E( a )] γ φ δ φ 0 0 PAT ( c c ) K E ( a ) ( c c ) ( c c ) ( K K ) + [ E( a ) E( a )] K + E a ( ) PAT 0 0 ( c c ) ( c c ) [ E( a ) E( a )] + ( d d ) ( c c ) [( p p )( PAT a )] ( c c ) [( p p )( a PAT )] ( c c ) ( p p ) α φ β φ γ φ δ φ 71
74 TableII:Payoffmatxfowokedexample a a a a a a a a a a a a a a a a a a a a a a d d d d d d d d d d d d d d d d
such that for 1 From the definition of the k-fibonacci numbers, the firsts of them are presented in Table 1. Table 1: First k-fibonacci numbers F 1
Scholas Joual of Egeeg ad Techology (SJET) Sch. J. Eg. Tech. 0; (C):669-67 Scholas Academc ad Scetfc Publshe (A Iteatoal Publshe fo Academc ad Scetfc Resouces) www.saspublshe.com ISSN -X (Ole) ISSN 7-9
More informationOn EPr Bimatrices II. ON EP BIMATRICES A1 A Hence x. is said to be EP if it satisfies the condition ABx
Iteatoal Joual of Mathematcs ad Statstcs Iveto (IJMSI) E-ISSN: 3 4767 P-ISSN: 3-4759 www.jms.og Volume Issue 5 May. 4 PP-44-5 O EP matces.ramesh, N.baas ssocate Pofesso of Mathematcs, ovt. ts College(utoomous),Kumbakoam.
More informationThe Linear Probability Density Function of Continuous Random Variables in the Real Number Field and Its Existence Proof
MATEC Web of Cofeeces ICIEA 06 600 (06) DOI: 0.05/mateccof/0668600 The ea Pobablty Desty Fucto of Cotuous Radom Vaables the Real Numbe Feld ad Its Estece Poof Yya Che ad Ye Collee of Softwae, Taj Uvesty,
More informationFIBONACCI-LIKE SEQUENCE ASSOCIATED WITH K-PELL, K-PELL-LUCAS AND MODIFIED K-PELL SEQUENCES
Joual of Appled Matheatcs ad Coputatoal Mechacs 7, 6(), 59-7 www.ac.pcz.pl p-issn 99-9965 DOI:.75/jac.7..3 e-issn 353-588 FIBONACCI-LIKE SEQUENCE ASSOCIATED WITH K-PELL, K-PELL-LUCAS AND MODIFIED K-PELL
More informationThe Exponentiated Lomax Distribution: Different Estimation Methods
Ameca Joual of Appled Mathematcs ad Statstcs 4 Vol. No. 6 364-368 Avalable ole at http://pubs.scepub.com/ajams//6/ Scece ad Educato Publshg DOI:.69/ajams--6- The Expoetated Lomax Dstbuto: Dffeet Estmato
More informationAn Unconstrained Q - G Programming Problem and its Application
Joual of Ifomato Egeeg ad Applcatos ISS 4-578 (pt) ISS 5-0506 (ole) Vol.5, o., 05 www.ste.og A Ucostaed Q - G Pogammg Poblem ad ts Applcato M. He Dosh D. Chag Tved.Assocate Pofesso, H L College of Commece,
More informationA Method of Reliability Target Setting for Electric Power Distribution Systems Using Data Envelopment Analysis
27 กก ก 9 2-3 2554 ก ก ก A Method of Relablty aget Settng fo Electc Powe Dstbuton Systems Usng Data Envelopment Analyss ก 2 ก ก ก ก ก 0900 2 ก ก ก ก ก 0900 E-mal: penjan262@hotmal.com Penjan Sng-o Psut
More informationFairing of Parametric Quintic Splines
ISSN 46-69 Eglad UK Joual of Ifomato ad omputg Scece Vol No 6 pp -8 Fag of Paametc Qutc Sples Yuau Wag Shagha Isttute of Spots Shagha 48 ha School of Mathematcal Scece Fuda Uvesty Shagha 4 ha { P t )}
More informationMinimum Hyper-Wiener Index of Molecular Graph and Some Results on Szeged Related Index
Joual of Multdscplay Egeeg Scece ad Techology (JMEST) ISSN: 359-0040 Vol Issue, Febuay - 05 Mmum Hype-Wee Idex of Molecula Gaph ad Some Results o eged Related Idex We Gao School of Ifomato Scece ad Techology,
More informationInequalities for Dual Orlicz Mixed Quermassintegrals.
