Avian hairy Gene Expression Iden4fies a Molecular Clock Linked to Vertebrate Segmenta4on and Somitogenesis
|
|
- Leon Lee
- 6 years ago
- Views:
Transcription
1 Avian hairy Gene Expression Iden4fies a Molecular Clock Linked to Vertebrate Segmenta4on and Somitogenesis Pourquie, et. al., 1997 Swetha Mummini, Victoria Fong What is a somite? Defini4on: Segmental block or ball mesoderm formed from paraxial mesoderm adjacent to notochord, form the axial skeleton (vertebrae, ribs), skeletal muscle, dorsal dermis, tendons, joints, and dorsal aor4c cells. Chick somite every 90 minutes 1
2 Clock & wavefront model 2
3 What is c hairy1? Member of the pair rule genes/segmenta4on genes Promotes produc4on of somites Expressed in presomi4c mesoderm (PSM) What does this paper explore? Turning c hairy1 off and on in individual cells during somite forma4on expression of c hairy1 in somite forma4on Autonomy of c hairy1 expression 3
4 What does the clock & wavefront model predict about gene expression in somite forma4on? Is c hairy1 expression in cells oscilla4ng in a pa]ern consistent with the c&w model? Are cells really oscilla4ng or it is a result of cell movement? Is this kind of gene expression a result of relay signaling? Is this gene expression autonomous? c hairy1 gene oscillates once per cell/per wave 4
5 Is c hairy1 expression in cells oscilla4ng in a pa]ern consistent with the c&w model? Figure 3 Is c hairy1 expression in cells oscilla4ng in a pa]ern consistent with the c&w model? Figure 4 5
6 What does the clock & wavefront model predict about gene expression in somite forma4on? Is c hairy1 expression in cells oscilla4ng in a pa]ern consistent with the c&w model? YES Are the cells really oscilla4ng or is it a result of cell movement? Is this kind of gene expression a result of relay signaling? Is this gene expression autonomous? Figure 5 6
7 What does the clock & wavefront model predict about gene expression in somite forma4on? Does gene expression move in a wave like pa]ern? YES Are the cells really oscilla4ng or is it a result of cell movement? NO Is this kind of gene expression a result of relay signaling? Is this wave like gene expression autonomous? Figure 6 A C 7
8 What does the clock & wavefront model predict about gene expression in somite forma4on? Does gene expression move in a wave like pa]ern? YES Are the cells really oscilla4ng or is it a result of cell movement? NO Is this kind of gene expression a result of relay signaling? NO Is this gene expression autonomous? Is this wave like gene expression autonomous? Figure 6 D F 8
9 What does the clock & wavefront model predict about gene expression in somite forma4on? Does gene expression move in a wave like pa]ern? YES Are the cells really oscilla4ng or is it a result of cell movement? NO Is this kind of gene expression a result of relay signaling? NO Is this gene expression autonomous? YES Figure 8 9
10 Summary & conclusions for c&w model in c hairy1 Expression is not due to cell migra4on through PSM it is individual oscilla4ons within cells Individual oscilla4ons within cells are not due to relay signaling it is autonomous within the PSM The molecular clock of c hairy1 con4nues to be debated whether c hairy1 is a central component or if its expression is an output of the molecular clock Discussion 1. How does c hairy1 fit with somitogenesis and the c&w model? 2. When do PSM cells know when to group together and form a somite? 3. Why does it even ma]er? 10
11 Your Ques4ons/Notch & Wnt Vast majority of your ques4ons involved other genes involved in the molecular clock What is Notch? 11
2/23/09. Regional differentiation of mesoderm. Morphological changes at early postgastrulation. Segments organize the body plan during embryogenesis
Regional differentiation of mesoderm Axial Paraxial Intermediate Somatic Splanchnic Chick embryo Morphological changes at early postgastrulation stages Segments organize the body plan during embryogenesis
