Supplemental Data. Gao et al. (2012). Plant Cell /tpc
|
|
- Tabitha Wiggins
- 5 years ago
- Views:
Transcription
1 Supplemental Figure 1. Plant EMP Proteins. (A) The Accession numbers of the 12 EMP members from Arabidopsis. (B) Phylogenetic analysis of EMP proteins from Arabidopsis, human and yeast using the Mac Vector by UPGMA method. The bootstrap values are shown above each branch. (C) Alignment of the C-terminal region of Arabidopsis EMPs. The red boxes highlighted the ER export signals, while the blue boxes highlighted the Golgi retention signals. (D) Alignment of the C-terminal tail of EMP proteins from Arabidopsis, rice and maize. The red box highlighted the conserved lysine in the 3 position, while the blue box highlighted the conserved acidic residue (aspartic acid or glutamic acid) in the 1 position. 1
2 Supplemental Figure 2. The C-terminus of EMP12 was Essential for ER Export. (A) Constructs of GFP-EMP12 lacking lumenal N-terminus or cytoplasmic C-terminus. (B-C) Subcellular localization of GFP-EMP12( N) (B) and GFP-EMP12( C) (C) upon co-expression with either the Golgi marker Man1-mRFP or the ER marker Calnexin-mRFP in an Arabidopsis protoplast. Scale bar = 10 μm. 2
3 Supplemental Figure 3. Subcellular Localization of GFP-EMP12 with Triple Mutations at Its C-terminus. These constructs were co-expressed with the Golgi marker Man1-mRFP in Arabidopsis protoplasts. Scale bar = 10 μm. 3
4 Supplemental Figure 4. Subcellular Localization of EMP12-GFP with the Golgi Retention Motif Fused to the C-terminal End. The EMP12-GFP-CT (panels A-C), the EMP12-GFP-RNIKCD (panels D-E) and the EMP12-GFP-KCD (panels F-H) fusions were coexpressed with indicated organelle markers in Arabidopsis protoplasts, followed by confocal imaging at 12 h-14 h after transfection. Scale bar = 10 μm. 4
5 Supplemental Figure 5. Subcellular Localization of EMP12-GFP with C-terminal Fusion of Mutated Golgi Retention Motif. The EMP12-GFP-RNIACA (panels A-C), the EMP12-GFP-RNIACD (panels D-E), the EMP12-GFP-RNIKCA (panels F-G) and the EMP12-GFP-RNIKCDAAA (panels H-I) fusions were co-expressed with indicated organelle markers in Arabidopsis protoplasts, followed by confocal imaging at 12 h-14 h after transfection. Scale bar = 10 μm. 5
6 Supplemental Figure 6. EMP12-GFP Reached the Vacuole via the PVC for Degradation. (A). Overexpression of mrfp-ara7(q69l) did not affect the Golgi localization of GFP-EMP12 fusion. (B). EMP12-GFP reached the lumen of the enlarged PVC. When co-expressed with mrfp-ara7(q69l), EMP12-GFP fusion showed ball-like structures that were trapped in the lumen of mrfp-ara7(q69l) bounded ring-like structures, indicating that the