Supporting Information
|
|
- Juliana McCoy
- 6 years ago
- Views:
Transcription
1 Supporting Information The Predicted Ensemble of Low-Energy Conformations of Human Somatostatin Receptor Subtype 5 and the Binding of Antagonists Sijia S. Dong, [a] Ravinder Abrol, [a, b] and William A. Goddard, III* [a] cmdc_015000_sm_miscellaneous_information.pdf
2 Figure S1. Hydrophobicity profile of hsstr5 before applying the capping rules. The residues expected to lie in the membrane are indicated by red dashed lines.
3 TM1! TM! SEQ: MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFG NEW_RAW: HHHHHHHHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHHHHHHHH NEW_CAP: HHHHHHHHHHHHHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHHHHHHHHHHHHH PORTER: ccccccccccccccccccccccccccccccccccccchhhhhhhhhhhhhhhhhhhhhhhhhhhhhhcccccchhhhhhhhhhhhhhhhhhchhhhhhhhhhcccccc SSPRO: ccccccccccccccccccccccccccccccccccchhhhhhhhhhhhhhhhhhhchhcheeeeeeeeccccccchhhhhhhhhhhhhhhhhccchhhhhhhhcccccc APSSP: --ccccccccccccccccccccccccccccccccccccccehhhhhhhhhhhhhhhhhhhhhhhhhccccccchhhhhhhhhhhhhhhhhhccchhhhhhhhcccccc APSSP: *999*** ********* ****8886*886 PSIPRED: ccccccccccccccccccccccccccccccccccccccchhhhhhhhhhhhhhhhhhhhhhhhhhhhcccccchhhhhhhhhhhhhhhhhhhhhhhhhhhhccccccc PSIPRED: JPRED: ccccccccccccccccccccccccccceeecccccccchhhhhhhhhhhhhhhhhhhhhhhhhhhhccccccchhhhhhhhhhhhhhhhhhhhhhhhhhhhhcccccc JPRED: OLD_RAW: HHHHHHHHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHHHHHHHH TM! TM! SEQ: NEW_RAW: NEW_CAP: PORTER: SSPRO: APSSP: APSSP: PSIPRED: PSIPRED: JPRED: JPRED: OLD_RAW: ATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV HHHH HHHHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHH----- HHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHHHHHH----- HHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcHHHccccE HHHHHHccccccHHHHHHHHHHHHHHHHHHHHEEHHEEHHHEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEc HHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccc ****8886* ** * ****88*** HHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccccccccHHHHHHHHHHHHHHHHccEEEEEEE HHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEc HHHH HHHHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHH----- TM5! SEQ: QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR NEW_RAW: HHHHHHHHHHHHHHHHHHHHHHHH NEW_CAP: HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH PORTER: ccccccceccccccccchhhhhhhhhhhhchhhhhhhhhhhhhhhhhhhhcccccccccc SSPRO: ccccceeccccccchhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhccccccccc APSSP: ccccceececcccchhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhccccccccccc APSSP: **86779** ***989*99*98999** PSIPRED: cccccccccccccchhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhcccccccccc PSIPRED: JPRED: cccccccccccccccchhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh JPRED: OLD_RAW: HHHHHHHHHHHHHHHHHHHHHHHH TM6! TM7! SEQ: RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDAD NEW_RAW: HHHHHHHHHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHH NEW_CAP: --HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHHHHHHHHH PORTER: HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHcccccccccccc SSPRO: cchhhhhheeeehhhhhhhehchhhhhhhhhhhhccccccchhhhhhhhhhhhhhhhccchhhhhecchhhhhhhhhhhhccccccccccc APSSP: ccchhhhhhhhhehhhhhhhhcchhhhhhhhhhhhcccchhhhhhhhhhhhehhhhhccchhhhhhhchhhhhhhhhhhhccccccccccc APSSP: ** ** ***** PSIPRED: cccchhhhhhhhhhhhhhhccchhhhhhhhhhcccccchhhhhhhhhhhhhhhhhhhhhhhhhhhhcchhhhhhhhhhhcccccccccccc PSIPRED: JPRED: HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccc JPRED: OLD_RAW: HHHHHHHHHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHH Figure S. Secondary structure prediction for hsstr5 from various servers. NEW_RAW is PredicTM prediction; NEW_CAP is from consensus of different secondary structure prediction servers.