More informationParaxial and Intermediate Mesoderm
Biology 4361 Paraxial and Intermediate Mesoderm December 7, 2006 Major Mesoderm Lineages Mesodermal subdivisions are specified along a mediolateral axis by increasing amounts of BMPs more lateral mesoderm
More informationParaxial and Intermediate Mesoderm
Biology 4361 Paraxial and Intermediate Mesoderm December 6, 2007 Mesoderm Formation Chick Major Mesoderm Lineages Mesodermal subdivisions are specified along a mediolateral axis by increasing amounts of
More informationParaxial and Intermediate Mesoderm
Biology 4361 Paraxial and Intermediate Mesoderm December 6, 2007 Mesoderm Formation Chick Major Mesoderm Lineages Mesodermal subdivisions are specified along a mediolateral axis by increasing amounts of
More informationParaxial and Intermediate Mesoderm
Biology 4361 Paraxial and Intermediate Mesoderm July 28, 2008 Paraxial and Intermediate Mesoderm Overview Development of major mesodermal lineages Somites: formation specification and differentiation Mesodermal
More informationA systems approach to biology
A systems approach to biology SB200 Lecture 7 7 October 2008 Jeremy Gunawardena jeremy@hms.harvard.edu Recap of Lecture 6 In phage lambda, cooperativity leads to bistability and hysteresis In HIV-1, sequestration
More informationMesoderm Development
Quiz rules: Spread out across available tables No phones, text books, or (lecture) notes on your desks No consultation with your colleagues No websites open other than the Quiz page No screen snap shots
More informationPeriodic Pattern Formation In Developmental Biology: A Study Of The Mechanisms Underlying Somitogenesis
Periodic Pattern Formation In Developmental Biology: A Study Of The Mechanisms Underlying Somitogenesis Ruth E. Baker WADHAM COLLEGE University of Oxford A thesis submitted for the degree of Doctor of
More informationSomites without a clock
Dias, AS; de Almeida, I; Belmonte, JM; Glazier, JA; Stern, CD; (2014) Somites Without a Clock. Science 10.1126/science.1247575. ARTICLE Somites without a clock Ana S. Dias 1,, Irene de Almeida 1,, Julio
More informationpresumptiv e germ layers during Gastrulatio n and neurulation Somites
Vertebrate embryos are similar at the phylotypic stage Patterning the Vertebrate Body Plan II: Mesoderm & Early Nervous System Wolpert L, Beddington R, Jessell T, Lawrence P, Meyerowitz E, Smith J. (2001)
More informationLife Sciences For NET & SLET Exams Of UGC-CSIR. Section B and C. Volume-08. Contents A. BASIC CONCEPT OF DEVELOPMENT 1
Section B and C Volume-08 Contents 5. DEVELOPMENTAL BIOLOGY A. BASIC CONCEPT OF DEVELOPMENT 1 B. GAMETOGENESIS, FERTILIZATION AND EARLY DEVELOPMENT 23 C. MORPHOGENESIS AND ORGANOGENESIS IN ANIMALS 91 0
More informationExamining the role of Lunatic fringe dosage in somitogenesis. A Senior Honors Thesis. Jason D. Lather
Examining the role of Lunatic fringe dosage in somitogenesis A Senior Honors Thesis Presented in partial fulfillment of the requirements for graduation with distinction in Molecular Genetics in the undergraduate
More informationTHE MAKING OF THE SOMITE: MOLECULAR EVENTS IN VERTEBRATE SEGMENTATION. Yumiko Saga* and Hiroyuki Takeda
THE MAKING OF THE SOMITE: MOLECULAR EVENTS IN VERTEBRATE SEGMENTATION Yumiko Saga* and Hiroyuki Takeda The reiterated structures of the vertebrate axial skeleton, spinal nervous system and body muscle
More informationRevisiting the involvement of signaling gradients in somitogenesis
VIEWPOINT Revisiting the involvement of signaling gradients in somitogenesis Moises Mallo Instituto Gulbenkian de Ciencia, Oeiras, Portugal Keywords development; mesoderm; segmentation; signaling; somite
More informationASpatio-TemporalModelofNotchSignallinginthe Zebrafish Segmentation Clock: Conditions for Synchronised Oscillatory Dynamics
ASpatio-TemporalModelofNotchSignallinginthe Zebrafish Segmentation Clock: Conditions for Synchronised Oscillatory Dynamics Alan J. Terry 1 *, Marc Sturrock 1, J. Kim Dale 2, Miguel Maroto 2, Mark A. J.
