for Molecular Biology and Neuroscience and Institute of Medical Microbiology, Rikshospitalet-Radiumhospitalet
|
|
- Samuel Marsh
- 5 years ago
- Views:
Transcription
1 SUPPLEMENTARY INFORMATION TO Structural basis for enzymatic excision of N -methyladenine and N 3 -methylcytosine from DNA Ingar Leiros,5, Marivi P. Nabong 2,3,5, Kristin Grøsvik 3, Jeanette Ringvoll 2, Gyri T. Haugland 4, Lene Uldal 2, Karen Reite 2, Inger K. Olsbu 3, Ingeborg Knævelsrud 3,4, Elin Moe, Ole A. Andersen, Nils-Kåre Birkeland 4, Peter Ruoff 3, Arne Klungland 2 and Svein Bjelland 3, * The Norwegian Structural Biology Centre, University of Tromsø, N-937 Tromsø, Norway. 2 Centre for Molecular Biology and Neuroscience and Institute of Medical Microbiology, Rikshospitalet-Radiumhospitalet HF, University of Oslo, N-27 Oslo, Norway. 3 Faculty of Science and Technology, Department of Mathematics and Natural Sciences, University of Stavanger, N-436 Stavanger, Norway. 4 Department of Biology, University of Bergen, PO Box 78, N-52 Bergen, Norway. 5 These authors contributed equally to this work. *Corresponding author. Faculty of Science and Technology, Department of Mathematics and Natural Sciences, University of Stavanger, N-436 Stavanger, Norway. Tel.: ; Fax: ; svein.bjelland@uis.no
2 Derivation of kinetic equations for AfAlkA The reaction catalyzed by AfAlkA (E) can be summarized as DNA P (R) where P represents products (i.e. DNA and free base lesion). Reaction R is a first-order process with reaction rate v=d[p]/dt = k [DNA] () Equation is readily solved and the increase of product concentration [P] as a function of time t is given by the equation [P] = [DNA] ( e k t ) (2) where [DNA] denotes the al (initial) DNA substrate concentration and k is the (first-order) rate constant. The experimental results can be interpreted by considering a non-specific glycosylase binding or adsorption to DNA and looking specifically at the site where catalysis (excision) is taking place, i.e., the specific position where m A, εa or m 3 C are inserted (Figure A). If DNA i is the location i on the DNA where catalysis occurs (when E binds to this site) we can write k k E + DNA E DNA 2 i E + DNA + free base lesion (R2) k i - Considering this process, we can write the following mass balance at DNA i : [DNA] = [DNA i ] + [E DNA i ] (3) where [DNA] is the al DNA concentration, E DNA i denotes any DNA molecule where E occupies the catalytic site i, and DNA i is any DNA molecule where E has not bound to the excision site i. Calculating d[e DNA i ]/dt and assuming that E DNA i is in a steady state (leading to d[e DNA i ]/dt = ), it results in d[e DNA i ]/dt = k [E][DNA i ] (k + k 2 )[E DNA i ] = (4) By inserting [DNA i ] from Equation 3 into Equation 4, the steady state value of [E DNA i ], [E DNA i ] ss, can be expressed as 2
3 with [E][DNA] [E DNA i ] ss = K + [E] k D + K D = k k 2 (5) Because the concentration of E is in excess of the DNA template (single-turnover conditions; [E] >> [DNA] ), [E] in Equation 5 can be replaced by [E] : [E DNA i ] ss [E] = (6) K + [E] D [DNA] Since the reaction rate is expressed by ν = k 2 [E DNA i ] ss, ν can be written as [E] [DNA] ν = k2 (7) K D + [E] showing that the rate constant k of Equation is specified by the following relationship: k E] k = 2[ K + [ E] D (8) An analogous expression to Equation 7 can be derived by assuming a rapid equilibrium between E, DNA i and E DNA i. In this case K D is represented by k /k. In the case reaction R2 is irreversible (k = ), K D = k 2 /k. Due to these situations it is difficult to make a precise interpretation about the physical nature of K D based on k 2 and K D values alone. The observation that for m A, k 2 is decreased while K D is increased for most of the mutant proteins (Table I), may suggest that the binding between the DNA and the enzyme has become less effective with a somewhat slower turnover. For εa, both k 2 and K D are decreased for the mutant compared to the wild-type proteins (Table I). This may indicate the presence of a steady state with still a relatively strong binding between DNA and the enzyme, but with a less effective turnover. 3
4 Supplementary Table I Data collection, structure solution and refinement statistics Dataset Peak Native Data collection statistics Beamline ID4-4 BL4. Wavelength (Å).9.99 Resolution range (Å) 2..8(.9.8) 5.-.9(.95-.9) R sym (%) 8.4(49.9) 6.7(43.4) Multiplicity 8.(7.6) 2.9(2.9) Mean I/σI 8.(3.5).4(2.5) Completeness (%) 98.7(97.9) 99.9(.) Anom. completeness (%) 98.5(97.5) - Space group P2 P2 Unit cell parameters: Phasing statistics a(å) b(å) c(å) β( ) No. Heavy atoms/a.s.u. 2 Hg - R cullis Phasing power FOM SHARP.43 - FOM DM Refinement statistics No. Atoms 5493/49/495/4/4/4/4 5425/4826/57//4/4/ B-factors 2/9/29/33 /27 /8/33 2/9/3//34/2/ R free (%) R work (%) Geometrical deviation Bonds (Å).5.5 Angles ( ) ESU (Å).78. : Two additional Mercury atoms were identified at the refinement stage through phased anomalous fourier maps, but were not used at the preceding phasing stage. : Figure-ofmerit (FOM) from SHARP-phasing for acentric data to 2.5 Å. : FOM from DM after extending phases to.8 Å. : Total/Protein/Water/Mercury/Glycerol molecules/sodium/mes molecules. : Modeled with reduced occupancy. : Estimated overall coordinate error from REFMAC5 based on maximum likelihood. 4