4 Table S1. Sequence similarity (in percentage) between hsstr5 and Class A GPCRs with experimentally available structures. The bold underlined cases were used as templates in this study. Protein Identifier Rank All TM Avg TM1 TM TM TM TM5 TM6 TM7 P56 SSR5_HUMAN P116 OPRX_HUMAN P866 OPRM_MOUSE P00 OPRD_MOUSE P115 OPRK_HUMAN P6107 CXCR_HUMAN P0699 OPSD_BOVIN P07700 ADRB1_MELGA P07550 ADRB_HUMAN P156 OPSD_TODPA P0817 ACM_HUMAN P97 AAAR_HUMAN P088 ACM_RAT Table S. Top 10 structures from the BiHelix/CombiHelix predictions for all 15 starting structures. [a] The lowest energy case for each template (shaded) was used for the SuperBiHelix step. [b] The Δη values are the deviations of helix (H) rotation angles from the respective templates. Method Δη [b] [ ] Energy [kcal mol -1 ] H1 H H H H5 H6 H7 CInterH CTotal NInterH NTotal E CNti moprm [a] moprm moprm
5 moprm moprm hoprk moprm hoprx moprm moprm Table S. Sampling space of the coarse SuperBiHelix for each of the three templates. The deviation angles apply to every helix (H) unless otherwise labeled. The angles apply specifically to one helix are from top 0 BiHelix results of the respective template. The starting structure of the sampling is the lowest energy case in BiHelix for each template (the shaded cases in Table S). Template Δθ [ ] Δφ [ ] Δη [ ] moprm 0, ±15 0, ±5, ±90 0, ±0, -60 (H6), -90 (H5, H6), -10 (H5), -150 (H5) hoprk 0, ±15 0, ±5, ±90 0, ±0 hoprx 0, ±15 0, ±5, ±90 0, ±0, ±10 (H5), 60 (H6), 90 (H6), -60 (H7), -90 (H7) Table S. Top 5 structures from fine SuperBiHelix/SuperCombiHelix with moprm as the initial template. Rank Δθ [ ] Δφ [ ] Δη [ ] E CNti [kcal mol -1 ] H1 H H H H5 H6 H7 H1 H H H H5 H6 H7 H1 H H H H5 H6 H
6 Table S5. Antagonists experimental binding constants and their corresponding calculated binding energies relative to M59. The binding energies are calculated according to equation ΔG 1 - ΔG = RTln(K i /K i1 ). Antagonist K i [nm] Relative Binding Energy [kcal mol -1 ] M M M8 11. M M >
7 a).5 RMSD (Å) b).5 RMSD (Å) Figure S. RMSD changes along the MD trajectory. a) The snapshots were aligned against the first frame, and RMSD values were calculated with the first frame as the reference. b) The snapshots were aligned against the last frame, and RMSD values were calculated with the last frame as the reference. Only backbone atoms were considered in calculating RMSD values.
8 1.8 cluster 1 cluster cluster cluster cluster RMSD (Å) Figure S. Results of clustering by RMSD along the MD trajectory. K-means algorithm was used. The K- means clustering radius is Å.
9 7 6 Distance between S97 HG1 and D86 OD1 (Å) 5 1 Figure S5. The fluctuation of interatomic distance between S O-donated H atom and D86.50 O atom on their side chains during the 50 ns MD simulation of M59-bound predicted hsstr5 structure. Distance between N58 HD1 and S97 O (Å) Figure S6. The fluctuation of interatomic distance between N N-donated H atom on its side chain and S O atom on its backbone during the 50 ns MD simulation of M59-bound predicted hsstr5 structure.
10 8 7 Distance between N81 HD and W16 NE1 (Å) Figure S7. The fluctuation of interatomic distance between N81.5 N-donated H atom and W16.50 N atom on their side chains during the 50 ns MD simulation of M59-bound predicted hsstr5 structure. 7 6 Distance between Y78 HH and D16 OD1 (Å) 5 1 Figure S8. The fluctuation of interatomic distance between Y78. O-donated H atom and D16.9 O atom on their side chains during the 50 ns MD simulation of M59-bound predicted hsstr5 structure.
11 .5 Distance between T15 HG1 and S167 OG (Å) Figure S9. The fluctuation of interatomic distance between T15.8 O-donated H atom and S167.5 O atom on their side chains during the 50 ns MD simulation of M59-bound predicted hsstr5 structure. 1 1 Distance between Y86 OH and N71 HD1 (Å) Figure S10. The fluctuation of interatomic distance between N N-donated H atom and Y O atom on their side chains during the 50 ns MD simulation of M59-bound predicted hsstr5 structure.
12 10 9 Distance between R17 NH and T7 O (Å) Figure S11. The fluctuation of interatomic distance between R17.50 N-donated H atom and T7 6. O atom on their side chains during the 50 ns MD simulation of M59-bound predicted hsstr5 structure. Visualization of this interaction is in Figure 7(a) of the main article.
13 9 Distance between M59 piperidine amine N and D119 OD1 (Å) Figure S1. The fluctuation of distance between the M59 piperidine amine N atom and D119. carboxylic acid O atom during the 50 ns MD simulation of M59-bound predicted hsstr5 structure.
14 18 16 Distance between M59 O in COO and R9 NH (Å) Figure S1. The fluctuation of distance between M59 carboxylic acid O atom and R9 1.1 amine N atom during the 50 ns MD simulation of M59-bound predicted hsstr5 structure.