Advaces Pue Mathematcs 206 6 894-902 http://wwwscpog/joual/apm IN Ole: 260-0384 IN Pt: 260-0368 Iequaltes fo Dual Olcz Mxed Quemasstegals jua u chool of Mathematcs ad Computatoal cece Hua Uvesty of cece
More informationHyper-wiener index of gear fan and gear wheel related graph
Iteatoal Joual of Chemcal Studes 015; (5): 5-58 P-ISSN 49 858 E-ISSN 1 490 IJCS 015; (5): 5-58 014 JEZS Receed: 1-0-015 Accepted: 15-0-015 We Gao School of Ifomato Scece ad Techology, Yua Nomal Uesty,
More informationA New Approach to Moments Inequalities for NRBU and RNBU Classes With Hypothesis Testing Applications
Iteatoal Joual of Basc & Appled Sceces IJBAS-IJENS Vol: No:6 7 A New Appoach to Momets Iequaltes fo NRBU ad RNBU Classes Wth Hypothess Testg Applcatos L S Dab Depatmet of Mathematcs aculty of Scece Al-Azha
More informationUniversity of Pavia, Pavia, Italy. North Andover MA 01845, USA
Iteatoal Joual of Optmzato: heoy, Method ad Applcato 27-5565(Pt) 27-6839(Ole) wwwgph/otma 29 Global Ifomato Publhe (HK) Co, Ltd 29, Vol, No 2, 55-59 η -Peudoleaty ad Effcecy Gogo Gog, Noma G Rueda 2 *
More informationRECAPITULATION & CONDITIONAL PROBABILITY. Number of favourable events n E Total number of elementary events n S
Fomulae Fo u Pobablty By OP Gupta [Ida Awad We, +91-9650 350 480] Impotat Tems, Deftos & Fomulae 01 Bascs Of Pobablty: Let S ad E be the sample space ad a evet a expemet espectvely Numbe of favouable evets
More informationGREEN S FUNCTION FOR HEAT CONDUCTION PROBLEMS IN A MULTI-LAYERED HOLLOW CYLINDER
Joual of ppled Mathematcs ad Computatoal Mechacs 4, 3(3), 5- GREE S FUCTIO FOR HET CODUCTIO PROBLEMS I MULTI-LYERED HOLLOW CYLIDER Stasław Kukla, Uszula Sedlecka Isttute of Mathematcs, Czestochowa Uvesty
More informationRecord Values from Size-Biased Pareto Distribution and a Characterization
Iteatoal Joual o Egeeg Reseach ad Geeal Scece Volume, Issue 4, Jue-July, 4 ISSN 9-73 Recod Values om Sze-Based Paeto Dtbuto ad a Chaactezato Shakla Bash, Mu Ahmad Asstat Poesso, Kad College o Wome, Lahoe
More informationSUBSEQUENCE CHARACTERIZAT ION OF UNIFORM STATISTICAL CONVERGENCE OF DOUBLE SEQUENCE
Reseach ad Coucatos atheatcs ad atheatcal ceces Vol 9 Issue 7 Pages 37-5 IN 39-6939 Publshed Ole o Novebe 9 7 7 Jyot cadec Pess htt//yotacadecessog UBEQUENCE CHRCTERIZT ION OF UNIFOR TTITIC CONVERGENCE
More informationIterative Algorithm for a Split Equilibrium Problem and Fixed Problem for Finite Asymptotically Nonexpansive Mappings in Hilbert Space
Flomat 31:5 (017), 143 1434 DOI 10.98/FIL170543W Publshed by Faculty of Sceces ad Mathematcs, Uvesty of Nš, Seba Avalable at: http://www.pmf..ac.s/flomat Iteatve Algothm fo a Splt Equlbum Poblem ad Fxed
More informationFIXED POINT AND HYERS-ULAM-RASSIAS STABILITY OF A QUADRATIC FUNCTIONAL EQUATION IN BANACH SPACES
IJRRAS 6 () July 0 www.apapess.com/volumes/vol6issue/ijrras_6.pdf FIXED POINT AND HYERS-UAM-RASSIAS STABIITY OF A QUADRATIC FUNCTIONA EQUATION IN BANACH SPACES E. Movahedia Behbaha Khatam Al-Abia Uivesity
More informationSOME ARITHMETIC PROPERTIES OF OVERPARTITION K -TUPLES
#A17 INTEGERS 9 2009), 181-190 SOME ARITHMETIC PROPERTIES OF OVERPARTITION K -TUPLES Deick M. Keiste Depatmet of Mathematics, Pe State Uivesity, Uivesity Pak, PA 16802 dmk5075@psu.edu James A. Selles Depatmet
More informationStrong Result for Level Crossings of Random Polynomials. Dipty Rani Dhal, Dr. P. K. Mishra. Department of Mathematics, CET, BPUT, BBSR, ODISHA, INDIA