5 Supplementary Table II Structural alignment of domains of AfAlkA and EcAlkA EcAlkA (#aligned/al) rmsd (Å) Domain AfAlkA (84/).55 N-term (33/48).4 Central (4/3).38 C-term (59/289).58 All residues The table illustrates structural conservation between individual domains of AfAlkA and EcAlkA, where the numbers in parenthesis are number of residues aligned out of the al number of residues in that domain and the last number lists the root mean square deviation (rmsd) between the aligned residues in AfAlkA and EcAlkA. 5
6 Supplementary Figure 6
7 Legend to Supplementary Figure Exposure of EcAlkA to m A- and m 3 C- containing DNA. Assay for cleavage of 5 [ 32 P]labeled 49-nt DNA into repair product (23 and 25 nt) is described in FigureA,B. EcAlkA was incubated with DNA ( fmol) in 5 mm Hepes [4-(2-hydroxyethyl)--piperazineethanesulfonic acid]-koh, ph 7.5,.3 mm EDTA,.5 mm 2-mercaptoethanol at 37 C for 3 min (The same result was obtained when incubation was carried out at 37 C under exactly the same conditions as employed for AfAlkA). 7
8 Supplementary Figure 2 8
9 Legend to Supplementary Figure 2 Stereo representation showing the superpositioning of the Cα-traces of AfAlkA (red) and Ec AlkA (black). Af AlkA residue numbers are labeled. 9
10 Supplementary Figure 3
11 Legend to Supplementary Figure 3 Sliced view of the molecular surface of AfAlkA enabling visualization of the water-accessible channel extending from the base of the substrate-binding pocket into the core of the protein. The modeled εa moiety is shown with orange carbon atoms, while protein carbon atoms are shown in dark green. Other atoms are shown in atom colors (oxygen, red; nitrogen blue; sulfur, yellow). The cavity contains a al of one glycerol and 3 water molecules. The electrostatic surface potential is calculated as for Figure 4.
12 Supplementary Figure 4 2
13 Legend to Supplementary Figure 4 SDS PAGE (2 %) of purified AfAlkA mutant and wild type proteins stained with Coomassie Blue. Samples (2 μg; μl) and protein markers ( μl; BenchMark Pre-Stained Protein Ladder, Cat. No. 748-, Invitrogen) were loaded onto the gel (Bio-Rad, Ready Gel Tris HCl Gels, 2 % Resolving Gel, Cat. # 6-56) and run for 2 h at 2 V. 3
14 Supplementary Figure 5.4 m A (Gln28Ala).6 m A (Phe33Ala) [E]= nm [E]=6 nm [E]=25 nm.4 [E]=5 nm.2 [E]= nm m A (Phe282Ala) [E]= nm [E]=6 nm [E]=25 nm [E]= nm [E]= nm [E]=6 nm [E]=25 nm [E]= nm m A (Phe33Ala/Phe282Ala).6.4 [E]= nm m A (Arg286Ala) [E]= nm [E]=6 nm [E]=25 nm [E]=5 nm [E]= nm 4
15 Legend to Supplementary Figure 5 Single-turnover kinetics for excision of m A, where nm of substrate was incubated with different concentrations of AfAlkA at 7 C for increasing time periods. Each value represents the average of three independent measurements. 5
16 Supplementary Figure 6 ε A (Gln28Ala) 8 7 [E]=25 nm [E]=5 nm 3 2 [E]= nm [E]=5 nm ε A (Phe33Ala) 6 [E]=25 nm [E]=5 nm [E]= nm [E]=5 nm 6 ε A (Phe282Ala).2 ε A (Phe33Ala/Phe282Ala) 5 [E]=25 nm 4 [E]=5 nm 3 2 [E]= nm [E]=5 nm [E]=25 nm.8.6 [E]=5 nm.4.2 [E]= nm 5 ε A (Arg286Ala) [E]=25 nm [E]= nm [E]=5 nm [E]=5 nm 6
17 Legend to Supplementary Figure 6 Single-turnover kinetics for excision of εa, where nm of substrate was incubated with different concentrations of AfAlkA at 7 C for increasing time periods. Each value represents the average of 2 3 independent measurements. 7
SUPPLEMENTARY INFORMATION
Fig. 1 Influences of crystal lattice contacts on Pol η structures. a. The dominant lattice contact between two hpol η molecules (silver and gold) in the type 1 crystals. b. A close-up view of the hydrophobic
More informationAccording to the manufacture s direction (Pierce), RNA and DNA
Supplementary method Electrophoretic Mobility-shift assay (EMSA) According to the manufacture s direction (Pierce), RNA and DNA oligonuleotides were firstly labeled by biotin. TAVb (1pM) was incubated
More informationSUPPLEMENTARY INFORMATION
Table of Contents Page Supplementary Table 1. Diffraction data collection statistics 2 Supplementary Table 2. Crystallographic refinement statistics 3 Supplementary Fig. 1. casic1mfc packing in the R3
More informationSUPPLEMENTARY INFORMATION
Supplementary materials Figure S1 Fusion protein of Sulfolobus solfataricus SRP54 and a signal peptide. a, Expression vector for the fusion protein. The signal peptide of yeast dipeptidyl aminopeptidase
More informationSUPPLEMENTARY INFORMATION
Supplementary Table S1 Kinetic Analyses of the AMSH-LP mutants AMSH-LP K M (μm) k cat x 10-3 (s -1 ) WT 71.8 ± 6.3 860 ± 65.4 T353A 76.8 ± 11.7 46.3 ± 3.7 F355A 58.9 ± 10.4 5.33 ± 0.30 proximal S358A 75.1