EMP12-GFP fusion was degraded. (C). Overexpression of mrfp-ara7(q69l) did not affect the Golgi localization of EMP12-GFP-RNIKCD fusion. (D). EMP12-GFP-RNIKCDAAA reached the lumen of the enlarged PVC. When co-expressed with mrfp-ara7(q69l), EMP12-GFP-RNIKCDAAA fusion showed ball-like structures that were trapped in the lumen of mrfp-ara7(q69l) bounded ring-like structures, indicating that the EMP12-GFP-RNIKCDAAA fusion was degraded. Scale bar = 10 μm. 6
7 Supplemental Figure 7. EMP12 C-terminus Interacted with COPI Subunits. The wild-type Arabidopsis cells were used for protein isolation and peptide binding using Sepharose conjugated with EMP12 C-terminus synthetic peptides. Eluted proteins were separated by SDS-PAGE, followed by silver staining and MS-MS analysis of protein bands for protein identification. Arrowheads indicated COPI coat proteins, and the search results were included in the Table. MW, molecular weight in Da; PI, isoelectric point; C.I., confidence interval. 7
8 Supplemental Figure 8. Subcellular Localization of N-terminal or C-terminal GFP Fusions with EMP2, EMP3 and EMP8 in Arabidopsis Protoplasts. The GFP tag was either fused to the N-terminus (A, C and E) or the C-terminus (B, D and F) of EMP2, EMP3 and EMP8, followed by their co-expression with the Golgi marker Man1-mRFP in Arabidopsis protoplasts for confocal imaging. Scale bar = 10 μm. 8
9 Supplemental Figure 9. Localization Patterns of Singly-expressed Various EMP12 Fusions and Their Mutants in Arabidopsis Protoplasts. The indicated GFP fusions were transiently expressed alone in Arabidopsis protoplasts, followed by confocal imaging at 12 h-14 h after transfection. Scale bar = 10 μm. 9
10 Supplemental Table 1: Primers used in this study GFP-EMP12-Forward 5'-gggTCTAGATCAGATCACAAGTATCAAGCCGAG G-3' GFP-EMP12-Reverse 5'-gggGAGCTCCTAGTCGCACTTGATGTTTCTGTAG -3' GFP-EMP12( N)-Forward 5'-gggTCTAGAGAACACCAGATCCACTGGTTCT-3' GFP-EMP12( C)-Reverse 5 -ggggagctcctatcccaggtagccaacagctc-3 GFP-EMP12(F578A/V579A/Y583A 5 -ggggagctcctactagtcgcacttgatgtttctg )-Reverse GCGATCCTCCTTGCAGCCAGATTTGATC-3 GFP-EMP12(F578A/V579A)-Revers 5 -ggggagctcctagtcgcacttgatgtttctgtag e ATCCTCCTTGCAGCCAGATTTGATC-3 GFP-EMP12(V579A/Y583A)-Rever 5 -gggctcgagctagtcgcacttgatgtttctggcg se ATCCTC CTTGCAAACAGATTTG-3 GFP-EMP12(F578A/Y583A)-Revers 5 -gggctcgagctagtcgcacttgatgtttctggcg e ATCCTC CTTACAGCCA GATTTGATC-3 GFP-EMP12(F578A)-Reverse 5 -ggggagctcctagtcgcacttgatgtttctgtag ATCCTCCTTACAGCCAGATTTGATC-3 GFP-EMP12(V579A)-Reverse 5 -ggggagctcctagtcgcacttgatgtttctgtag ATCCTCCTTGCAAACAGATTTG-3 GFP-EMP12(Y583A)-Reverse 5 -ggggagctcctagtcgcacttgatgtttctggcg ATCCTCCTTAC-3 EMP12-GFP-Forward 