Iteatioal Joual of Reseach i Egieeig ad aageet Techology (IJRET) olue Issue July 5 Available at http://wwwijetco/ Stog Result fo Level Cossigs of Rado olyoials Dipty Rai Dhal D K isha Depatet of atheatics
More informationON THE CONVERGENCE THEOREMS OF THE McSHANE INTEGRAL FOR RIESZ-SPACES-VALUED FUNCTIONS DEFINED ON REAL LINE
O The Covegece Theoems... (Muslm Aso) ON THE CONVERGENCE THEOREMS OF THE McSHANE INTEGRAL FOR RIESZ-SPACES-VALUED FUNCTIONS DEFINED ON REAL LINE Muslm Aso, Yosephus D. Sumato, Nov Rustaa Dew 3 ) Mathematcs
More informationA. Thicknesses and Densities
10 Lab0 The Eath s Shells A. Thcknesses and Denstes Any theoy of the nteo of the Eath must be consstent wth the fact that ts aggegate densty s 5.5 g/cm (ecall we calculated ths densty last tme). In othe
More informationNon-axial symmetric loading on axial symmetric. Final Report of AFEM
No-axal symmetc loadg o axal symmetc body Fal Repot of AFEM Ths poject does hamoc aalyss of o-axal symmetc loadg o axal symmetc body. Shuagxg Da, Musket Kamtokat 5//009 No-axal symmetc loadg o axal symmetc
More informationCouncil for Innovative Research
Geometc-athmetc Idex ad Zageb Idces of Ceta Specal Molecula Gaphs efe X, e Gao School of Tousm ad Geogaphc Sceces, Yua Nomal Uesty Kumg 650500, Cha School of Ifomato Scece ad Techology, Yua Nomal Uesty
More informationVECTOR MECHANICS FOR ENGINEERS: Vector Mechanics for Engineers: Dynamics. In the current chapter, you will study the motion of systems of particles.
Seeth Edto CHPTER 4 VECTOR MECHNICS FOR ENINEERS: DYNMICS Fedad P. ee E. Russell Johsto, J. Systems of Patcles Lectue Notes: J. Walt Ole Texas Tech Uesty 003 The Mcaw-Hll Compaes, Ic. ll ghts eseed. Seeth
More informationA Production Model for Time Dependent Decaying Rate with Probabilistic Demand
www.jem.et ISSN (ONLINE: 5-758, ISSN (PRIN: 394-696 Volume-7, Issue-3, May-Jue 7 Iteatoal Joual of Egeeg ad Maagemet Reseach Page Numbe: 4-47 A Poducto Model fo me Depedet Decayg Rate wth Pobablstc Demad
More informationFULLY RIGHT PURE GROUP RINGS (Gelanggang Kumpulan Tulen Kanan Penuh)
Joual of Qualty Measuemet ad Aalyss JQMA 3(), 07, 5-34 Jual Pegukua Kualt da Aalss FULLY IGHT PUE GOUP INGS (Gelaggag Kumpula Tule Kaa Peuh) MIKHLED ALSAAHEAD & MOHAMED KHEI AHMAD ABSTACT I ths pape, we
More informationSums of Involving the Harmonic Numbers and the Binomial Coefficients
Ameica Joual of Computatioal Mathematics 5 5 96-5 Published Olie Jue 5 i SciRes. http://www.scip.og/oual/acm http://dx.doi.og/.46/acm.5.58 Sums of Ivolvig the amoic Numbes ad the Biomial Coefficiets Wuyugaowa
More informationTrace of Positive Integer Power of Adjacency Matrix
Global Joual of Pue ad Appled Mathematcs. IN 097-78 Volume, Numbe 07), pp. 079-087 Reseach Ida Publcatos http://www.publcato.com Tace of Postve Itege Powe of Adacecy Matx Jagdsh Kuma Pahade * ad Mao Jha
More informationStrong Result for Level Crossings of Random Polynomials
IOSR Joual of haacy ad Biological Scieces (IOSR-JBS) e-issn:78-8, p-issn:19-7676 Volue 11, Issue Ve III (ay - Ju16), 1-18 wwwiosjoualsog Stog Result fo Level Cossigs of Rado olyoials 1 DKisha, AK asigh
More informationAvailable from Deakin Research Online:
This is the published vesion: Moghadam, Ami Ali Amii, Kouzani, Abbas Z., Zamani, Reza, Magniez, Kevin and Kaynak, Akif 2015, Nonlinea lage defomation dynamic analysis of electoactive polyme actuatos, Smat
More informationGRAVITATIONAL FORCE IN HYDROGEN ATOM