More informationSupplementary Materials for
www.advances.sciencemag.org/cgi/content/full/1/7/e1500263/dc1 Supplementary Materials for Newton s cradle proton relay with amide imidic acid tautomerization in inverting cellulase visualized by neutron
More informationSI Text S1 Solution Scattering Data Collection and Analysis. SI references
SI Text S1 Solution Scattering Data Collection and Analysis. The X-ray photon energy was set to 8 kev. The PILATUS hybrid pixel array detector (RIGAKU) was positioned at a distance of 606 mm from the sample.
More informationFull-length GlpG sequence was generated by PCR from E. coli genomic DNA. (with two sequence variations, D51E/L52V, from the gene bank entry aac28166),
Supplementary Methods Protein expression and purification Full-length GlpG sequence was generated by PCR from E. coli genomic DNA (with two sequence variations, D51E/L52V, from the gene bank entry aac28166),
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature10458 Active Site Remodeling in the Bifunctional Fructose-1,6- bisphosphate aldolase/phosphatase Juan Du, Rafael F. Say, Wei Lü, Georg Fuchs & Oliver Einsle SUPPLEMENTARY FIGURES Figure
More informationSupplementary materials. Crystal structure of the carboxyltransferase domain. of acetyl coenzyme A carboxylase. Department of Biological Sciences
Supplementary materials Crystal structure of the carboxyltransferase domain of acetyl coenzyme A carboxylase Hailong Zhang, Zhiru Yang, 1 Yang Shen, 1 Liang Tong Department of Biological Sciences Columbia
More informationSupplementary Information
Supplementary Information The direct role of selenocysteine in [NiFeSe] hydrogenase maturation and catalysis Marta C. Marques a, Cristina Tapia b, Oscar Gutiérrez-Sanz b, Ana Raquel Ramos a, Kimberly L.
More informationtype GroEL-GroES complex. Crystals were grown in buffer D (100 mm HEPES, ph 7.5,
Supplementary Material Supplementary Materials and Methods Structure Determination of SR1-GroES-ADP AlF x SR1-GroES-ADP AlF x was purified as described in Materials and Methods for the wild type GroEL-GroES
More informationTable 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2
Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell
More informationSUPPLEMENTARY INFORMATION
doi:1.138/nature1737 Supplementary Table 1 variant Description FSEC - 2B12 a FSEC - 6A1 a K d (leucine) c Leucine uptake e K (wild-type like) K (Y18F) K (TS) K (TSY) K288A mutant, lipid facing side chain
More informationStructure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase Cwc27
Acta Cryst. (2014). D70, doi:10.1107/s1399004714021695 Supporting information Volume 70 (2014) Supporting information for article: Structure and evolution of the spliceosomal peptidyl-prolyl cistrans isomerase
More informationSupporting Information. UV-induced ligand exchange in MHC class I protein crystals
Supporting Information for the article entitled UV-induced ligand exchange in MHC class I protein crystals by Patrick H.N. Celie 1, Mireille Toebes 2, Boris Rodenko 3, Huib Ovaa 3, Anastassis Perrakis
More informationSupplementary Information. The protease GtgE from Salmonella exclusively targets. inactive Rab GTPases
Supplementary Information The protease GtgE from Salmonella exclusively targets inactive Rab GTPases Table of Contents Supplementary Figures... 2 Supplementary Figure 1... 2 Supplementary Figure 2... 3
More informationSupplementary Information
Supplementary Information Structural analysis of leader peptide binding enables leaderfree cyanobactin processing Jesko Koehnke 1,2, Greg Mann 1,2, Andrew F Bent 1,2, Hannes Ludewig 1, Sally Shirran 1,
More informationActa Crystallographica Section D
Supporting information Acta Crystallographica Section D Volume 70 (2014) Supporting information for article: Structural characterization of the virulence factor Nuclease A from Streptococcus agalactiae
More informationSerine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition
Supplementary Information to Serine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition Nadine Czudnochowski 1,2, *, Christian A. Bösken 1, * & Matthias Geyer 1 1 Max-Planck-Institut
More informationSupporting Information for: Kinetic Mechanisms Governing Stable Ribonucleotide Incorporation in Individual DNA Polymerase Complexes
Supporting Information for: Kinetic Mechanisms Governing Stable Ribonucleotide Incorporation in Individual DNA Polymerase Complexes Joseph M. Dahl, Hongyun Wang, José M. Lázaro, Margarita Salas, and Kate
More informationThe Fic protein Doc uses an inverted substrate to phosphorylate and. inactivate EF-Tu
The Fic protein Doc uses an inverted substrate to phosphorylate and inactivate EF-Tu Daniel Castro-Roa 1, Abel Garcia-Pino 2,3 *, Steven De Gieter 2,3, Nico A.J. van Nuland 2,3, Remy Loris 2,3, Nikolay
More informationTable S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1.
Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. PDZK1 constru cts Amino acids MW [kda] KD [μm] PEPT2-CT- FITC KD [μm] NHE3-CT- FITC KD [μm] PDZK1-CT-
More informationE.Z.N.A. MicroElute Clean-up Kits Table of Contents
E.Z.N.A. MicroElute Clean-up Kits Table of Contents Introduction... 2 Kit Contents... 3 Preparing Reagents/Storage and Stability... 4 Guideline for Vacuum Manifold... 5 MicroElute Cycle-Pure - Spin Protocol...
More informationSupplementary figure 1 Application of tmfret in LeuT. (a) To assess the feasibility of using tmfret for distance-dependent measurements in LeuT, a
Supplementary figure 1 Application of tmfret in LeuT. (a) To assess the feasibility of using tmfret for distance-dependent measurements in LeuT, a series of tmfret-pairs comprised of single cysteine mutants
More informationSUPPLEMENTARY INFORMATION. Pistol Ribozyme Adopts a Pseudoknot Fold. Facilitating Site-specific In-line Cleavage
UPPLEMENTAY INFMATIN Pistol ibozyme Adopts a Pseudoknot Fold Facilitating ite-specific In-line Cleavage Aiming en 1,2,4, Nikola Vušurović 3,4, Jennifer Gebetsberger 3, Pu Gao 2, Michael Juen 3, Christoph
More informationEnzyme Reactions. Lecture 13: Kinetics II Michaelis-Menten Kinetics. Margaret A. Daugherty Fall v = k 1 [A] E + S ES ES* EP E + P
Lecture 13: Kinetics II Michaelis-Menten Kinetics Margaret A. Daugherty Fall 2003 Enzyme Reactions E + S ES ES* EP E + P E = enzyme ES = enzyme-substrate complex ES* = enzyme/transition state complex EP
More informationMichaelis-Menten Kinetics. Lecture 13: Kinetics II. Enzyme Reactions. Margaret A. Daugherty. Fall Substrates bind to the enzyme s active site
Lecture 13: Kinetics II Michaelis-Menten Kinetics Margaret A. Daugherty Fall 2003 Enzyme Reactions E + S ES ES* EP E + P E = enzyme ES = enzyme-substrate complex ES* = enzyme/transition state complex EP
More informationSUPPLEMENTARY INFORMATION
Data collection Supplementary Table 1 Statistics of data collection, phasing and refinement Native Se-MAD Space group P2 1 2 1 2 1 P2 1 2 1 2 1 Cell dimensions a, b, c (Å) 50.4, 94.2, 115.4 49.8, 94.2,
More informationPurification, SDS-PAGE and cryo-em characterization of the MCM hexamer and Cdt1 MCM heptamer samples.
Supplementary Figure 1 Purification, SDS-PAGE and cryo-em characterization of the MCM hexamer and Cdt1 MCM heptamer samples. (a-b) SDS-PAGE analysis of the hexamer and heptamer samples. The eluted hexamer
More informationSUPPLEMENTARY INFORMATION
Supplementary Results DNA binding property of the SRA domain was examined by an electrophoresis mobility shift assay (EMSA) using synthesized 12-bp oligonucleotide duplexes containing unmodified, hemi-methylated,
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11539 Supplementary Figure 1 Schematic representation of plant (A) and mammalian (B) P 2B -ATPase domain organization. Actuator (A-), nucleotide binding (N-),
More informationStructure and Function of Neisseria gonorrhoeae MtrF Illuminates a Class of Antimetabolite Efflux Pumps
Cell Reports Supplemental Information Structure and Function of Neisseria gonorrhoeae MtrF Illuminates a Class of Antimetabolite Efflux Pumps Chih-Chia Su, Jani Reddy Bolla, Nitin Kumar, Abhijith Radhakrishnan,
More informationSUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES Supplementary Figure 1 Protein sequence alignment of Vibrionaceae with either a 40-residue insertion or a 44-residue insertion. Identical residues are indicated by red background.