5'-gggTCTAGAATGCCGTCTTCCTCCTCC-3' EMP12-GFP-Reverse 5'-gggCTCGAGGTCGCACTTGATGTTTCTGTAG-3' EMP12-GFP-Cter-Forward 5 -gggctcgagatggtgagcaagggcgaggag-3 EMP12-GFP-Cter-Reverse 5 -ggggagctcctagtcgcacttgatgtttctgtag ATCCTCCTTACAAACAGATTTGATCCCTTGTACAG CTCGTCCATGCCGTGAGT-3 EMP12-GFP-RIYRNIKCD-Reverse 5 -ggggagctcctagtcgcacttgatgtttctgtag ATCCTC TTGTACAGCTCGTCCATGCC-3 EMP12-GFP-RNIKCD-Reverse 5 -ggggagctcctagtcgcacttgatgtttctcttg TACAGC TCGTCCATGCC-3 EMP12-GFP-KCD-Reverse 5 -ggggagctcctagtcgcacttcttgtacagctc GTCCATG-3 EMP12-GFP-RNIACA-Reverse 5 -ggggagctcctaggcgcacgcgatgtttctctt GTACAGCTCG TCCATG-3 EMP12-GFP-RNIACD-Reverse 5 -ggggagctctagactagtcgcacgcgatgtttc TCTTGTA CAG-3 EMP12-GFP-RNIKCA-Reverse 5 -ggggagctctagactaggcgcacttgatgtttct CTTG-3 EMP12-GFP-RNIKCDAAA-Revers 5 -ggggagctctagactatgctgctgcgtcgcact e TGATGTTTCT-3 SCAMP1-GFP-RNIKCD-Reverse 5 -ggggagctcctagtcgcacttgatgtttctcttg TACAGC TCGTCCATGCC-3 TPK1-GFP-RNIKCD-Reverse 5 -ggggagctcctagtcgcacttgatgtttctcttg TACAGC TCGTCCATGCC-3 10
11 EMP2-GFP-Forward EMP2-GFP-Reverse GFP-EMP2-Forward GFP-EMP2-Reverse EMP3-GFP-Forward EMP3-GFP-Reverse GFP-EMP3-Forward GFP-EMP3-Reverse EMP8-GFP-Forward EMP8-GFP-Reverse GFP-EMP8-Forward GFP-EMP8-Reverse 5 -gggctcgagatggagttttatagaagttctag-3 5 -gggggtaccatcgatctttaccgaggaat-3 5 -gggctcgagttttaccttcctggtgttgctc-3 5 -gggggtacctcaatcgatctttaccgaggaat-3 5 -gggtgtaga ATGGCGAAAGTTCGGATTTTG-3 5 -gggctcgagatcgattttaaccgaagag-3 5 -gggtgtagagctccacaagatttccaaatg-3 5 -gggctcgagtcaatcgattttaaccgaagag-3 5 -cgctctagaatgaggacaccgacgacgattctc ccgctcgagctcgcatttgatcgaccggta-3 5 -cgcgacgcctccg ACCACCGTTA CAAG-3 5 -ccgctcgagttactcgcatttgatcgaccggta-3 11
GFP WxTP-GFP WxTP-GFP. stromules. DsRed WxTP-DsRed WxTP-DsRed. stromules
Supplemental Data. Kitajima et al. (2009). The rice -amylase glycoprotein is targeted from the Golgi apparatus through the secretory pathway to the plastids. A GFP WxTP-GFP WxTP-GFP stromules stromules
More informationHeather Currinn, Benjamin Guscott, Zita Balklava, Alice Rothnie and Thomas Wassmer*
Online Resources APP controls the formation of PI(3,5)P 2 vesicles through its binding of the PIKfyve complex. Cellular and Molecular Life Sciences Heather Currinn, Benjamin Guscott, Zita Balklava, Alice
More information13-3. Synthesis-Secretory pathway: Sort lumenal proteins, Secrete proteins, Sort membrane proteins
13-3. Synthesis-Secretory pathway: Sort lumenal proteins, Secrete proteins, Sort membrane proteins Molecular sorting: specific budding, vesicular transport, fusion 1. Why is this important? A. Form and
More informationNature Genetics: doi: /ng Supplementary Figure 1. The phenotypes of PI , BR121, and Harosoy under short-day conditions.