Fudametal Joual of Mode Physics Vol. 8, Issue, 015, Pages 141-145 Published olie at http://www.fdit.com/ GRAVITATIONAL FORCE IN HYDROGEN ATOM Uiesitas Pedidika Idoesia Jl DR Setyabudhi No. 9 Badug Idoesia
More informationApplication Of Alternating Group Explicit Method For Parabolic Equations
WSEAS RANSACIONS o INFORMAION SCIENCE ad APPLICAIONS Qghua Feg Applcato Of Alteatg oup Explct Method Fo Paabolc Equatos Qghua Feg School of Scece Shadog uvesty of techology Zhagzhou Road # Zbo Shadog 09
More informationAllocations for Heterogenous Distributed Storage
Allocatos fo Heteogeous Dstbuted Stoage Vasleos Ntaos taos@uscedu Guseppe Cae cae@uscedu Alexados G Dmaks dmaks@uscedu axv:0596v [csi] 8 Feb 0 Abstact We study the poblem of stog a data object a set of
More informationPermutations that Decompose in Cycles of Length 2 and are Given by Monomials
Poceedgs of The Natoa Cofeece O Udegaduate Reseach (NCUR) 00 The Uvesty of Noth Caoa at Asheve Asheve, Noth Caoa Ap -, 00 Pemutatos that Decompose Cyces of Legth ad ae Gve y Moomas Lous J Cuz Depatmet
More informationAvailable online through ISSN
Intenational eseach Jounal of Pue Algeba -() 01 98-0 Available online though wwwjpainfo ISSN 8 907 SOE ESULTS ON THE GOUP INVESE OF BLOCK ATIX OVE IGHT OE DOAINS Hanyu Zhang* Goup of athematical Jidong
More informationDistribution of Geometrically Weighted Sum of Bernoulli Random Variables
Appled Mathematc, 0,, 8-86 do:046/am095 Publhed Ole Novembe 0 (http://wwwscrpog/oual/am) Dtbuto of Geometcally Weghted Sum of Beoull Radom Vaable Abtact Deepeh Bhat, Phazamle Kgo, Ragaath Naayaachaya Ratthall
More informationAn Expanded Method to Robustly Practically. Output Tracking Control. for Uncertain Nonlinear Systems
It Joual of Math Aalyss, Vol 8, 04, o 8, 865-879 HIKARI Ltd, wwwm-hacom http://ddoog/0988/jma044368 A Epaded Method to Robustly Pactcally Output Tacg Cotol fo Uceta Nolea Systems Keyla Almha, Naohsa Otsua,
More informationLecture 10: Condensed matter systems
Lectue 0: Codesed matte systems Itoducg matte ts codesed state.! Ams: " Idstgushable patcles ad the quatum atue of matte: # Cosequeces # Revew of deal gas etopy # Femos ad Bosos " Quatum statstcs. # Occupato
More informationA GENERAL CLASS OF ESTIMATORS UNDER MULTI PHASE SAMPLING
TATITIC IN TRANITION-ew sees Octobe 9 83 TATITIC IN TRANITION-ew sees Octobe 9 Vol. No. pp. 83 9 A GENERAL CLA OF ETIMATOR UNDER MULTI PHAE AMPLING M.. Ahed & Atsu.. Dovlo ABTRACT Ths pape deves the geeal
More informationStratification Analysis of Certain Nakayama Algebras
Advaces ue athematcs, 5, 5, 85-855 ublshed Ole Decembe 5 ScRes http://wwwscpog/joual/apm http://dxdoog/46/apm55479 Statfcato Aalyss of Ceta Nakayama Algebas José Fdel Heádez Advícula, Rafael Facsco Ochoa
More informationχ be any function of X and Y then
We have show that whe we ae gve Y g(), the [ ] [ g() ] g() f () Y o all g ()() f d fo dscete case Ths ca be eteded to clude fuctos of ay ube of ado vaables. Fo eaple, suppose ad Y ae.v. wth jot desty fucto,
More informationSuppose we have observed values t 1, t 2, t n of a random variable T.
Sppose we have obseved vales, 2, of a adom vaable T. The dsbo of T s ow o belog o a cea ype (e.g., expoeal, omal, ec.) b he veco θ ( θ, θ2, θp ) of ow paamees assocaed wh s ow (whee p s he mbe of ow paamees).
More informationThis is a repository copy of Modelling Outliers and Missing Values in traffic Count Data Using the ARIMA Model..