More informationClass Business. I will have Project I graded by the end of the week. The discussion groups for Project 2 are cancelled
Quiz 1 Class Business I will have Project I graded by the end of the week. Project 2 is due on 11/15 The discussion groups for Project 2 are cancelled There is additional reading for classes held on 10/30
More informationPlasmid Relevant features Source. W18N_D20N and TrXE-W18N_D20N-anti
Table S1. E. coli plasmids Plasmid Relevant features Source pdg680 T. reesei XynII AA 2-190 with C-terminal His 6 tag optimized for E. coli expression in pjexpress401 Wan et al. (in press) psbn44d psbn44h
More informationBSc and MSc Degree Examinations
Examination Candidate Number: Desk Number: BSc and MSc Degree Examinations 2018-9 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes Marking
More informationActa Crystallographica Section F
Supporting information Acta Crystallographica Section F Volume 70 (2014) Supporting information for article: Chemical conversion of cisplatin and carboplatin with histidine in a model protein crystallised
More informationSUPPLEMENTARY INFORMATION
www.nature.com/nature 1 Figure S1 Sequence alignment. a Structure based alignment of the plgic of E. chrysanthemi (ELIC), the acetylcholine binding protein from the snail Lymnea stagnalis (AchBP, PDB code
More informationSupplemental Data SUPPLEMENTAL FIGURES
Supplemental Data CRYSTAL STRUCTURE OF THE MG.ADP-INHIBITED STATE OF THE YEAST F 1 C 10 ATP SYNTHASE Alain Dautant*, Jean Velours and Marie-France Giraud* From Université Bordeaux 2, CNRS; Institut de
More informationSupporting Information. Time-Resolved Botulinum Neurotoxin A Activity Monitored using. Peptide-Functionalized Au Nanoparticle Energy Transfer Sensors
Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2014 Supporting Information Time-Resolved Botulinum Neurotoxin A Activity Monitored using Peptide-Functionalized
More informationNature Structural & Molecular Biology: doi: /nsmb.3194
Supplementary Figure 1 Mass spectrometry and solution NMR data for -syn samples used in this study. (a) Matrix-assisted laser-desorption and ionization time-of-flight (MALDI-TOF) mass spectrum of uniformly-
More informationSupporting Information
Supporting Information Self-Assembly of Glutathione S-transferases into Nanowires Wei Zhang, a Quan Luo,* a Lu Miao, a Yushi Bai, a Zeyuan Dong, a Jiayun Xu, a and Junqiu Liu* a a State Key Laboratory
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Crystallization. a, Crystallization constructs of the ET B receptor are shown, with all of the modifications to the human wild-type the ET B receptor indicated. Residues interacting
More informationLecture 13: Data Analysis for the V versus [S] Experiment and Interpretation of the Michaelis-Menten Parameters
Biological Chemistry Laboratory Biology 3515/Chemistry 3515 Spring 2018 Lecture 13: Data Analysis for the V versus [S] Experiment and Interpretation of the Michaelis-Menten Parameters 20 February 2018
More informationStructural basis for catalytically restrictive dynamics of a high-energy enzyme state
Supplementary Material Structural basis for catalytically restrictive dynamics of a high-energy enzyme state Michael Kovermann, Jörgen Ådén, Christin Grundström, A. Elisabeth Sauer-Eriksson, Uwe H. Sauer
More informationDetermining Protein Structure BIBC 100
Determining Protein Structure BIBC 100 Determining Protein Structure X-Ray Diffraction Interactions of x-rays with electrons in molecules in a crystal NMR- Nuclear Magnetic Resonance Interactions of magnetic
More informationCryo-EM data collection, refinement and validation statistics
1 Table S1 Cryo-EM data collection, refinement and validation statistics Data collection and processing CPSF-160 WDR33 (EMDB-7114) (PDB 6BM0) CPSF-160 WDR33 (EMDB-7113) (PDB 6BLY) CPSF-160 WDR33 CPSF-30
More informationThe structure of the deubiquitinase USP15 reveals a misaligned catalytic triad and an open ubiquitin-binding channel
SUPPORTING INFORMATION The structure of the deubiquitinase USP15 reveals a misaligned catalytic triad and an open ubiquitin-binding channel Stephanie J. Ward, Hayley E. Gratton, Peni Indrayudha #, Camille
More informationData Sheet. Azide Cy5 RNA T7 Transcription Kit
Cat. No. Size 1. Description PP-501-Cy5 10 reactions à 40 µl For in vitro use only Quality guaranteed for 12 months Store all components at -20 C. Avoid freeze and thaw cycles. DBCO-Sulfo-Cy5 must be stored