15 18 16 Distance between R17 NH1 and E OE1 (Å) Figure S1. The fluctuation of distance between the R17.50 side chain N atom and E 6.0 side chain O atom during the 50 ns MD simulation of M59-bound predicted hsstr5 structure. After 0 ns, the intracellular end of TM6 including E 6.0 unwinds to accommodate the salt bridge between E 6.0 and R1 on the loop, and E 6.0 can be considered part of the loop. Additional Experimental Details 1. Preparing the initial helix shape 1.1 OptHelix This method treats each of the seven helices separately. It first takes the TM lengths predicted above, and generates seven separate canonical polyalanine helices accordingly. Then, it mutates the Pro and Gly back to their respective positions on the helices using Side Chain Rotamer Energy Analysis Method (SCREAM). A first structural optimization is then done to minimize the energy of each helix. Subsequently, the Ser and Thr adjacent to Pro are mutated back, and a molecular dynamics (MD) simulation on each helix is run for ns. Finally, all remaining residues are mutated back to have their original side chains, and a second energy minimization is performed. For each helix, the structures that go to the final step are selected based on minrmsd, which takes the snapshot that has the average root mean square deviation (RMSD) closest to the average structure from the MD, and based on mineng, which takes the snapshot that has the lowest energy from the latter 75% of the MD. 1. Homology modeling The template structures were taken from the Orientations of Proteins in Membranes (OPM) database. For each template protein, the sequence was aligned with that of the target protein hsstr5, and the corresponding residues in the template structure were mutated to be that of the target protein using SCREAM. Then each helix was truncated or extended to the previously determined start/end residues, which
16 was followed by a geometry optimization of each individual helix for 100 steps using the DREIDING-III force field. [1]. Obtaining ActiveConf Replacing TM6 shape in the starting structure by that from the active hadrb structure: The TMs 1,,,,5,7 of the starting structure and those of the active hβ AR x-ray structure were aligned using VMD. Only the backbone atoms were used in the alignment. Then, the TM6 in the starting structure was replaced by that from the active hβ AR structure. Finally, the residues on the new TM6 were mutated to hsstr5 residues using SCREAM. BiHelix/CombiHelix: After replacing the TM6 shape by that from the active hβ AR structure, another BiHelix/CombiHelix step (Δη from 0 to 60 with a step size of 0 ) was carried out before the fine SuperBiHelix. The rest followed BiHelix/CombiHelix described in the main text. Fine SuperBiHelix sampling: Starting from the best rotation angles from the above BiHelix/CombiHelix, the fine SuperBiHelix/SuperCombiHelix was carried out. The space sampled was: Δθ = 0, ±15 ; Δφ = 0, ±15, ±0 ; Δη =0, ±0. The rest followed SuperBiHelix described in the main text. References [1] S. L. Mayo, B. D. Olafson, W. A. Goddard, J. Phys. Chem. 1990, 9,
β1 Structure Prediction and Validation
13 Chapter 2 β1 Structure Prediction and Validation 2.1 Overview Over several years, GPCR prediction methods in the Goddard lab have evolved to keep pace with the changing field of GPCR structure. Despite
More informationConformational and Thermodynamic Landscape of GPCR Activation
Biophysical Journal, Volume 110 Supplemental Information Conformational and Thermodynamic Landscape of GPCR Activation from Theory and Computation Sijia S. Dong, William A. Goddard, III, and Ravinder Abrol
More informationHomology Models of Human Adrenergic Receptors
58 Chapter 4 Homology Models of Human Adrenergic Receptors The increased availability of high-resolution GPCR crystal structures has enabled deeper investigation into homology modeling as a method for
More informationT H E J O U R N A L O F G E N E R A L P H Y S I O L O G Y. jgp
S u p p l e m e n ta l m at e r i a l jgp Lee et al., http://www.jgp.org/cgi/content/full/jgp.201411219/dc1 T H E J O U R N A L O F G E N E R A L P H Y S I O L O G Y S u p p l e m e n ta l D I S C U S
More informationWhat makes a good graphene-binding peptide? Adsorption of amino acids and peptides at aqueous graphene interfaces: Electronic Supplementary
Electronic Supplementary Material (ESI) for Journal of Materials Chemistry B. This journal is The Royal Society of Chemistry 21 What makes a good graphene-binding peptide? Adsorption of amino acids and
More informationNitrogenase MoFe protein from Clostridium pasteurianum at 1.08 Å resolution: comparison with the Azotobacter vinelandii MoFe protein
Acta Cryst. (2015). D71, 274-282, doi:10.1107/s1399004714025243 Supporting information Volume 71 (2015) Supporting information for article: Nitrogenase MoFe protein from Clostridium pasteurianum at 1.08
More informationAdrenergic Receptors: Model Systems for Investigation of GPCR Structure and Function
Adrenergic Receptors: Model Systems for Investigation of GPCR Structure and Function Thesis by Heather L. Wiencko In Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy California
More informationproteins Predicted structures of agonist and antagonist bound complexes of adenosine A3 receptor
proteins STRUCTURE O FUNCTION O BIOINFORMATICS Predicted structures of agonist and antagonist bound complexes of adenosine A3 receptor Soo-Kyung Kim,1 Lindsay Riley,2 Ravinder Abrol,1 Kenneth A. Jacobson,3
More informationSupporting information to: Time-resolved observation of protein allosteric communication. Sebastian Buchenberg, Florian Sittel and Gerhard Stock 1
Supporting information to: Time-resolved observation of protein allosteric communication Sebastian Buchenberg, Florian Sittel and Gerhard Stock Biomolecular Dynamics, Institute of Physics, Albert Ludwigs
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Crystallization. a, Crystallization constructs of the ET B receptor are shown, with all of the modifications to the human wild-type the ET B receptor indicated. Residues interacting
More informationExamples of Protein Modeling. Protein Modeling. Primary Structure. Protein Structure Description. Protein Sequence Sources. Importing Sequences to MOE
Examples of Protein Modeling Protein Modeling Visualization Examination of an experimental structure to gain insight about a research question Dynamics To examine the dynamics of protein structures To
More informationStructure Investigation of Fam20C, a Golgi Casein Kinase
Structure Investigation of Fam20C, a Golgi Casein Kinase Sharon Grubner National Taiwan University, Dr. Jung-Hsin Lin University of California San Diego, Dr. Rommie Amaro Abstract This research project
More informationGoals. Structural Analysis of the EGR Family of Transcription Factors: Templates for Predicting Protein DNA Interactions
Structural Analysis of the EGR Family of Transcription Factors: Templates for Predicting Protein DNA Interactions Jamie Duke 1,2 and Carlos Camacho 3 1 Bioengineering and Bioinformatics Summer Institute,
More informationProcheck output. Bond angles (Procheck) Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics.