More informationRole of Organizer Chages in Late Frog Embryos
Ectoderm Germ Layer Frog Fate Map Frog Fate Map Role of Organizer Chages in Late Frog Embryos Organizer forms three distinct regions Notochord formation in chick Beta-catenin localization How does beta-catenin
More informationCoupling segmentation to axis formation
5783 Coupling segmentation to axis formation Julien Dubrulle* and Olivier Pourquié Stowers Institute for Medical Research, 1000E 50th street, Kansas City, MO 64110, USA *Present address: Skirball Institute
More informationSomitogenesis Clock-Wave Initiation Requires Differential Decay and Multiple Binding Sites for Clock Protein
Requires Differential Decay and Multiple Binding Sites for Clock Protein Mark Campanelli 1, Tomáš Gedeon 2 * 1 Department of Mathematics and Computer Science, Southwest Minnesota State University, Marshall,
More informationParaxial and Intermediate Mesoderm
12 Paraxial and Intermediate Mesoderm chapters 10 and 11 followed the formation of various tissues from the vertebrate ectoderm. In this chapter and the next, we will follow the development of the mesodermal
More informationMediolateral somitic origin of ribs and dermis determined by quail-chick chimeras
Development 127, 4611-4617 (2000) Printed in Great Britain The Company of Biologists Limited 2000 DEV2597 4611 Mediolateral somitic origin of ribs and dermis determined by quail-chick chimeras Isabel Olivera-Martinez
More informationOnset of the segmentation clock in the chick embryo: evidence for oscillations in the somite precursors in the primitive streak
Development 129, 1107-1117 (2002) Printed in Great Britain The Company of Biologists Limited 2002 DEV2742 1107 Onset of the segmentation clock in the chick embryo: evidence for oscillations in the somite
More informationLesson 10. References: Chapter 8: Reading for Next Lesson: Chapter 8:
Lesson 10 Lesson Outline: General Features of the Skeletal System Axial Skeleton (Vertebral Column) Ontogenetic Origins (Morphogenesis) of the Skeletal System Functions of the Axial Skeleton Phylogenetic
More informationA NOVEL GAIN OF FUNCTION OF THE IRX1 AND IRX2 GENES DISRUPTS AXIS ELONGATION IN THE ARAUCANA RUMPLESS CHICKEN
Clemson University TigerPrints All Dissertations Dissertations 8-2013 A NOVEL GAIN OF FUNCTION OF THE IRX1 AND IRX2 GENES DISRUPTS AXIS ELONGATION IN THE ARAUCANA RUMPLESS CHICKEN Nowlan Freese Clemson
More informationPatterning embryos with oscillations: structure, function and dynamics of the vertebrate segmentation clock
REVIEW 625 Development 139, 625-639 (2012) doi:10.1242/dev.063735 2012. Published by The Company of Biologists Ltd Patterning embryos with oscillations: structure, function and dynamics of the vertebrate
More informationMODELLING PERIODIC OSCILLATIONS DURING SOMITOGENESIS. Peng Feng. Menaka Navaratna. (Communicated by Yang Kuang)
MATHEMATICAL BIOSCIENCES http://www.mbejournal.org/ AND ENGINEERING Volume 4, Number 4, October 2007 pp. 661 673 MODELLING PERIODIC OSCILLATIONS DURING SOMITOGENESIS Peng Feng Department of Physical Sciences
More informationSomite formation in the chicken embryo
Int. J. Dev. Biol. 62: 57-62 (2018) https://doi.org/10.1387/ijdb.180036op www.intjdevbiol.com Somite formation in the chicken embryo OLIVIER POURQUIÉ*,1,2,3 1 Department of Genetics, Harvard Medical School,
More informationReview Article Timing Embryo Segmentation: Dynamics and Regulatory Mechanisms of the Vertebrate Segmentation Clock
BioMed Research International, Article ID 718683, 12 pages http://dx.doi.org/10.1155/2014/718683 Review Article Timing Embryo Segmentation: Dynamics and Regulatory Mechanisms of the Vertebrate Segmentation
More informationarxiv: v1 [q-bio.qm] 23 Apr 2007
Converting genetic networ oscillations into somite spatial pattern K. I. Mazzitello, 1,2 C. M. Arizmendi, 2 and H. G. E. Hentschel 3 1 CONICET 2 Facultad de Ingeniería, Universidad Nacional de Mar del