More informationOverview of Kinetics
Overview of Kinetics [P] t = ν = k[s] Velocity of reaction Conc. of reactant(s) Rate of reaction M/sec Rate constant sec -1, M -1 sec -1 1 st order reaction-rate depends on concentration of one reactant
More informationEnzyme reaction example of Catalysis, simplest form: E + P at end of reaction No consumption of E (ES): enzyme-substrate complex Intermediate
V 41 Enzyme Kinetics Enzyme reaction example of Catalysis, simplest form: k 1 E + S k -1 ES E at beginning and ES k 2 k -2 E + P at end of reaction No consumption of E (ES): enzyme-substrate complex Intermediate
More informationSupporting Information for. Jesinghaus, Rachael Barry, Zemer Gitai, Justin Kollman and Enoch P. Baldwin
Supporting Information for Inhibition of E. coli CTP synthetase by NADH and other nicotinamides, and their mutual interactions with CTP and GTP Chris Habrian, Adithi Chandrasekhara, Bita Shahrvini, Brian
More informationSupporting Information
Supporting Information Decoding Allosteric Networks in Biocatalysts: Rational Approach to Therapies and Biotechnologies Johannes T. Cramer 1,2, Jana I. Führing 1, Petra Baruch 2, Christian Brütting 3,
More informationBiochemistry. Lecture 8 Enzyme Kinetics
Biochemistry Lecture 8 Enzyme Kinetics Why Enzymes? igher reaction rates Greater reaction specificity Milder reaction conditions Capacity for regulation C - - C N 2 - C N 2 - C - C Chorismate mutase -
More informationTHE CRYSTAL STRUCTURE OF THE SGT1-SKP1 COMPLEX: THE LINK BETWEEN
THE CRYSTAL STRUCTURE OF THE SGT1-SKP1 COMPLEX: THE LINK BETWEEN HSP90 AND BOTH SCF E3 UBIQUITIN LIGASES AND KINETOCHORES Oliver Willhoft, Richard Kerr, Dipali Patel, Wenjuan Zhang, Caezar Al-Jassar, Tina
More informationFinal Chem 4511/6501 Spring 2011 May 5, 2011 b Name
Key 1) [10 points] In RNA, G commonly forms a wobble pair with U. a) Draw a G-U wobble base pair, include riboses and 5 phosphates. b) Label the major groove and the minor groove. c) Label the atoms of
More informationSUPPLEMENTARY INFORMATION
Supplementary Table 1: Data collection, phasing and refinement statistics ChbC/Ta 6 Br 12 Native ChbC Data collection Space group P4 3 2 1 2 P4 3 2 1 2 Cell dimensions a, c (Å) 132.75, 453.57 132.81, 452.95
More informationCrystal Structure of Fibroblast Growth Factor 9 (FGF9) Reveals Regions. Implicated in Dimerization and Autoinhibition
JBC Papers in Press. Published on November 1, 2000 as Manuscript M006502200 Crystal Structure of Fibroblast Growth Factor 9 (FGF9) Reveals Regions Implicated in Dimerization and Autoinhibition 1 Copyright
More informationSUPPLEMENTARY INFORMATION
Supplementary Figure 1: The HpUreI crystal used for collection of native diffraction data. The crystal belongs to spacegroup P4 2 2 1 2 and has an approximate maximal dimension of 0.25 mm. Supplementary
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11524 Supplementary discussion Functional analysis of the sugar porter family (SP) signature motifs. As seen in Fig. 5c, single point mutation of the conserved
More informationIgE binds asymmetrically to its B cell receptor CD23
Supplementary Information IgE binds asymmetrically to its B cell receptor CD23 Balvinder Dhaliwal 1*, Marie O. Y. Pang 2, Anthony H. Keeble 2,3, Louisa K. James 2,4, Hannah J. Gould 2, James M. McDonnell
More informationSupplementary Figure 1 Pairing alignments, turns and extensions within the structure of the ribozyme-product complex. (a) The alignment of the G27
Supplementary Figure 1 Pairing alignments, turns and extensions within the structure of the ribozyme-product complex. (a) The alignment of the G27 A40 non-canonical pair stacked over the A41 (G1-C26) three-base
More informationBiological Sciences 11 Spring Experiment 4. Protein crosslinking
Biological Sciences 11 Spring 2000 Experiment 4. Protein crosslinking = C - CH 2 - CH 2 - CH 2 - C = H H GA Cl - H 2 N N H 2 Cl - C - CH 2 - CH 2 - CH 2 - CH 2 - CH 2 - CH 2 - C DMS CH 3 CH 3 N - - C -
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Identification of the ScDcp2 minimal region interacting with both ScDcp1 and the ScEdc3 LSm domain. Pull-down experiment of untagged ScEdc3 LSm with various ScDcp1-Dcp2-His 6 fragments.
More informationCrystal lattice Real Space. Reflections Reciprocal Space. I. Solving Phases II. Model Building for CHEM 645. Purified Protein. Build model.