Structure verification and validation Bond lengths (Procheck) Introduction to Bioinformatics Iosif Vaisman Email: ivaisman@gmu.edu ----------------------------------------------------------------- Bond
More informationSupporting Information
Electronic Supplementary Material (ESI) for Physical Chemistry Chemical Physics. This journal is the Owner Societies 2016 Supporting Information Lipid molecules can induce an opening of membrane-facing
More information1-D Predictions. Prediction of local features: Secondary structure & surface exposure
1-D Predictions Prediction of local features: Secondary structure & surface exposure 1 Learning Objectives After today s session you should be able to: Explain the meaning and usage of the following local
More informationPhysiochemical Properties of Residues
Physiochemical Properties of Residues Various Sources C N Cα R Slide 1 Conformational Propensities Conformational Propensity is the frequency in which a residue adopts a given conformation (in a polypeptide)
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature17991 Supplementary Discussion Structural comparison with E. coli EmrE The DMT superfamily includes a wide variety of transporters with 4-10 TM segments 1. Since the subfamilies of the
More informationProtein Structures: Experiments and Modeling. Patrice Koehl
Protein Structures: Experiments and Modeling Patrice Koehl Structural Bioinformatics: Proteins Proteins: Sources of Structure Information Proteins: Homology Modeling Proteins: Ab initio prediction Proteins:
More informationProtein Structure Refinement Using 13 C α Chemical. Shift Tensors. Benjamin J. Wylie, Charles D. Schwieters, Eric Oldfield and Chad M.
Protein Structure Refinement Using 13 C α Chemical Shift Tensors Benjamin J. Wylie, Charles D. Schwieters, Eric Oldfield and Chad M. Rienstra * Department of Chemistry, University of Illinois at Urbana-Champaign,
More informationElectronic Supplementary Information
Electronic Supplementary Material (ESI) for Physical Chemistry Chemical Physics. This journal is the Owner Societies 2018 Electronic Supplementary Information Temperature dependence of dynamic, tunnelling
More informationDocking. GBCB 5874: Problem Solving in GBCB
Docking Benzamidine Docking to Trypsin Relationship to Drug Design Ligand-based design QSAR Pharmacophore modeling Can be done without 3-D structure of protein Receptor/Structure-based design Molecular
More informationSteps in protein modelling. Structure prediction, fold recognition and homology modelling. Basic principles of protein structure
Structure prediction, fold recognition and homology modelling Marjolein Thunnissen Lund September 2012 Steps in protein modelling 3-D structure known Comparative Modelling Sequence of interest Similarity
More informationStructural Insights from Molecular Dynamics. Simulations of Tryptophan 7-Halogenase and
Supporting Information Structural Insights from Molecular Dynamics Simulations of Tryptophan 7-Halogenase and Tryptophan 5-halogenase Jon Ainsley 1, Adrian J. Mulholland 2, Gary W. Black 1, Olivier Sparagano
More informationTable S1. Primers used for the constructions of recombinant GAL1 and λ5 mutants. GAL1-E74A ccgagcagcgggcggctgtctttcc ggaaagacagccgcccgctgctcgg
SUPPLEMENTAL DATA Table S1. Primers used for the constructions of recombinant GAL1 and λ5 mutants Sense primer (5 to 3 ) Anti-sense primer (5 to 3 ) GAL1 mutants GAL1-E74A ccgagcagcgggcggctgtctttcc ggaaagacagccgcccgctgctcgg
More informationSuperBiHelix method for predicting the pleiotropic ensemble of G-protein coupled receptor conformations. Significance
SuperBiHelix method for predicting the pleiotropic ensemble of G-protein coupled receptor conformations Jenelle K. Bray 1,2, Ravinder Abrol 1,3,4, William A. Goddard III 4, Bartosz Trzaskowski 5, and Caitlin
More informationMolecular Modeling Lecture 7. Homology modeling insertions/deletions manual realignment
Molecular Modeling 2018-- Lecture 7 Homology modeling insertions/deletions manual realignment Homology modeling also called comparative modeling Sequences that have similar sequence have similar structure.