More informationA mathematical investigation of a Clock and Wavefront model for somitogenesis
J. Math. Biol. 52, 458 482 (6) Mathematical Biology Digital Object Identifier (DOI): 1.17/s285-5-362-2 R.E. Baker S. Schnell P.K. Maini A mathematical investigation of a Clock and Wavefront model for somitogenesis
More informationDetermination of epithelial half-somites in skeletal morphogenesis
Development 116, 441-445 (1992) Printed in Great Britain The Company of Biologists Limited 1992 441 Determination of epithelial half-somites in skeletal morphogenesis RONALD S. GOLDSTEIN * and CHAYA KALCHEIM
More informationDevelopmental Biology
Developmental Biology 371 (2012) 235 245 Contents lists available at SciVerse ScienceDirect Developmental Biology journal homepage: www.elsevier.com/locate/developmentalbiology Signaling by FGF4 and FGF8
More informationDOWNLOAD SOMITOGENESIS REPRINT
DOWNLOAD SOMITOGENESIS REPRINT Page 1 Page 2 somitogenesis reprint pdf Title: Somitogenesis Reprint Keywords: Link Dwonload Somitogenesis Reprint,Read File Somitogenesis Reprint pdf live, Where I can Download
More informationOsmotic and Heat Stress Effects on Segmentation
Wesleyan University WesScholar Faculty Scholarship Biology 2016 Julian Weiss Stephen Devoto Wesleyan University, sdevoto@wesleyan.edu Follow this and additional works at: https://wesscholar.wesleyan.edu/biolfacpub
More informationThe segmentation clock mechanism moves up a notch
Review The segmentation clock mechanism moves up a notch Sarah Gibb, Miguel Maroto and J. Kim Dale College of Life Sciences, University of Dundee, Dundee, DD1 5EH, Scotland, UK The vertebrate segmentation
More informationThe oscillation of Notch activation, but not its boundary, is required for somite border formation and rostral-caudal patterning within a somite
Access the Development most First recent posted version epress online at http://dev.biologists.org/lookup/doi/10.1242/dev.044545 on online 24 March publication 2010 as 10.1242/dev.044545 date March 2010
More informationEvolution of the Skeleton
Evolution of the Skeleton Reading Benton Chapter 5 The Vertebrate Archetype (Richard Owen) Next week Tuesday (17 Sept): Paper Discussion Purnell, M. A. 2001. Scenarios, selection and the ecology of early
More information9/4/2015 INDUCTION CHAPTER 1. Neurons are similar across phyla Thus, many different model systems are used in developmental neurobiology. Fig 1.
INDUCTION CHAPTER 1 Neurons are similar across phyla Thus, many different model systems are used in developmental neurobiology Fig 1.1 1 EVOLUTION OF METAZOAN BRAINS GASTRULATION MAKING THE 3 RD GERM LAYER
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11804 a Tailbud after cutting PSM after cutting b 3500 3000 2500 mean intensity 2000 1500 1000 ROI1 (TB) ROI2 (PSM) 500 0 0 1 2 3 4 5 6 7 8 9 time (h) Supplementary Fig.1 Lfng gene activity
More informationA Proposed Mechanism for the Interaction of the Segmentation Clock and the Determination Front in Somitogenesis
A Proposed Mechanism for the Interaction of the Segmentation Clock and the Determination Front in Somitogenesis Moisés Santillán 1,2 *, Michael C. Mackey 1 1 Campus Monterrey, Centro de Investigación y
More informationSpecification of vertebral identity is coupled to Notch signalling and the segmentation clock
Research article 1221 Specification of vertebral identity is coupled to Notch signalling and the segmentation clock Ralf Cordes, Karin Schuster-Gossler, Katrin Serth and Achim Gossler* Institut für Molekularbiologie
More informationLive Imaging of Segmentation Clock Dynamics in Zebrafish. Nathan Pui-Yin Shih. A dissertation submitted in partial satisfaction of the
Live Imaging of Segmentation Clock Dynamics in Zebrafish By Nathan Pui-Yin Shih A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Molecular