Supplementary Figure 1 The phenotypes of PI 159925, BR121, and Harosoy under short-day conditions. (a) Plant height. (b) Number of branches. (c) Average internode length. (d) Number of nodes. (e) Pods
More informationSupporting Information
Supporting Information Mullins et al. 10.1073/pnas.0906781106 SI Text Detection of Calcium Binding by 45 Ca 2 Overlay. The 45 CaCl 2 (1 mci, 37 MBq) was obtained from NEN. The general method of 45 Ca 2
More informationWaithe et al Supplementary Figures
Waithe et al Supplementary Figures Supplementary Figure 1 Expression and properties of WT and W391A mutant YFP- Ca V 2.2. A Immunoblot using Ca V 2.2 Ab for untransfected cells (UT, lane 1), YFP-Ca V 2.2
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature10534 Supplementary Fig. 1. Diagrammatic representation of the N-end rule pathway of targeted proteolysis (after Graciet and Wellmer 2010 9 ). Tertiary, secondary
More informationSupplemental Data. Fernández-Calvo et al. Plant Cell. (2011) /tpc
Supplemental Data. Fernández-Calvo et al. Plant Cell. (2011). 10.1105/tpc.110.080788 Supplemental Figure S1. Phylogenetic tree of MYC2-related proteins from Arabidopsis and other plants. Phenogram representation
More informationNature Genetics: doi: /ng Supplementary Figure 1. ssp mutant phenotypes in a functional SP background.
Supplementary Figure 1 ssp mutant phenotypes in a functional SP background. (a,b) Statistical comparisons of primary and sympodial shoot flowering times as determined by mean values for leaf number on
More informationCorrect Targeting of Plant ARF GTPases Relies on Distinct Protein Domains
Traffic 2008; 9: 103 120 Blackwell Munksgaard # 2007 The Authors Journal compilation # 2007 Blackwell Publishing Ltd doi: 10.1111/j.1600-0854.2007.00671.x Correct Targeting of Plant ARF GTPases Relies
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2647 Figure S1 Other Rab GTPases do not co-localize with the ER. a, Cos-7 cells cotransfected with an ER luminal marker (either KDEL-venus or mch-kdel) and mch-tagged human Rab5 (mch-rab5,
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature09606 Chen Li-Qing et al. A novel class of sugar transporters. Supplementary Figure 1. Confocal imaging of FRET sensor localization in HEK293T cells. The subcellular localization of the
More informationSupplementary information
Supplementary information Statistical organelle dissection of Arabidopsis guard cells using image database LIPS Takumi Higaki *, Natsumaro Kutsuna, Yoichiroh Hosokawa, Kae Akita, Kazuo Ebine, Takashi Ueda,
More informationSupplementary Figure 1 Structure of the Orai channel. (a) The hexameric Drosophila Orai channel structure derived from crystallography 1 comprises
Supplementary Figure 1 Structure of the Orai channel. (a) The hexameric Drosophila Orai channel structure derived from crystallography 1 comprises six Orai subunits, each with identical amino acid sequences
More informationOverexpression of the Arabidopsis Syntaxin PEP12/SYP21 Inhibits Transport from the Prevacuolar Compartment tothelyticvacuoleinvivo W
The Plant Cell, Vol. 18, 2275 2293, September 2006, www.plantcell.org ª 2006 American Society of Plant Biologists Overexpression of the Arabidopsis Syntaxin PEP12/SYP21 Inhibits Transport from the Prevacuolar
More informationSUPPLEMENTARY INFORMATION
doi:1.138/nature111 cytosol Model: PILS function in cellular auxin homeostasis ER nucleus IAA degradation? sequestration? conjugation? storage? signalling? PILS IAA ER cytosol Supplemental Figure 1 Model
More informationCELB40060 Membrane Trafficking in Animal Cells. Prof. Jeremy C. Simpson. Lecture 2 COPII and export from the ER
CELB40060 Membrane Trafficking in Animal Cells Prof. Jeremy C. Simpson Lecture 2 COPII and export from the ER Today s lecture... The COPII coat - localisation and subunits Formation of the COPII coat at
More informationDiacidic Motifs Influence the Export of Transmembrane Proteins from the Endoplasmic Reticulum in Plant Cells W
This article is published in The Plant Cell Online, The Plant Cell Preview Section, which publishes manuscripts accepted for publication after they have been edited and the authors have corrected proofs,
More informationSupplementary Information
Supplementary Information Structural analysis of leader peptide binding enables leaderfree cyanobactin processing Jesko Koehnke 1,2, Greg Mann 1,2, Andrew F Bent 1,2, Hannes Ludewig 1, Sally Shirran 1,
More informationSupplementary Figure 1. Biochemical and sequence alignment analyses the
Supplementary Figure 1. Biochemical and sequence alignment analyses the interaction of OPTN and TBK1. (a) Analytical gel filtration chromatography analysis of the interaction between TBK1 CTD and OPTN(1-119).