This is a repository copy of Modelling Outliers and Missing Values in traffic Count Data Using the ARIMA Model.. White Rose Research Online URL for this paper: http://eprints.whiterose.ac.uk/2180/ Monograph:
More informationSecond Geometric-Arithmetic Index and General Sum Connectivity Index of Molecule Graphs with Special Structure
Iteatoal Joual of Cotempoay Mathematcal Sceces Vol 0 05 o 9-00 HIKARI Ltd wwwm-hacom http://dxdoog/0988/cms0556 Secod Geometc-Athmetc Idex ad Geeal Sum Coectty Idex of Molecule Gaphs wth Specal Stuctue
More informationRecurrence Relations for the Product, Ratio and Single Moments of Order Statistics from Truncated Inverse Weibull (IW) Distribution
Recuece Relatios fo the Poduct, Ratio ad Sigle Moets of Ode Statistics fo Tucated Ivese Weiull (IW) Distiutio ISSN 684 8403 Joual of Statistics Vol: 3, No. (2006) Recuece Relatios fo the Poduct, Ratio
More informationAPPLICATIONS OF SEMIGENERALIZED -CLOSED SETS
Intenatonal Jounal of Mathematcal Engneeng Scence ISSN : 22776982 Volume Issue 4 (Apl 202) http://www.mes.com/ https://stes.google.com/ste/mesounal/ APPLICATIONS OF SEMIGENERALIZED CLOSED SETS G.SHANMUGAM,
More informationSome Integrals Pertaining Biorthogonal Polynomials and Certain Product of Special Functions
Global Joual o Scece Fote Reeach atheatc ad Deco Scece Volue Iue Veo Te : Double Bld ee Reewed Iteatoal Reeach Joual ublhe: Global Joual Ic SA Ole ISSN: 49-466 & t ISSN: 975-5896 Soe Itegal etag Bothogoal
More informationMultistage Median Ranked Set Sampling for Estimating the Population Median
Jounal of Mathematcs and Statstcs 3 (: 58-64 007 ISSN 549-3644 007 Scence Publcatons Multstage Medan Ranked Set Samplng fo Estmatng the Populaton Medan Abdul Azz Jeman Ame Al-Oma and Kamaulzaman Ibahm
More informationSolving Some Definite Integrals Using Parseval s Theorem
Ameican Jounal of Numeical Analysis 4 Vol. No. 6-64 Available online at http://pubs.sciepub.com/ajna///5 Science and Education Publishing DOI:.69/ajna---5 Solving Some Definite Integals Using Paseval s
More informationOptimal System for Warm Standby Components in the Presence of Standby Switching Failures, Two Types of Failures and General Repair Time
Intenatonal Jounal of ompute Applcatons (5 ) Volume 44 No, Apl Optmal System fo Wam Standby omponents n the esence of Standby Swtchng Falues, Two Types of Falues and Geneal Repa Tme Mohamed Salah EL-Shebeny
More informationL-MOMENTS EVALUATION FOR IDENTICALLY AND NONIDENTICALLY WEIBULL DISTRIBUTED RANDOM VARIABLES
THE PUBLISHING HOUSE PROCEEDINGS OF THE ROMANIAN ACADEMY, Sees A, OF THE ROMANIAN ACADEMY Volume 8, Numbe 3/27,. - L-MOMENTS EVALUATION FOR IDENTICALLY AND NONIDENTICALLY WEIBULL DISTRIBUTED RANDOM VARIABLES
More informationOn ARMA(1,q) models with bounded and periodically correlated solutions
Reseach Repot HSC/03/3 O ARMA(,q) models with bouded ad peiodically coelated solutios Aleksade Weo,2 ad Agieszka Wy oma ska,2 Hugo Steihaus Cete, Woc aw Uivesity of Techology 2 Istitute of Mathematics,
More informationApplication of Parseval s Theorem on Evaluating Some Definite Integrals
Tukish Jounal of Analysis and Numbe Theoy, 4, Vol., No., -5 Available online at http://pubs.sciepub.com/tjant/// Science and Education Publishing DOI:.69/tjant--- Application of Paseval s Theoem on Evaluating
More informationSingle-layer model of reflective nanostructures for magneto- ellipsometry data analysis
IOP Confeence Seies: Mateials Science and Engineeing PAPER OPEN ACCESS Single-laye model of eflective nanostuctues fo magneto- ellipsomety data analysis To cite this aticle: O A Maximova et al 6 IOP Conf.
More informationHarmonic Curvatures in Lorentzian Space
BULLETIN of the Bull Malaya Math Sc Soc Secod See 7-79 MALAYSIAN MATEMATICAL SCIENCES SOCIETY amoc Cuvatue Loetza Space NEJAT EKMEKÇI ILMI ACISALIOĞLU AND KĀZIM İLARSLAN Aaa Uvety Faculty of Scece Depatmet