More informationResults and Problems in Cell Differentiation. Series Editor: Hennig
Results and Problems in Cell Differentiation Series Editor: w. 38 Hennig Springer-Verlag Berlin Heidelberg GmbH Beate Brand-Saberi (Ed.) Vertebrate Myogenesis With 31 Figures Springer Professor Dr. Beate
More informationBIOLOGY
Int. J. Dev. Biol. 53: 1469-1481 (2009) doi: 10.1387/ijdb.072276mm THE INTERNATIONAL JOURNAL OF DEVELOPMENTAL BIOLOGY www.intjdevbiol.com The road to the vertebral formula MOISÉS MALLO*,1, TÂNIA VINAGRE
More information6 Mathematical Models for Somite Formation
6 Mathematical Models for Somite Formation Ruth E. Baker, Santiago Schnell, and Philip K. Maini, Centre for Mathematical Biology, Mathematical Institute, University of Oxford, 24-29 St. Giles, Oxford OX1
More informationSonic hedgehog is required for survival of both myogenic and chondrogenic somitic lineages
Development 125, 2019-2030 (1998) Printed in Great Britain The Company of Biologists Limited 1998 DEV2281 2019 Sonic hedgehog is required for survival of both myogenic and chondrogenic somitic lineages
More informationNotch Is a Critical Component of the Mouse Somitogenesis Oscillator and Is Essential for the Formation of the Somites
Notch Is a Critical Component of the Mouse Somitogenesis Oscillator and Is Essential for the Formation of the Somites Zoltan Ferjentsik 1, Shinichi Hayashi 2., J. Kim Dale 1., Yasumasa Bessho 2, An Herreman
More informationCircadian Genes, xbmal1 and xnocturnin, Modulate the Timing and Differentiation of Somites in Xenopus laevis
Circadian Genes, xbmal1 and xnocturnin, Modulate the Timing and Differentiation of Somites in Xenopus laevis Kristen L. Curran*, Latoya Allen, Brittany Bronson Porter, Joseph Dodge, Chelsea Lope, Gail
More informationName KEY. Biology Developmental Biology Winter Quarter Midterm 3 KEY
Name KEY 100 Total Points Open Book Biology 411 - Developmental Biology Winter Quarter 2009 Midterm 3 KEY All of the 25 multi-choice questions are single-answer. Choose the best answer. (4 pts each) Place
More informationSection 4 Professor Donald McFarlane
Characteristics Section 4 Professor Donald McFarlane Lecture 11 Animals: Origins and Bauplans Multicellular heterotroph Cells lack cell walls Most have nerves, muscles, capacity to move at some point in
More informationA cell lineage analysis of segmentation in the chick embryo
Development 104 Supplement, 231-244 (1988) 231 Printed in Great Britain The Company of Biologists Limited 1988 A cell lineage analysis of segmentation in the chick embryo CLAUDIO D. STERN 1, SCOTT E. FRASER
More informationA novel signal induces a segmentation fissure by acting in a ventral-to-dorsal direction in the presomitic mesoderm
Developmental Biology 282 (2005) 183 191 www.elsevier.com/locate/ydbio A novel signal induces a segmentation fissure by acting in a ventral-to-dorsal direction in the presomitic mesoderm Yuki Sato a, Yoshiko
More informationVertebrate Segmentation: From Cyclic Gene Networks to Scoliosis
Leading Edge Review Vertebrate Segmentation: From Cyclic Gene Networks to Scoliosis Olivier Pourquié 1, * 1 Institut de Génétique et de Biologie Moléculaire et Cellulaire (IGBMC), CNRS (UMR 7104), Inserm
More informationN-Cadherin/Catenin-Mediated Morphoregulation of Somite Formation
DEVELOPMENTAL BIOLOGY 202, 85 102 (1998) ARTICLE NO. DB989025 N-Cadherin/Catenin-Mediated Morphoregulation of Somite Formation Kersti K. Linask,*,1 Cheryl Ludwig,* Ming-Da Han,* Xiao Liu,* Glenn L. Radice,
More informationCa 2+ signaling during vertebrate somitogenesis 1
Acta Pharmacologica Sinica 2006 Jul; 27 (7): 781 790 Invited review Ca 2+ signaling during vertebrate somitogenesis 1 Sarah E WEBB, Andrew L MILLER 2 Department of Biology, the Hong Kong University of
More informationPRACTICE EXAM. 20 pts: 1. With the aid of a diagram, indicate how initial dorsal-ventral polarity is created in fruit fly and frog embryos.