More informationSupporting Text 1. Comparison of GRoSS sequence alignment to HMM-HMM and GPCRDB
Structure-Based Sequence Alignment of the Transmembrane Domains of All Human GPCRs: Phylogenetic, Structural and Functional Implications, Cvicek et al. Supporting Text 1 Here we compare the GRoSS alignment
More informationProtein Dynamics. The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron.
Protein Dynamics The space-filling structures of myoglobin and hemoglobin show that there are no pathways for O 2 to reach the heme iron. Below is myoglobin hydrated with 350 water molecules. Only a small
More informationIntroduction to" Protein Structure
Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.
More informationL718Q mutant EGFR escapes covalent inhibition by stabilizing. a non-reactive conformation of the lung cancer drug. osimertinib
Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2018 Electronic Supplementary Information (ESI) for L718Q mutant EGFR escapes covalent inhibition
More informationSupporting Information
Supporting Information Allosteric communication disrupted by small molecule binding to the Imidazole glycerol phosphate synthase protein-protein interface. Ivan Rivalta*,#, George P. Lisi #, Ning-Shiuan
More informationMD Simulation in Pose Refinement and Scoring Using AMBER Workflows
MD Simulation in Pose Refinement and Scoring Using AMBER Workflows Yuan Hu (On behalf of Merck D3R Team) D3R Grand Challenge 2 Webinar Department of Chemistry, Modeling & Informatics Merck Research Laboratories,
More informationSUPPLEMENTARY INFORMATION
Figure S1. Secondary structure of CAP (in the camp 2 -bound state) 10. α-helices are shown as cylinders and β- strands as arrows. Labeling of secondary structure is indicated. CDB, DBD and the hinge are
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11524 Supplementary discussion Functional analysis of the sugar porter family (SP) signature motifs. As seen in Fig. 5c, single point mutation of the conserved
More informationSecondary and sidechain structures
Lecture 2 Secondary and sidechain structures James Chou BCMP201 Spring 2008 Images from Petsko & Ringe, Protein Structure and Function. Branden & Tooze, Introduction to Protein Structure. Richardson, J.
More informationModeling for 3D structure prediction
Modeling for 3D structure prediction What is a predicted structure? A structure that is constructed using as the sole source of information data obtained from computer based data-mining. However, mixing
More informationDesign of a Novel Globular Protein Fold with Atomic-Level Accuracy
Design of a Novel Globular Protein Fold with Atomic-Level Accuracy Brian Kuhlman, Gautam Dantas, Gregory C. Ireton, Gabriele Varani, Barry L. Stoddard, David Baker Presented by Kate Stafford 4 May 05 Protein
More informationSupplementary Figure 3 a. Structural comparison between the two determined structures for the IL 23:MA12 complex. The overall RMSD between the two
Supplementary Figure 1. Biopanningg and clone enrichment of Alphabody binders against human IL 23. Positive clones in i phage ELISA with optical density (OD) 3 times higher than background are shown for
More informationBuilding a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor
Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor Presented by Stephanie Lee Research Mentor: Dr. Rob Coalson Glycine Alpha 1 Receptor (GlyRa1) Member of the superfamily
More informationBIOINF 4120 Bioinformatics 2 - Structures and Systems - Oliver Kohlbacher Summer Protein Structure Prediction I
BIOINF 4120 Bioinformatics 2 - Structures and Systems - Oliver Kohlbacher Summer 2013 9. Protein Structure Prediction I Structure Prediction Overview Overview of problem variants Secondary structure prediction
More informationMolecular dynamics simulations on the Tre1 G protein-coupled receptor: exploring the role of the arginine of the NRY motif in Tre1 structure
Molecular dynamics simulations on the Tre1 G protein-coupled receptor: exploring the role of the arginine of the NRY motif in Tre1 structure Pruitt et al. Pruitt et al. BMC Structural Biology 2013, 13:15
More informationSupplementary Figures:
Supplementary Figures: Supplementary Figure 1: The two strings converge to two qualitatively different pathways. A) Models of active (red) and inactive (blue) states used as end points for the string calculations
More informationSupporting Information How does Darunavir prevent HIV-1 protease dimerization?
Supporting Information How does Darunavir prevent HIV- protease dimerization? Danzhi Huang and Amedeo Caflisch a Department of Biochemistry University of Zürich, Winterthurerstrasse 9 CH-7 Zürich, Switzerland
More informationPrediction and refinement of NMR structures from sparse experimental data
Prediction and refinement of NMR structures from sparse experimental data Jeff Skolnick Director Center for the Study of Systems Biology School of Biology Georgia Institute of Technology Overview of talk
More informationSupplemental Information for: Characterizing the Membrane-Bound State of Cytochrome P450 3A4: Structure, Depth of Insertion and Orientation
Supplemental Information for: Characterizing the Membrane-Bound State of Cytochrome P450 3A4: Structure, Depth of Insertion and Orientation Javier L. Baylon, Ivan L. Lenov, Stephen G. Sligar and Emad Tajkhorshid
More informationStructural and mechanistic insight into the substrate. binding from the conformational dynamics in apo. and substrate-bound DapE enzyme
Electronic Supplementary Material (ESI) for Physical Chemistry Chemical Physics. This journal is the Owner Societies 215 Structural and mechanistic insight into the substrate binding from the conformational
More informationA conserved P-loop anchor limits the structural dynamics that mediate. nucleotide dissociation in EF-Tu.