I. Solving Phases II. Model Building for CHEM 645 Purified Protein Solve Phase Build model and refine Crystal lattice Real Space Reflections Reciprocal Space ρ (x, y, z) pronounced rho F hkl 2 I F (h,
More informationA First Course on Kinetics and Reaction Engineering. Class 9 on Unit 9
A First Course on Kinetics and Reaction Engineering Class 9 on Unit 9 Part I - Chemical Reactions Part II - Chemical Reaction Kinetics Where We re Going A. Rate Expressions - 4. Reaction Rates and Temperature
More informationSupplemental Information
Supplemental Information Combinatorial Readout of Unmodified H3R2 and Acetylated H3K14 by the Tandem PHD Finger of MOZ Reveals a Regulatory Mechanism for HOXA9 Transcription Yu Qiu 1, Lei Liu 1, Chen Zhao
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature12242 C. thermophilum 666 RPAVLDNVYIRPALE-GKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQN S. pombe 659 RPAHINDVYVRPAID-GKRLPGFIEIHQNGIRYQSPLRSDSHIDLLFSNMKHLFFQPCEG
More informationBiochemistry 3100 Sample Problems Binding proteins, Kinetics & Catalysis
(1) Draw an approximate denaturation curve for a typical blood protein (eg myoglobin) as a function of ph. (2) Myoglobin is a simple, single subunit binding protein that has an oxygen storage function
More informationCharacterization of Reversible Kinase Inhibitors using Microfluidic Mobility-Shift Assays
Application Note 211 Characterization of Reversible Kinase Inhibitors using Microfluidic Mobility-Shift Assays Introduction Current drug discovery efforts typically focus on developing small molecule inhibitors
More informationTex 25mer ssrna Binding Stoichiometry
Figure S. Determination of Tex:2nt ssrna binding stoichiometry using fluorescence polarization. Fluorescein labeled RNA was held at a constant concentration 2-fold above the K d. Tex protein was titrated
More informationMalachite Green Phosphate Detection Kit Catalog Number: DY996
Malachite Green Phosphate Detection Kit Catalog Number: DY996 This Malachite Green Phosphate Detection Kit employs a simple, sensitive, reproducible, and non-radioactive method for measuring inorganic
More informationSDS-PAGE (Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis):
SDS-PAGE (Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis): Aim: SDS-PAGE (Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis) is one of the common methods used in the molecular biology
More informationSUPPLEMENTARY INFORMATION
Supplementary Table 1: Amplitudes of three current levels. Level 0 (pa) Level 1 (pa) Level 2 (pa) TrkA- TrkH WT 200 K 0.01 ± 0.01 9.5 ± 0.01 18.7 ± 0.03 200 Na * 0.001 ± 0.01 3.9 ± 0.01 12.5 ± 0.03 200
More information4. What is the general expression Keq (the equilibrium constant) in terms of product and reactant concentration? tell us about the enzyme.
Section 8 Enzyme Kinetics Pre-Activity Assignment 1. Produce a reading log for the sections in your text that discuss the Michaelis-Menten equation and including kcat. 2. Focus on the derivation of the
More informationSupplementary figure 1. Comparison of unbound ogm-csf and ogm-csf as captured in the GIF:GM-CSF complex. Alignment of two copies of unbound ovine
Supplementary figure 1. Comparison of unbound and as captured in the GIF:GM-CSF complex. Alignment of two copies of unbound ovine GM-CSF (slate) with bound GM-CSF in the GIF:GM-CSF complex (GIF: green,
More informationExquisite Sequence Selectivity with Small Conditional RNAs
Supplementary Information Exquisite Sequence Selectivity with Small Conditional RNAs Jonathan B. Sternberg and Niles A. Pierce,, Division of Biology & Biological Engineering, Division of Engineering &
More informationLecture 15 (10/20/17) Lecture 15 (10/20/17)
Reading: Ch6; 98-203 Ch6; Box 6- Lecture 5 (0/20/7) Problems: Ch6 (text); 8, 9, 0,, 2, 3, 4, 5, 6 Ch6 (study guide-facts); 6, 7, 8, 9, 20, 2 8, 0, 2 Ch6 (study guide-applying); NEXT Reading: Ch6; 207-20
More informationS-SAD and Fe-SAD Phasing using X8 PROTEUM
S-SAD and Fe-SAD Phasing using X8 PROTEUM Kristina Djinovic Carugo Dept. for Structural and Computational Biology Max F. Perutz Labs Univ. Vienna, Austria Outline Fe-SAD on chlorite dismutase from Candidatus
More informationSUPPLEMENTARY INFORMATION. Structural basis of laminin binding to the LARGE glycans on dystroglycan
SUPPLEMENTARY INFORMATION Structural asis of laminin inding to the LARGE glycans on dystroglycan David C. Briggs 1, Takako Yoshida-Moriguchi 2, Tianqing Zheng 2, David Venzke 2, Mary Anderson 2, Andrea
More informationSupporting Information. Synthesis of Aspartame by Thermolysin : An X-ray Structural Study
Supporting Information Synthesis of Aspartame by Thermolysin : An X-ray Structural Study Gabriel Birrane, Balaji Bhyravbhatla, and Manuel A. Navia METHODS Crystallization. Thermolysin (TLN) from Calbiochem
More informationSupporting information for: Mechanism of lignin inhibition of enzymatic. biomass deconstruction