PRACTICE EXAM 20 pts: 1. With the aid of a diagram, indicate how initial dorsal-ventral polarity is created in fruit fly and frog embryos. No Low [] Fly Embryo Embryo Non-neural Genes Neuroectoderm Genes
More informationMorphogenesis and specification of the muscle lineage during Xenopus laevis embryo development. Armbien F. Sabillo
Morphogenesis and specification of the muscle lineage during Xenopus laevis embryo development by Armbien F. Sabillo A dissertation submitted in partial satisfaction of the requirements for the degree
More informationARTICLE IN PRESS YDBIO-01976; No of pages: 11; 4C: 4, 5, 6, 8
YDBIO-01976; No of pages: 11; 4C: 4, 5, 6, 8 DTD 5 Developmental Biology xx (2005) xxx xxx www.elsevier.com/locate/ydbio Generation of segment polarity in the paraxial mesoderm of the zebrafish through
More informationfamtly'members induces. q myogenic
Combinatorial signaling bv Sonic hedgehog and wg~ famtly'members induces. q myogenic. bhlh gene expression in the somite Andrea E. ~iinsterber~,' Jan ~itajewski; David A. ~umcrot? Andrew P. McMahon? and
More informationMyoblasts and notochord influence the orientation of somitic myoblasts from Xenopus laevis
/. Embryol. exp. Morph. 93, 121-131 (1986) 121 Printed in Great Britain The Company of Biologists Limited 1986 Myoblasts and notochord influence the orientation of somitic myoblasts from Xenopus laevis
More informationInitial steps of myogenesis in somites are independent of influence from axial structures
Development 120, 3073-3082 (1994) Printed in Great Britain The Company of Biologists Limited 1994 3073 Initial steps of myogenesis in somites are independent of influence from axial structures Eva Bober
More informationFrom Segment to Somite: Segmentation to Epithelialization Analyzed Within Quantitative Frameworks
DEVELOPMENTAL DYNAMICS 236:1392 1402, 2007 SPECIAL ISSUE REVIEWS A PEER REVIEWED FORUM From Segment to Somite: Segmentation to Epithelialization Analyzed Within Quantitative Frameworks Paul M. Kulesa,
More informationBIOLOGY - CLUTCH CH.32 - OVERVIEW OF ANIMALS.
!! www.clutchprep.com Animals are multicellular, heterotrophic eukaryotes that feed by ingesting their food Most animals are diploid, and produce gametes produced directly by meiosis Animals lack cell
More informationPractical Lessons from Theoretical Models about the Somitogenesis
REVIEW Practical Lessons from Theoretical Models about the Somitogenesis Aitor González and Ryoichiro Kageyama Institute for Virus Research, Kyoto University, and Japan Science and Technology Agency, CREST
More informationName. Biology Developmental Biology Winter Quarter 2013 KEY. Midterm 3
Name 100 Total Points Open Book Biology 411 - Developmental Biology Winter Quarter 2013 KEY Midterm 3 Read the Following Instructions: * Answer 20 questions (5 points each) out of the available 25 questions
More informationLimb Development Involving the development of the appendicular skeleton and muscles
Limb Development Involving the development of the appendicular skeleton and muscles 1 Objectives Timing and location of limb bud development The tissues from which limb buds are made Determining the position
More informationMesoderm Divided into three main types - Paraxial (somite) - Intermediate - Lateral (somatic and splanchnic)
Mesoderm Divided into three main types - Paraxial (somite) - Intermediate - Lateral (somatic and splanchnic) Fates of Mesoderm Paraxial - Dermis of skin - Axial Skeleton - Axial and limb muscles/tendons
More informationSomite Development in Zebrafish
Wesleyan University WesScholar Division III Faculty Publications Natural Sciences and Mathematics 2000 Somite Development in Zebrafish Stephen Devoto Wesleyan University, sdevoto@wesleyan.edu Follow this
More informationMechanisms of somite. formation and subdivision
Mechanisms of somite formation and subdivision Ana Sofia Teixeira Franco Dias A Thesis Submitted for the Degree of Doctor of Philosophy University of London 2017 Department of Cell and Developmental Biology
More informationMCDB 4777/5777 Molecular Neurobiology Lecture 29 Neural Development- In the beginning
MCDB 4777/5777 Molecular Neurobiology Lecture 29 Neural Development- In the beginning Learning Goals for Lecture 29 4.1 Describe the contributions of early developmental events in the embryo to the formation
More information4. Neural tube cells are specified by opposing dorsal-ventral gradients of a. Wnts and Nodal. b. FGF and Shh. c. BMPs and Wnts. d. BMPs and Shh.