More information4) Please cite Dagda et al J Biol Chem 284: , for any publications or presentations resulting from use or modification of the macro.
Supplement Figure S1. Algorithmic quantification of mitochondrial morphology in SH- SY5Y cells treated with known fission/fusion mediators. Parental SH-SY5Y cells were transiently transfected with an empty
More informationcote cote-yfp spc This work cote cote-yfp spc This work cote cote-yfp spc This work cote cote-yfp spc This work cote cote-yfp spc This work
SUPPLEMENTARY INFORMATION Table S1. List of strains Strains Genotype Source B. subtilis PY79 Prototrophic derivative of B. subtilis 168 (60) RL1070 spovid::kan (12) HS176 cotz phs2 (cotz-gfp spc) (22)
More informationSupplementary Figure 1. Phenotype of the HI strain.
Supplementary Figure 1. Phenotype of the HI strain. (A) Phenotype of the HI and wild type plant after flowering (~1month). Wild type plant is tall with well elongated inflorescence. All four HI plants
More informationSupplementary Figure 1. Real time in vivo imaging of SG secretion. (a) SGs from Drosophila third instar larvae that express Sgs3-GFP (green) and
Supplementary Figure 1. Real time in vivo imaging of SG secretion. (a) SGs from Drosophila third instar larvae that express Sgs3-GFP (green) and Lifeact-Ruby (red) were imaged in vivo to visualize secretion
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Eisner et al., http://www.jcb.org/cgi/content/full/jcb.201312066/dc1 Figure S1. Mitochondrial continuity in adult skeletal muscle. (A)
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature12791 Supplementary Figure 1 (1/3) WWW.NATURE.COM/NATURE 1 RESEARCH SUPPLEMENTARY INFORMATION Supplementary Figure 1 (2/3) 2 WWW.NATURE.COM/NATURE SUPPLEMENTARY
More informationSupplementary Figure 1. SDS-PAGE analysis of GFP oligomer variants with different linkers. Oligomer mixtures were applied to a PAGE gel containing
Supplementary Figure 1. SDS-PAGE analysis of GFP oligomer variants with different linkers. Oligomer mixtures were applied to a PAGE gel containing 0.1% SDS without boiling. The gel was analyzed by a fluorescent
More information7.06 Cell Biology EXAM #3 KEY
7.06 Cell Biology EXAM #3 KEY May 2, 2006 This is an OPEN BOOK exam, and you are allowed access to books, a calculator, and notes BUT NOT computers or any other types of electronic devices. Please write
More informationPredominant Golgi Residency of the Plant K/HDEL Receptor Is Essential for its Function in Mediating ER Retention
Plant Cell Advance Publication. Published on August 2, 2018, doi:10.1105/tpc.18.00426 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41
More informationGolgi-Dependent Transport of Vacuolar Sorting Receptors Is Regulated by COPII, AP1, and AP4 Protein Complexes in Tobacco W OPEN
The Plant Cell, Vol. 26: 1308 1329, March 2014, www.plantcell.org ã 2014 American Society of Plant Biologists. All rights reserved. Golgi-Dependent Transport of Vacuolar Sorting Receptors Is Regulated
More informationPenghui Li, Beibei Chen, Gaoyang Zhang, Longxiang Chen, Qiang Dong, Jiangqi Wen, Kirankumar S. Mysore and Jian Zhao
New Phytologist Supporting Information Regulation of anthocyanin and proanthocyanidin biosynthesis by Medicago truncatula bhlh transcription factor MtTT8 Penghui Li, Beibei Chen, Gaoyang Zhang, Longxiang
More informationImportance of Protein sorting. A clue from plastid development
Importance of Protein sorting Cell organization depend on sorting proteins to their right destination. Cell functions depend on sorting proteins to their right destination. Examples: A. Energy production