Supporting information for: Mechanism of lignin inhibition of enzymatic biomass deconstruction Josh V. Vermaas,, Loukas Petridis, Xianghong Qi,, Roland Schulz,, Benjamin Lindner, and Jeremy C. Smith,,
More informationFormation and Determination of the Oxidation Products of 5- Methylcytosine in RNA
Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2016 Supporting Information For Formation and Determination of the Oxidation Products of 5-
More informationSupplementary Information. Structural basis for precursor protein-directed ribosomal peptide macrocyclization
Supplementary Information Structural basis for precursor protein-directed ribosomal peptide macrocyclization Kunhua Li 1,3, Heather L. Condurso 1,3, Gengnan Li 1, Yousong Ding 2 and Steven D. Bruner 1*
More informationSupporting Information
Supporting Information Ottmann et al. 10.1073/pnas.0907587106 Fig. S1. Primary structure alignment of SBT3 with C5 peptidase from Streptococcus pyogenes. The Matchmaker tool in UCSF Chimera (http:// www.cgl.ucsf.edu/chimera)
More informationSUPPLEMENTARY INFORMATION
doi:10.108/nature11899 Supplementar Table 1. Data collection and refinement statistics (+TPMP, native) (-TPMP, native) (+TPMP, recombinant) (MgCl ) (MgSO ) Data collection Space group C P 1 C P 1 1 P 1
More informationInstantaneous and Quantitative Functionalization of Gold Nanoparticles with Thiolated DNA Using a ph-assisted and Surfactant-Free Route
Supporting Information Instantaneous and Quantitative Functionalization of Gold Nanoparticles with Thiolated DNA Using a ph-assisted and Surfactant-Free Route Xu Zhang,, Mark R. Servos and Juewen Liu *
More information4 Examples of enzymes
Catalysis 1 4 Examples of enzymes Adding water to a substrate: Serine proteases. Carbonic anhydrase. Restrictions Endonuclease. Transfer of a Phosphoryl group from ATP to a nucleotide. Nucleoside monophosphate
More information[Urea] (M) k (s -1 )
BMB178 Fall 2018 Problem Set 1 Due: 10/26/2018, noon Office hour: 10/25/2018, SFL GSR218 7 9 pm Problem 1. Transition state theory (20 points): Consider a unimolecular reaction where a substrate S is converted
More informationReconfigurable DNA Origami Nanocapsule for ph- Controlled Encapsulation and Display of Cargo
Supporting Information Reconfigurable DNA Origami Nanocapsule for ph- Controlled Encapsulation and Display of Cargo Heini Ijäs, Iiris Hakaste, Boxuan Shen, Mauri A. Kostiainen, and Veikko Linko* Biohybrid
More informationSupporting Protocol This protocol describes the construction and the force-field parameters of the non-standard residue for the Ag + -site using CNS
Supporting Protocol This protocol describes the construction and the force-field parameters of the non-standard residue for the Ag + -site using CNS CNS input file generatemetal.inp: remarks file generate/generatemetal.inp
More information13 Determining the Efficiency of the Enzyme Acetylcholine Esterase Using Steady-State Kinetic Experiment
13 Determining the Efficiency of the Enzyme Acetylcholine Esterase Using Steady-State Kinetic Experiment 131 Learning Objective This laboratory introduces you to steady-state kinetic analysis, a fundamental
More informationOn the status of the Michaelis-Menten equation and its implications for enzymology
1 On the status of the Michaelis-Menten equation and its implications for enzymology Sosale Chandrasekhar 1 Department of Organic Chemistry, Indian Institute of Science, Bangalore 560 012, India 1 E-mail:
More informationSUPPLEMENTARY INFORMATION. doi: /nature07461
Figure S1 Electrophysiology. a ph-activation of. Two-electrode voltage clamp recordings of Xenopus oocytes expressing in comparison to waterinjected oocytes. Currents were recorded at 40 mv. The ph of
More informationBA, BSc, and MSc Degree Examinations
Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes
More informationNature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1. Definition and assessment of ciap1 constructs.
Supplementary Figure 1 Definition and assessment of ciap1 constructs. (a) ciap1 constructs used in this study are shown as primary structure schematics with domains colored as in the main text. Mutations
More informationStructure, mechanism and ensemble formation of the Alkylhydroperoxide Reductase subunits. AhpC and AhpF from Escherichia coli
Structure, mechanism and ensemble formation of the Alkylhydroperoxide Reductase subunits AhpC and AhpF from Escherichia coli Phat Vinh Dip 1,#, Neelagandan Kamariah 2,#, Malathy Sony Subramanian Manimekalai
More informationBiology Slide 1 of 34
Biology 1 of 34 2 4 Chemical Reactions and Enzymes 2 of 34 2 4 Chemical Reactions and Enzymes Chemical Reactions Chemical Reactions A chemical reaction is a process that changes one set of chemicals into
More informationHydrophobicity-Induced Prestaining for Protein Detection in Polyacrylamide
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2016 Hydrophobicity-Induced Prestaining for Protein Detection in Polyacrylamide Gel Electrophoresis
More information