Biology 4361 Name: KEY Exam 4 ID#: August 1, 2008 Multiple choice (one point each; indicate the best answer) 1. Neural tube closure is accomplished by movement of the a. medial hinge point cells. b. medial
More informationCamillo Mariani Center for Neutrino Physics, Virginia Tech
Camillo Mariani Center for Neutrino Physics, Virginia Tech Mo9va9on and Contents Determina9on of neutrino oscilla9on parameters requires knowledge of neutrino energy Modern experiments use complicated
More informationInteractions between muscle fibers and segment boundaries in zebrafish
Developmental Biology 287 (2005) 346 360 www.elsevier.com/locate/ydbio Interactions between muscle fibers and segment boundaries in zebrafish Clarissa A. Henry a,1, Ian M. McNulty b, Wendy A. Durst a,
More informationControl of dorsoventral patterning of somitic derivatives by notochord and floor plate
Proc. Natl. Acad. Sci. USA Vol. 90, pp. 5242-5246, June 1993 Developmental Biology Control of dorsoventral patterning of somitic derivatives by notochord and floor plate (BEN glycoprotein/muscle differentiation/cartilage/myotome/sclerotome)
More informationSclerotome development and morphogenesis: when experimental embryology meets genetics
Int. J. Dev. Biol. 49: 301-308 (2005) doi: 10.1387/ijdb.041953am Sclerotome development and morphogenesis: when experimental embryology meets genetics ANNE-HÉLÈNE MONSORO-BURQ* Institut Curie, Section
More informationExam 3 (Final Exam) December 20, 2007
Biology 4361 Exam 3 (Final Exam) December 20, 2007 Name: ID: Multiple choice (1 point each. Indicate the best answer.) 1. During Drosophila gastrulation, mesoderm moves in through the a. primitives streak.
More informationA Notch feeling of somite segmentation and beyond
Developmental Biology 265 (2004) 2 22 Review A Notch feeling of somite segmentation and beyond Padmashree C.G. Rida, Nguyet Le Minh, and Yun-Jin Jiang* Laboratory of Developmental Signalling and Patterning,
More informationSupplementary Figure 1: Mechanism of Lbx2 action on the Wnt/ -catenin signalling pathway. (a) The Wnt/ -catenin signalling pathway and its
Supplementary Figure 1: Mechanism of Lbx2 action on the Wnt/ -catenin signalling pathway. (a) The Wnt/ -catenin signalling pathway and its transcriptional activity in wild-type embryo. A gradient of canonical
More informationWnt signaling from the dorsal neural tube is required for the formation of the medial dermomyotome
Development 125, 4969-4976 (1998) Printed in Great Britain The Company of Biologists Limited 1998 DEV4080 4969 Wnt signaling from the dorsal neural tube is required for the formation of the medial dermomyotome
More information!!!!!!!! DB3230 Midterm 2 12/13/2013 Name:
1. (10 pts) Draw or describe the fate map of a late blastula stage sea urchin embryo. Draw or describe the corresponding fate map of the pluteus stage larva. Describe the sequence of gastrulation events
More informationChapter 32. Objectives. Table of Contents. Characteristics. Characteristics, continued. Section 1 The Nature of Animals
Introduction to Animals Table of Contents Objectives Identify four important characteristics of animals. List two kinds of tissues found only in animals. Explain how the first animals may have evolved
More informationDetermining the impact of cell mixing on signaling during development
The Japanese Society of Developmental Biologists Develop. Growth Differ. (2017) 59, 351 368 doi: 10.1111/dgd.12366 Review Article Determining the impact of cell mixing on signaling during development Koichiro
More informationDynamics of Zebrafish Somitogenesis
DEVELOPMENTAL DYNAMICS 237:545 553, 2008 RESEARCH ARTICLE Dynamics of Zebrafish Somitogenesis Christian Schröter, 1 Leah Herrgen, 1 Albert Cardona, 2 Gary J. Brouhard, 1 Benjamin Feldman, 3 and Andrew
More informationTHE HEADS AND TAILS OF DINOSAURIAN DEVELOPMENT. JOHN RYAN CALDWELL, Hons. B.Sc. degree of Masters of Science. John Ryan Caldwell, August 2017
THE HEADS AND TAILS OF DINOSAURIAN DEVELOPMENT BY JOHN RYAN CALDWELL, Hons. B.Sc. A Thesis submitted to McGill University in partial fulfillment of the requirements of the degree of Masters of Science
More informationUnit 4 Evaluation Question 1:
Name: Unit 4 Evaluation Question 1: /7 points A naturally occurring dominant mutant in mice is the Doublefoot (Dbf) mutant. Below is an image of the bones from a wildtype (wt) and Doublefoot mutant mouse.