More informationMolecular Cell Biology 5068 In Class Exam 1 September 30, Please print your name:
Molecular Cell Biology 5068 In Class Exam 1 September 30, 2014 Exam Number: Please print your name: Instructions: Please write only on these pages, in the spaces allotted and not on the back. Write your
More information!"#$%&'%()*%+*,,%-&,./*%01%02%/*/3452*%3&.26%&4752*,,*1%%
!"#$%&'%()*%+*,,%-&,./*%01%02%/*/3452*%3&.26%&4752*,,*1%% !"#$%&'(")*++*%,*'-&'./%/,*#01#%-2)#3&)/% 4'(")*++*% % %5"0)%-2)#3&) %%% %67'2#72'*%%%%%%%%%%%%%%%%%%%%%%%4'(")0/./% % 8$+&'&,+"/7 % %,$&7&/9)7$*/0/%%%%%%%%%%
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3267 Supplementary Figure 1 A group of genes required for formation or orientation of annular F-actin bundles and aecm ridges: RNAi phenotypes and their validation by standard mutations.
More informationSupplemental Data. Nayak et al. (2013). Plant Cell /tpc
Start - End Observed Mr(expt) Mr(calc) Delta Sequence 1 13 468.8413 1403.5020 1403.7330-0.2309 MPSLMLSDKKEEK.K 19-29 610.1743 1218.3341 1218.5802-0.2461 K.MLDTPELDSK.K 85-102 663.33433343 1986.98109810
More informationNature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Quantitation of the binding of pro53 peptide to sorla Vps10p measured by the AP reporter assay. The graph shows tracings of the typical chromogenic AP reaction observed with AP-pro53
More informationSerine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition
Supplementary Information to Serine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition Nadine Czudnochowski 1,2, *, Christian A. Bösken 1, * & Matthias Geyer 1 1 Max-Planck-Institut
More informationTrans-Golgi Network-Located AP1 Gamma Adaptins Mediate Dileucine Motif-Directed Vacuolar Targeting in Arabidopsis C W
The Plant Cell, Vol. 26: 4102 4118, October 2014, www.plantcell.org ã 2014 American Society of Plant Biologists. All rights reserved. Trans-Golgi Network-Located AP1 Gamma Adaptins Mediate Dileucine Motif-Directed
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2362 Figure S1 CYLD and CASPASE 8 genes are co-regulated. Analysis of gene expression across 79 tissues was carried out as described previously [Ref: PMID: 18636086]. Briefly, microarray
More informationProtein Sorting, Intracellular Trafficking, and Vesicular Transport
Protein Sorting, Intracellular Trafficking, and Vesicular Transport Noemi Polgar, Ph.D. Department of Anatomy, Biochemistry and Physiology Email: polgar@hawaii.edu Phone: 692-1422 Outline Part 1- Trafficking
More informationGenome-wide multilevel spatial interactome model of rice
Sino-German Workshop on Multiscale Spatial Computational Systems Biology, Beijing, Oct 8-12, 2015 Genome-wide multilevel spatial interactome model of rice Ming CHEN ( 陈铭 ) mchen@zju.edu.cn College of Life
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature10244 a O07391_MYCAV/127-243 NLPC_HAEIN/80-181 SPR_SHIFL/79-183 P74160_SYNY3/112-245 O24914_HELPY/301-437 Q51835_PORGI/68-178 DPP6_BACSH/163-263 YKFC_BACSU/185-292 YDHO_ECOLI/153-263
More informationSecretory Bulk Flow of Soluble Proteins Is Efficient and COPII Dependent
The Plant Cell, Vol. 13, 2005 2020, September 2001, www.plantcell.org 2001 American Society of Plant Biologists Secretory Bulk Flow of Soluble Proteins Is Efficient and COPII Dependent Belinda A. Phillipson,
More information7.06 Problem Set
7.06 Problem Set 5 -- 2006 1. In the first half of the course, we encountered many examples of proteins that entered the nucleus in response to the activation of a cell-signaling pathway. One example of
More informationA Genome-Wide Analysis of Arabidopsis Rop-Interactive CRIB Motif Containing Proteins That Act as Rop GTPase Targets