More informationA NOTE ON DOMINATION PARAMETERS IN RANDOM GRAPHS
Discussioes Mathematicae Gaph Theoy 28 (2008 335 343 A NOTE ON DOMINATION PARAMETERS IN RANDOM GRAPHS Athoy Boato Depatmet of Mathematics Wilfid Lauie Uivesity Wateloo, ON, Caada, N2L 3C5 e-mail: aboato@oges.com
More informationFunctions Defined on Fuzzy Real Numbers According to Zadeh s Extension
Intenational Mathematical Foum, 3, 2008, no. 16, 763-776 Functions Defined on Fuzzy Real Numbes Accoding to Zadeh s Extension Oma A. AbuAaqob, Nabil T. Shawagfeh and Oma A. AbuGhneim 1 Mathematics Depatment,
More informationAn Algorithm of a Longest of Runs Test for Very Long. Sequences of Bernoulli Trials
A Algothm of a Logest of Rus Test fo Vey Log equeces of Beoull Tals Alexade I. KOZYNCHENKO Faculty of cece, Techology, ad Meda, Md wede Uvesty, E-857, udsvall, wede alexade_kozycheko@yahoo.se Abstact A
More informationDUALITY IN MULTIPLE CRITERIA AND MULTIPLE CONSTRAINT LEVELS LINEAR PROGRAMMING WITH FUZZY PARAMETERS
Ida Joual of Fudameal ad ppled Lfe Sceces ISSN: 223 6345 (Ole) Ope ccess, Ole Ieaoal Joual valable a www.cbech.o/sp.ed/ls/205/0/ls.hm 205 Vol.5 (S), pp. 447-454/Noua e al. Reseach cle DULITY IN MULTIPLE
More informationRecent Advances in Computers, Communications, Applied Social Science and Mathematics
Recet Advaces Computes, Commucatos, Appled ocal cece ad athematcs Coutg Roots of Radom Polyomal Equatos mall Itevals EFRAI HERIG epatmet of Compute cece ad athematcs Ael Uvesty Cete of amaa cece Pa,Ael,4487
More informationDistinct 8-QAM+ Perfect Arrays Fanxin Zeng 1, a, Zhenyu Zhang 2,1, b, Linjie Qian 1, c
nd Intenatonal Confeence on Electcal Compute Engneeng and Electoncs (ICECEE 15) Dstnct 8-QAM+ Pefect Aays Fanxn Zeng 1 a Zhenyu Zhang 1 b Lnje Qan 1 c 1 Chongqng Key Laboatoy of Emegency Communcaton Chongqng
More informationLab #0. Tutorial Exercises on Work and Fields
Lab #0 Tutoial Execises on Wok and Fields This is not a typical lab, and no pe-lab o lab epot is equied. The following execises will emind you about the concept of wok (fom 1130 o anothe intoductoy mechanics
More informationCompactness in Multiset Topology
opatess ultset Topolog Sougata ahata S K Saata Depatet of atheats Vsva-haat Satketa-7335 Ida Abstat The pupose of ths pape s to todue the oept of opatess ultset topologal spae e vestgate soe bas esults
More informationGeneralized Duality for a Nondifferentiable Control Problem
Aeca Joal of Appled Matheatcs ad Statstcs, 4, Vol., No. 4, 93- Avalable ole at http://pbs.scepb.co/aas//4/3 Scece ad Edcato Pblsh DO:.69/aas--4-3 Geealzed Dalty fo a Nodffeetable Cotol Poble. Hsa,*, Vkas
More informationCommunity and Anti-Poverty Targeting
Commuty ad t-povety Tagetg y daeel Dasgupta Uvesty of Nottgham daeel.dasgupta@ottgham.ac.u ad Rav Kabu Coell Uvesty s45@coell.edu Ths veso:.5.03 Cotets. toducto 2. The Stadad Theoy of Tagetg 2. Measug
More informationAn Enhanced Russell Measure of Super-Efficiency for Ranking Efficient Units in Data Envelopment Analysis
Aeca Joual of Appled Sceces 8 (): 92-96, 20 ISSN 546-9239 200 Scece Publcatos A Ehaced Russell Measue of Supe-Effcecy fo Rakg Effcet Uts Data Evelopet Aalyss,2 Al Ashaf,,3 Az B Jaafa,,4 La Soo Lee ad,4
More informationRepulsive Gravitational Force Field
Repulsve Gavtatoal Foce Feld Fa De Aquo To cte ths veso: Fa De Aquo. Repulsve Gavtatoal Foce Feld. 014. HAL Id: hal-01077840 https://hal.achves-ouvetes.f/hal-01077840 Subtted o 7 Oct 014
More informationLegendre-coefficients Comparison Methods for the Numerical Solution of a Class of Ordinary Differential Equations
IOSR Joual of Mathematcs (IOSRJM) ISS: 78-578 Volume, Issue (July-Aug 01), PP 14-19 Legede-coeffcets Compaso Methods fo the umecal Soluto of a Class of Oday Dffeetal Equatos Olaguju, A. S. ad Olaegu, D.G.
More informationHOW TO TEACH THE FUNDAMENTALS OF INFORMATION SCIENCE, CODING, DECODING AND NUMBER SYSTEMS?