More informationEnvironmental influences on the development of musculoskeletal tissues in sea bass
Environmental influences on the development of musculoskeletal tissues in sea bass Dr. Clare Ashton Prof. Neil Stickland The Royal Veterinary College, London, U.K. Acknowledgements Optimisation of Rearing
More informationCooperative activity of noggin and gremlin 1 in axial skeleton development
RESEARCH ARTICLE 1005 Development 138, 1005-1014 (2011) doi:10.1242/dev.051938 2011. Published by The Company of Biologists Ltd Cooperative activity of noggin and gremlin 1 in axial skeleton development
More informationThe period of the somite segmentation clock is sensitive to Notch activity. Institute of Science and Technology, Ikoma, Nara , Japan
The period of the somite segmentation clock is sensitive to Notch activity 1,7 Woong Kim, 1,7 Takaaki Matsui, 2 Masataka Yamao, 3 Makoto Ishibashi, 4 Kota Tamada, 4 Toru Takumi, 5 Kenji Kohno, 6 Shigeyuki
More informationSupporting Information
Supporting Information Pueyo et al. 10.1073/pnas.0804093105 SI Text Periplaneta americana (Delta GenBank Accession Number FJ222590). MR- WTQQTRVQGAVVVVILAALQQVCCSGVFELRLKSF- INDYGKDSVGQCCSGTPSPGTKACSGPCRTRFRVCL-
More informationAutoinhibition with Transcriptional Delay: A Simple Mechanism for the Zebrafish Somitogenesis Oscillator
Current Biology, Vol. 13, 1398 1408, August 19, 2003, 2003 Elsevier Science Ltd. All rights reserved. DOI 10.1016/S0960-9822(03)00534-7 Autoinhibition with Transcriptional Delay: A Simple Mechanism for
More informationinhibition of embryonic myogenesis
Dermomyotome development and myotome patterning require Tbx6 inhibition of embryonic myogenesis Stefanie E. Windner 1,2, Nathan C. Bird 1, Sara Elizabeth Patterson 1, Rosemarie Doris 1, and Stephen Henri
More informationQuestion Set # 4 Answer Key 7.22 Nov. 2002
Question Set # 4 Answer Key 7.22 Nov. 2002 1) A variety of reagents and approaches are frequently used by developmental biologists to understand the tissue interactions and molecular signaling pathways
More informationBiology 218, practise Exam 2, 2011
Figure 3 The long-range effect of Sqt does not depend on the induction of the endogenous cyc or sqt genes. a, Design and predictions for the experiments shown in b-e. b-e, Single-cell injection of 4 pg
More informationPax3 and Dach2 Positive Regulation in the Developing Somite
DEVELOPMENTAL DYNAMICS 224:350 355 (2002) BRIEF COMMUNICATIONS Pax3 and Dach2 Positive Regulation in the Developing Somite G. KARDON, T.A. HEANUE, AND C.J. TABIN* Department of Genetics, Harvard Medical
More informationStepwise Patterning of Erk Activity During Somitogenesis in Zebrafish
博士論文番号 :9971025 (Doctoral student number: 1281203) Stepwise Patterning of Erk Activity During Somitogenesis in Zebrafish Dini Wahyu Kartika Sari Nara Institute of Science and Technology Graduate School
More informationOsteology 101: It s all in the Bones (Adapted from Walker, S Exploring Physical Anthropology)
ANTHR 1-L: Biological Anthropology Lab R. Mitchell, Instructor Name Osteology 101: It s all in the Bones (Adapted from Walker, S. 2005. Exploring Physical Anthropology) Many subjects within the discipline
More informationCellular Neurobiology BIPN 140 Fall 2016 Problem Set #8
Cellular Neurobiology BIPN 140 Fall 2016 Problem Set #8 1. Inductive signaling is a hallmark of vertebrate and mammalian development. In early neural development, there are multiple signaling pathways
More informationMonodelphis domestica
EVOLUTION & DEVELOPMENT 14:1, 93 103 (2012) DOI: 10.1111/j.1525-142X.2011.00524.x Heterochrony in somitogenesis rate in a model marsupial, Monodelphis domestica Anna Keyte and Kathleen K. Smith Duke University,
More informationChapter 9. Benefits of Being Large. Levels of Organization in Organismal Complexity. Hierarchical Organization of Animal Complexity. Fig. 9.
Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. Chapter 9 Architectural Pattern of an Animal Levels of Organization in Organismal Complexity Zoologists recognize
More informationSkeletal 2 - joints. Puzzle 1 bones
Puzzle 1 bones Listed below are the names of some of the bones that make up your skeletal system. But the names have been encrypted using a secret code. Can you decipher this code to find out what they
More informationMutations affecting somite formation and patterning in the zebrafish, Danio
Development 123, 153-164 Printed in Great Britain The Company of Biologists Limited 1996 DEV3345 153 Mutations affecting somite formation and patterning in the zebrafish, Danio rerio Fredericus J. M. van
More information