Supplemental Material for A conserved P-loop anchor limits the structural dynamics that mediate nucleotide dissociation in EF-Tu. Evan Mercier 1,2, Dylan Girodat 1, and Hans-Joachim Wieden 1 * 1 Alberta
More informationJournal of Pharmacology and Experimental Therapy-JPET#172536
A NEW NON-PEPTIDIC INHIBITOR OF THE 14-3-3 DOCKING SITE INDUCES APOPTOTIC CELL DEATH IN CHRONIC MYELOID LEUKEMIA SENSITIVE OR RESISTANT TO IMATINIB Manuela Mancini, Valentina Corradi, Sara Petta, Enza
More informationEquilibrated atomic models of outward-facing P-glycoprotein and effect of ATP binding on structural dynamics (Supplementary Information)
Equilibrated atomic models of outward-facing P-glycoprotein and effect of ATP binding on structural dynamics (Supplementary Information) Lurong Pan 1 and Stephen G. Aller 2 * 1,2 Department of Pharmacology
More informationFigure 1. Molecules geometries of 5021 and Each neutral group in CHARMM topology was grouped in dash circle.
Project I Chemistry 8021, Spring 2005/2/23 This document was turned in by a student as a homework paper. 1. Methods First, the cartesian coordinates of 5021 and 8021 molecules (Fig. 1) are generated, in
More informationProtein Modeling Methods. Knowledge. Protein Modeling Methods. Fold Recognition. Knowledge-based methods. Introduction to Bioinformatics
Protein Modeling Methods Introduction to Bioinformatics Iosif Vaisman Ab initio methods Energy-based methods Knowledge-based methods Email: ivaisman@gmu.edu Protein Modeling Methods Ab initio methods:
More informationComputational engineering of cellulase Cel9A-68 functional motions through mutations in its linker region. WT 1TF4 (crystal) -90 ERRAT PROVE VERIFY3D
Electronic Supplementary Material (ESI) for Physical Chemistry Chemical Physics. This journal is the Owner Societies 218 Supplementary Material: Computational engineering of cellulase Cel9-68 functional
More informationProgramme Last week s quiz results + Summary Fold recognition Break Exercise: Modelling remote homologues
Programme 8.00-8.20 Last week s quiz results + Summary 8.20-9.00 Fold recognition 9.00-9.15 Break 9.15-11.20 Exercise: Modelling remote homologues 11.20-11.40 Summary & discussion 11.40-12.00 Quiz 1 Feedback
More informationDevelopment of a Structure Prediction Method for G-Protein Coupled Receptors
Development of a Structure Prediction Method for G-Protein Coupled Receptors Thesis by Spencer E. Hall In Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy California Institute
More informationComputational modeling of G-Protein Coupled Receptors (GPCRs) has recently become
Homology Modeling and Docking of Melatonin Receptors Andrew Kohlway, UMBC Jeffry D. Madura, Duquesne University 6/18/04 INTRODUCTION Computational modeling of G-Protein Coupled Receptors (GPCRs) has recently
More informationOverview & Applications. T. Lezon Hands-on Workshop in Computational Biophysics Pittsburgh Supercomputing Center 04 June, 2015
Overview & Applications T. Lezon Hands-on Workshop in Computational Biophysics Pittsburgh Supercomputing Center 4 June, 215 Simulations still take time Bakan et al. Bioinformatics 211. Coarse-grained Elastic
More informationSupporting Information
Supporting Information Micelle-Triggered b-hairpin to a-helix Transition in a 14-Residue Peptide from a Choline-Binding Repeat of the Pneumococcal Autolysin LytA HØctor Zamora-Carreras, [a] Beatriz Maestro,
More informationInsights on Antibiotic Translocation : Molecular Dynamics Simulations
I Insights on Antibiotic Translocation : Molecular Dynamics Simulations Amit Kumar, Eric Hajjar,Enrico Spiga, Francesa Collu, Paolo Ruggerone & Matteo Ceccarelli Marseille : 11 04 2008 Outline METHODS
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More informationThe Development and Application of Computational Methods for. the Prediction of G Protein-Coupled Receptor Structures
The Development and Application of Computational Methods for the Prediction of G Protein-Coupled Receptor Structures Thesis by Jenelle K. Bray In Partial Fulfillment of the Requirements for the Degree
More informationProtein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror
Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major
More informationTime-dependence of key H-bond/electrostatic interaction distances in the sirna5-hago2 complexes... Page S14
Supporting Information Probing the Binding Interactions between Chemically Modified sirnas and Human Argonaute 2 Using Microsecond Molecular Dynamics Simulations S. Harikrishna* and P. I. Pradeepkumar*
More information1. What is an ångstrom unit, and why is it used to describe molecular structures?