The Plant Cell, Vol. 13, 2841 2856, December 2001, www.plantcell.org 2001 American Society of Plant Biologists A Genome-Wide Analysis of Arabidopsis Rop-Interactive CRIB Motif Containing Proteins That
More informationtargets. clustering show that different complex pathway
Supplementary Figure 1. CLICR allows clustering and activation of cytoplasmic protein targets. (a, b) Upon light activation, the Cry2 (red) and LRP6c (green) components co-cluster due to the heterodimeric
More informationSupporting information for
Supporting information for Rewiring multi-domain protein switches: transforming a fluorescent Zn 2+ -sensor into a light-responsive Zn 2+ binding protein Stijn J.A. Aper and Maarten Merkx Laboratory of
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature10955 Supplementary Figures Supplementary Figure 1. Electron-density maps and crystallographic dimer structures of the motor domain. (a f) Stereo views of the final electron-density maps
More informationSupplemental Information. Molecular Basis of Spectral Diversity. in Near-Infrared Phytochrome-Based. Fluorescent Proteins
Chemistry & Biology, Volume 22 Supplemental Information Molecular Basis of Spectral Diversity in Near-Infrared Phytochrome-Based Fluorescent Proteins Daria M. Shcherbakova, Mikhail Baloban, Sergei Pletnev,
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/1121356/dc1 Supporting Online Material for Polar PIN Localization Directs Auxin Flow in Plants Justyna Wiśniewska, Jian Xu, Daniela Seifertová, Philip B. Brewer, Kamil
More informationdownstream (0.8 kb) homologous sequences to the genomic locus of DIC. A DIC mutant strain (ro- 6
A B C D ts Figure S1 Generation of DIC- mcherry expressing N.crassa strain. A. N. crassa colony morphology. When a cot1 (top, left panel) strain is grown at permissive temperature (25 C), it exhibits straight
More informationReconstructing Mitochondrial Evolution?? Morphological Diversity. Mitochondrial Diversity??? What is your definition of a mitochondrion??
Reconstructing Mitochondrial Evolution?? What is your definition of a mitochondrion?? Morphological Diversity Mitochondria as we all know them: Suprarenal gland Liver cell Plasma cell Adrenal cortex Mitochondrial
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. Purification of yeast CKM. (a) Silver-stained SDS-PAGE analysis of CKM purified through a TAP-tag engineered into the Cdk8 C-terminus. (b) Kinase activity
More informationSUPPLEMENTARY INFORMATION
GP2 Type I-piliated bacteria FAE M cell M cell pocket idc T cell mdc Generation of antigenspecific T cells Induction of antigen-specific mucosal immune response Supplementary Figure 1 Schematic diagram
More informationComputational Biology, Part 24 Clustering and Unmixing of Subcellular Patterns
Computational Biology, Part 24 Clustering and Unmixing of Subcellular Patterns Robert F. Murphy Copyright 1996, 1999, 2000-2009. All rights reserved. Unsupervised Learning to Identify High-Resolution Protein
More informationSupplemental Table 1. Primers used for cloning and PCR amplification in this study
Supplemental Table 1. Primers used for cloning and PCR amplification in this study Target Gene Primer sequence NATA1 (At2g393) forward GGG GAC AAG TTT GTA CAA AAA AGC AGG CTT CAT GGC GCC TCC AAC CGC AGC
More informationDivision Ave. High School AP Biology
Tour of the Cell 1 Types of cells Prokaryote bacteria cells - no organelles - organelles Eukaryote animal cells Eukaryote plant cells Why organelles? Specialized structures u specialized functions cilia
More informationSupplementary Figure 1.