6th INTERNATIONAL MULTIDISCIPLINARY CONFERENCE HOW TO TEACH THE FUNDAMENTALS OF INFORMATION SCIENCE, CODING, DECODING AND NUMBER SYSTEMS? Cecília Sitkuné Göömbei College of Nyíegyháza Hungay Abstact: The
More informationThe Geometric Proof of the Hecke Conjecture
The Geometc Poof of the Hecke Cojectue Kada Sh Depatmet of Mathematc Zhejag Ocea Uvety Zhouha Cty 6 Zhejag Povce Cha Atact Begg fom the eoluto of Dchlet fucto ug the e poduct fomula of two fte-dmeoal vecto
More informationA note on random minimum length spanning trees
A ote o adom miimum legth spaig tees Ala Fieze Miklós Ruszikó Lubos Thoma Depatmet of Mathematical Scieces Caegie Mello Uivesity Pittsbugh PA15213, USA ala@adom.math.cmu.edu, usziko@luta.sztaki.hu, thoma@qwes.math.cmu.edu
More informationCalculation of Quark-antiquark Potential Coefficient and Charge Radius of Light Mesons
Applied Physics Reseach ISSN: 96-9639 Vol., No., May E-ISSN: 96-9647 Calculation of Quak-antiquak Potential Coefficient and Chage Radius of Light Mesons M.R. Shojaei (Coesponding autho ) Depatment of Physics
More informationResults on the Commutative Neutrix Convolution Product Involving the Logarithmic Integral li(
Intenational Jounal of Scientific and Innovative Mathematical Reseach (IJSIMR) Volume 2, Issue 8, August 2014, PP 736-741 ISSN 2347-307X (Pint) & ISSN 2347-3142 (Online) www.acjounals.og Results on the
More informationFRACTIONAL CALCULUS OF GENERALIZED K-MITTAG-LEFFLER FUNCTION
Joual of Rajastha Academy of Physical Scieces ISSN : 972-636; URL : htt://aos.og.i Vol.5, No.&2, Mach-Jue, 26, 89-96 FRACTIONAL CALCULUS OF GENERALIZED K-MITTAG-LEFFLER FUNCTION Jiteda Daiya ad Jeta Ram
More informationWhite Rose Research Online URL for this paper: Version: Accepted Version
This is a repository copy of Improving health outcomes for adults with severe mental illness and comorbid diabetes : is supporting diabetes self-management the right approach? White Rose Research Online
More informationMinimizing spherical aberrations Exploiting the existence of conjugate points in spherical lenses
Mmzg sphecal abeatos Explotg the exstece of cojugate pots sphecal leses Let s ecall that whe usg asphecal leses, abeato fee magg occus oly fo a couple of, so called, cojugate pots ( ad the fgue below)
More informationCentral Coverage Bayes Prediction Intervals for the Generalized Pareto Distribution
Statistics Reseach Lettes Vol. Iss., Novembe Cental Coveage Bayes Pediction Intevals fo the Genealized Paeto Distibution Gyan Pakash Depatment of Community Medicine S. N. Medical College, Aga, U. P., India
More informationON CERTAIN CLASS OF ANALYTIC FUNCTIONS
ON CERTAIN CLASS OF ANALYTIC FUNCTIONS Nailah Abdul Rahma Al Diha Mathematics Depatmet Gils College of Educatio PO Box 60 Riyadh 567 Saudi Aabia Received Febuay 005 accepted Septembe 005 Commuicated by
More informationOn composite conformal mapping of an annulus to a plane with two holes
O composite cofomal mappig of a aulus to a plae with two holes Mila Batista (July 07) Abstact I the aticle we coside the composite cofomal map which maps aulus to ifiite egio with symmetic hole ad ealy
More information( ) ( ) Weibull Distribution: k ti. u u. Suppose t 1, t 2, t n are times to failure of a group of n mechanisms. The likelihood function is
Webll Dsbo: Des Bce Dep of Mechacal & Idsal Egeeg The Uvesy of Iowa pdf: f () exp Sppose, 2, ae mes o fale of a gop of mechasms. The lelhood fco s L ( ;, ) exp exp MLE: Webll 3//2002 page MLE: Webll 3//2002
More informationProfessor Chris Murray. Midterm Exam
Econ 7 Econometrcs Sprng 4 Professor Chrs Murray McElhnney D cjmurray@uh.edu Mdterm Exam Wrte your answers on one sde of the blank whte paper that I have gven you.. Do not wrte your answers on ths exam.
More information10/04/18. P [P(x)] 1 negl(n).
Mastemath, Sping 208 Into to Lattice lgs & Cypto Lectue 0 0/04/8 Lectues: D. Dadush, L. Ducas Scibe: K. de Boe Intoduction In this lectue, we will teat two main pats. Duing the fist pat we continue the
More informationSupplementary materials. Suzuki reaction: mechanistic multiplicity versus exclusive homogeneous or exclusive heterogeneous catalysis
Geeal Pape ARKIVOC 009 (xi 85-03 Supplemetay mateials Suzui eactio: mechaistic multiplicity vesus exclusive homogeeous o exclusive heteogeeous catalysis Aa A. Kuohtia, Alexade F. Schmidt* Depatmet of Chemisty
More informationInternational Journal of Mathematical Archive-5(3), 2014, Available online through ISSN
Iteatioal Joual of Mathematical Achive-5(3, 04, 7-75 Available olie though www.ijma.ifo ISSN 9 5046 ON THE OSCILLATOY BEHAVIO FO A CETAIN CLASS OF SECOND ODE DELAY DIFFEENCE EQUATIONS P. Mohakuma ad A.