1. What is an ångstrom unit, and why is it used to describe molecular structures? The ångstrom unit is a unit of distance suitable for measuring atomic scale objects. 1 ångstrom (Å) = 1 10-10 m. The diameter
More informationProblem Set 1
2006 7.012 Problem Set 1 Due before 5 PM on FRIDAY, September 15, 2006. Turn answers in to the box outside of 68-120. PLEASE WRITE YOUR ANSWERS ON THIS PRINTOUT. 1. For each of the following parts, pick
More informationEffect of intracellular loop 3 on intrinsic dynamics of human β 2 -adrenergic receptor. Ozcan et al.
Effect of intracellular loop 3 on intrinsic dynamics of human β 2 -adrenergic receptor Ozcan et al. Ozcan et al. BMC Structural Biology 2013, 13:29 Ozcan et al. BMC Structural Biology 2013, 13:29 RESEARCH
More informationBioinformatics. Macromolecular structure
Bioinformatics Macromolecular structure Contents Determination of protein structure Structure databases Secondary structure elements (SSE) Tertiary structure Structure analysis Structure alignment Domain
More informationEnhancing Specificity in the Janus Kinases: A Study on the Thienopyridine. JAK2 Selective Mechanism Combined Molecular Dynamics Simulation
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2015 Supporting Information Enhancing Specificity in the Janus Kinases: A Study on the Thienopyridine
More informationProtein Structure Prediction
Protein Structure Prediction Michael Feig MMTSB/CTBP 2006 Summer Workshop From Sequence to Structure SEALGDTIVKNA Ab initio Structure Prediction Protocol Amino Acid Sequence Conformational Sampling to
More informationThe Potassium Ion Channel: Rahmat Muhammad
The Potassium Ion Channel: 1952-1998 1998 Rahmat Muhammad Ions: Cell volume regulation Electrical impulse formation (e.g. sodium, potassium) Lipid membrane: the dielectric barrier Pro: compartmentalization
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11054 Supplementary Fig. 1 Sequence alignment of Na v Rh with NaChBac, Na v Ab, and eukaryotic Na v and Ca v homologs. Secondary structural elements of Na v Rh are indicated above the
More informationProtein Structure. W. M. Grogan, Ph.D. OBJECTIVES
Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate
More informationProtein Structure Prediction, Engineering & Design CHEM 430
Protein Structure Prediction, Engineering & Design CHEM 430 Eero Saarinen The free energy surface of a protein Protein Structure Prediction & Design Full Protein Structure from Sequence - High Alignment
More informationThis article appeared in a journal published by Elsevier. The attached copy is furnished to the author for internal non-commercial research and
This article appeared in a journal published by Elsevier. The attached copy is furnished to the author for internal non-commercial research and education use, including for instruction at the authors institution
More informationSupporting Information for. Models for the Metal Transfer Complex of the N-terminal Region of CusB and. CusF
Supporting Information for Models for the Metal Transfer Complex of the N-terminal Region of CusB and CusF Melek N. Ucisik, Dhruva K. Chakravorty, and Kenneth M. Merz Jr. * Department of Chemistry and
More informationElectronic Supplementary Information
Electronic Supplementary Material (ESI) for Physical Chemistry Chemical Physics. This journal is the Owner Societies 28 Electronic Supplementary Information ph-dependent Cooperativity and Existence of
More informationMolecular Modeling. Prediction of Protein 3D Structure from Sequence. Vimalkumar Velayudhan. May 21, 2007
Molecular Modeling Prediction of Protein 3D Structure from Sequence Vimalkumar Velayudhan Jain Institute of Vocational and Advanced Studies May 21, 2007 Vimalkumar Velayudhan Molecular Modeling 1/23 Outline
More informationPeptides And Proteins
Kevin Burgess, May 3, 2017 1 Peptides And Proteins from chapter(s) in the recommended text A. Introduction B. omenclature And Conventions by amide bonds. on the left, right. 2 -terminal C-terminal triglycine
More informationCentral Dogma. modifications genome transcriptome proteome
entral Dogma DA ma protein post-translational modifications genome transcriptome proteome 83 ierarchy of Protein Structure 20 Amino Acids There are 20 n possible sequences for a protein of n residues!
More informationDOCKING TUTORIAL. A. The docking Workflow
2 nd Strasbourg Summer School on Chemoinformatics VVF Obernai, France, 20-24 June 2010 E. Kellenberger DOCKING TUTORIAL A. The docking Workflow 1. Ligand preparation It consists in the standardization
More informationExploring the Changes in the Structure of α-helical Peptides Adsorbed onto Carbon and Boron Nitride based Nanomaterials
Exploring the Changes in the Structure of α-helical Peptides Adsorbed onto Carbon and Boron Nitride based Nanomaterials Dr. V. Subramanian Chemical Laboratory, IPC Division CSIR-Central Leather Research
More informationPatrick: An Introduction to Medicinal Chemistry 5e Chapter 04
01) Which of the following statements is not true about receptors? a. Most receptors are proteins situated inside the cell. b. Receptors contain a hollow or cleft on their surface which is known as a binding
More informationSUPPLEMENTARY MATERIALS
SUPPLEMENTARY MATERIALS Enhanced Recognition of Transmembrane Protein Domains with Prediction-based Structural Profiles Baoqiang Cao, Aleksey Porollo, Rafal Adamczak, Mark Jarrell and Jaroslaw Meller Contact:
More informationSupplementary Figure S1. Urea-mediated buffering mechanism of H. pylori. Gastric urea is funneled to a cytoplasmic urease that is presumably attached
Supplementary Figure S1. Urea-mediated buffering mechanism of H. pylori. Gastric urea is funneled to a cytoplasmic urease that is presumably attached to HpUreI. Urea hydrolysis products 2NH 3 and 1CO 2
More informationSensitive NMR Approach for Determining the Binding Mode of Tightly Binding Ligand Molecules to Protein Targets
Supporting information Sensitive NMR Approach for Determining the Binding Mode of Tightly Binding Ligand Molecules to Protein Targets Wan-Na Chen, Christoph Nitsche, Kala Bharath Pilla, Bim Graham, Thomas
More informationCrystal lattice Real Space. Reflections Reciprocal Space. I. Solving Phases II. Model Building for CHEM 645. Purified Protein. Build model.
I. Solving Phases II. Model Building for CHEM 645 Purified Protein Solve Phase Build model and refine Crystal lattice Real Space Reflections Reciprocal Space ρ (x, y, z) pronounced rho F hkl 2 I F (h,
More informationSUPPLEMENTAL MATERIAL
SUPPLEMENTAL MATERIAL Systematic Coarse-Grained Modeling of Complexation between Small Interfering RNA and Polycations Zonghui Wei 1 and Erik Luijten 1,2,3,4,a) 1 Graduate Program in Applied Physics, Northwestern
More informationPacking of Secondary Structures
7.88 Lecture Notes - 4 7.24/7.88J/5.48J The Protein Folding and Human Disease Professor Gossard Retrieving, Viewing Protein Structures from the Protein Data Base Helix helix packing Packing of Secondary
More informationSupplementary information for cloud computing approaches for prediction of ligand binding poses and pathways
Supplementary information for cloud computing approaches for prediction of ligand binding poses and pathways Morgan Lawrenz 1, Diwakar Shukla 1,2 & Vijay S. Pande 1,2 1 Department of Chemistry, Stanford
More informationMolecular Modeling lecture 2
Molecular Modeling 2018 -- lecture 2 Topics 1. Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction 4. Where do protein structures come from? X-ray crystallography
More informationSupplementary figure 1. Comparison of unbound ogm-csf and ogm-csf as captured in the GIF:GM-CSF complex. Alignment of two copies of unbound ovine
Supplementary figure 1. Comparison of unbound and as captured in the GIF:GM-CSF complex. Alignment of two copies of unbound ovine GM-CSF (slate) with bound GM-CSF in the GIF:GM-CSF complex (GIF: green,
More informationProtein Structure Prediction
Protein Structure Prediction Michael Feig MMTSB/CTBP 2009 Summer Workshop From Sequence to Structure SEALGDTIVKNA Folding with All-Atom Models AAQAAAAQAAAAQAA All-atom MD in general not succesful for real
More informationUser Guide for LeDock
User Guide for LeDock Hongtao Zhao, PhD Email: htzhao@lephar.com Website: www.lephar.com Copyright 2017 Hongtao Zhao. All rights reserved. Introduction LeDock is flexible small-molecule docking software,
More informationLS1a Fall 2014 Problem Set #2 Due Monday 10/6 at 6 pm in the drop boxes on the Science Center 2 nd Floor
LS1a Fall 2014 Problem Set #2 Due Monday 10/6 at 6 pm in the drop boxes on the Science Center 2 nd Floor Note: Adequate space is given for each answer. Questions that require a brief explanation should
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/309/5742/1868/dc1 Supporting Online Material for Toward High-Resolution de Novo Structure Prediction for Small Proteins Philip Bradley, Kira M. S. Misura, David Baker*
More informationAP Biology. Proteins. AP Biology. Proteins. Multipurpose molecules
Proteins Proteins Multipurpose molecules 2008-2009 1 Proteins Most structurally & functionally diverse group Function: involved in almost everything u enzymes (pepsin, DNA polymerase) u structure (keratin,
More informationProtein Structure Analysis with Sequential Monte Carlo Method. Jinfeng Zhang Computational Biology Lab Department of Statistics Harvard University
Protein Structure Analysis with Sequential Monte Carlo Method Jinfeng Zhang Computational Biology Lab Department of Statistics Harvard University Introduction Structure Function & Interaction Protein structure
More informationProtein Structure Prediction and Display
Protein Structure Prediction and Display Goal Take primary structure (sequence) and, using rules derived from known structures, predict the secondary structure that is most likely to be adopted by each
More informationCAP 5510 Lecture 3 Protein Structures
CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity
More informationTu 1,*, , Sweden
Supplementary Material Computational studiess of the binding profile of phosphoinositide PtdIns(,4,5)P with the pleckstrin homology domain d of an oomycetee cellulose synthase Guanglin Kuang 1, Vincent
More information