More informationBest Linear Unbiased Estimators of the Three Parameter Gamma Distribution using doubly Type-II censoring
Best Lea Ubased Estmatos of the hee Paamete Gamma Dstbuto usg doubly ype-ii cesog Amal S. Hassa Salwa Abd El-Aty Abstact Recetly ode statstcs ad the momets have assumed cosdeable teest may applcatos volvg
More informationThis is a repository copy of Myths about HIV and AIDS among serodiscordant couples in Malawi.
This is a repository copy of Myths about HIV and AIDS among serodiscordant couples in Malawi. White Rose Research Online URL for this paper: http://eprints.whiterose.ac.uk// Version: Accepted Version Article:
More informationA Multivariate Normal Law for Turing s Formulae
A Multivaiate Nomal Law fo Tuing s Fomulae Zhiyi Zhang Depatment of Mathematics and Statistics Univesity of Noth Caolina at Chalotte Chalotte, NC 28223 Abstact This pape establishes a sufficient condition
More informationXII. Addition of many identical spins
XII. Addto of may detcal sps XII.. ymmetc goup ymmetc goup s the goup of all possble pemutatos of obects. I total! elemets cludg detty opeato. Each pemutato s a poduct of a ceta fte umbe of pawse taspostos.
More information3. A Review of Some Existing AW (BT, CT) Algorithms
3. A Revew of Some Exstng AW (BT, CT) Algothms In ths secton, some typcal ant-wndp algothms wll be descbed. As the soltons fo bmpless and condtoned tansfe ae smla to those fo ant-wndp, the pesented algothms
More informationFractional Integrals Involving Generalized Polynomials And Multivariable Function
IOSR Joual of ateatcs (IOSRJ) ISSN: 78-578 Volue, Issue 5 (Jul-Aug 0), PP 05- wwwosoualsog Factoal Itegals Ivolvg Geealzed Poloals Ad ultvaable Fucto D Neela Pade ad Resa Ka Deatet of ateatcs APS uvest
More informationGeneralized k-normal Matrices
Iteatioal Joual of Computatioal Sciece ad Mathematics ISSN 0974-389 Volume 3, Numbe 4 (0), pp 4-40 Iteatioal Reseach Publicatio House http://wwwiphousecom Geealized k-omal Matices S Kishamoothy ad R Subash
More informationUNIQUENESS IN SEALED HIGH BID AUCTIONS. Eric Maskin and John Riley. Last Revision. December 14, 1996**
u9d.doc Uqueess u9a/d.doc UNIQUENESS IN SEALED HIGH BID AUCTIONS by Ec Mas ad Joh Rley Last Revso Decembe 4, 996 Depatmet of Ecoomcs, Havad Uvesty ad UCLA A much eale veso of ths pape focussed o the symmetc
More informationEVALUATION OF SUMS INVOLVING GAUSSIAN q-binomial COEFFICIENTS WITH RATIONAL WEIGHT FUNCTIONS
EVALUATION OF SUMS INVOLVING GAUSSIAN -BINOMIAL COEFFICIENTS WITH RATIONAL WEIGHT FUNCTIONS EMRAH KILIÇ AND HELMUT PRODINGER Abstact We coside sums of the Gaussia -biomial coefficiets with a paametic atioal
More informationMiskolc Mathematical Notes HU e-issn Tribonacci numbers with indices in arithmetic progression and their sums. Nurettin Irmak and Murat Alp
Miskolc Mathematical Notes HU e-issn 8- Vol. (0), No, pp. 5- DOI 0.85/MMN.0.5 Tibonacci numbes with indices in aithmetic pogession and thei sums Nuettin Imak and Muat Alp Miskolc Mathematical Notes HU
More informationControl Chart Analysis of E k /M/1 Queueing Model
Intenational OPEN ACCESS Jounal Of Moden Engineeing Reseach (IJMER Contol Chat Analysis of E /M/1 Queueing Model T.Poongodi 1, D. (Ms. S. Muthulashmi 1, (Assistant Pofesso, Faculty of Engineeing, Pofesso,
More informationarxiv: v1 [math.nt] 28 Oct 2017
ON th COEFFICIENT OF DIVISORS OF x n axiv:70049v [mathnt] 28 Oct 207 SAI TEJA SOMU Abstact Let,n be two natual numbes and let H(,n denote the maximal absolute value of th coefficient of divisos of x n
More informationCartesian Coordinate System and Vectors
Catesian Coodinate System and Vectos Coodinate System Coodinate system: used to descibe the position of a point in space and consists of 1. An oigin as the efeence point 2. A set of coodinate axes with
More informationGeneralized Fibonacci-Lucas Sequence
Tuish Joual of Aalysis ad Numbe Theoy, 4, Vol, No 6, -7 Available olie at http://pubssciepubcom/tjat//6/ Sciece ad Educatio Publishig DOI:6/tjat--6- Geealized Fiboacci-Lucas Sequece Bijeda Sigh, Ompaash
More information