Supplementary Figure 1. Characterisation of IHG-1 overexpressing and knockdown cell lines. (A) Total cellular RNA was prepared from HeLa cells stably overexpressing IHG-1 or mts-ihg-1. IHG-1 mrna was quantified
More informationPurification, SDS-PAGE and cryo-em characterization of the MCM hexamer and Cdt1 MCM heptamer samples.
Supplementary Figure 1 Purification, SDS-PAGE and cryo-em characterization of the MCM hexamer and Cdt1 MCM heptamer samples. (a-b) SDS-PAGE analysis of the hexamer and heptamer samples. The eluted hexamer
More informationSupplemental Data. Yamamoto et al. (2016). Plant Cell /tpc WT + HCO 3. slac1-4/δnc #5 + HCO 3 WT + ABA. slac1-4/δnc #5 + ABA
I (pa) I (pa) A WT + HCO 3 B 2 V (mv) 15 1 5 5 2 slac14/δnc #5 + HCO 3 4 6 WT (n = 6) 8 WT + HCO 3 (n = 7) slac14/δnc #5 (n = 6) slac14/δnc #5 + HCO 3 (n = 1) C WT + ABA D 2 V (mv) 15 1 5 5 2 slac14/δnc
More informationTUTORIAL EXERCISES WITH ANSWERS
TUTORIAL EXERCISES WITH ANSWERS Tutorial 1 Settings 1. What is the exact monoisotopic mass difference for peptides carrying a 13 C (and NO additional 15 N) labelled C-terminal lysine residue? a. 6.020129
More informationTable S1 List of primers used for genotyping and qrt-pcr.
Table S1 List of primers used for genotyping and qrt-pcr. genotyping! allele! ligomer*! 5'-sequence-3'! rice! d10-2! F! TTGGCTTTGCCTCGTTTC!!! R! AGCCTCCACTTGTACTGTG! Arabidopsis! max2-3, max2-4! F! ACTCTCTCCGACCTCCCTGACG!!!
More informationSupplementary material
Supplementary material Phosphorylation of the mitochondrial autophagy receptor Nix enhances its interaction with LC3 proteins Vladimir V. Rogov 1,*, Hironori Suzuki 2,3,*, Mija Marinković 4, Verena Lang
More informationCks1 CDK1 CDK1 CDK1 CKS1. are ice- lobe. conserved. conserved
Cks1 d CKS1 Supplementary Figure 1 The -Cks1 crystal lattice. (a) Schematic of the - Cks1 crystal lattice. -Cks1 crystallizes in a lattice that contains c 4 copies of the t - Cks1 dimer in the crystallographic
More informationYeast ORFan Gene Project: Module 5 Guide
Cellular Localization Data (Part 1) The tools described below will help you predict where your gene s product is most likely to be found in the cell, based on its sequence patterns. Each tool adds an additional
More informationWatanabe'et'al.' Supplementary'Figure'1'
MW IN O 80 2 IN O 80 SW 3 R -C 3 MW SW R -C SW 1 R -C 2 IN O 80 1 Supplementary'Figure'1' Supplementary Figure 1. SDS-PAGE image of INO80-C and SWR-C. Three independent preparations of each TAP-tagged
More informationSUPPLEMENTARY INFORMATION
DOI:.38/ncb97 P ( μm, hours) 1 2 4 P DMSO Figure S1 unningham et al. E 97 65 27 MFN1 GFP-Parkin Opa1 ctin GPDH HEK293 GFP-Parkin 19 115 97 65 27 Mitochondrial Fraction SH-SY5Y GFP-Parkin Mito DMSO Mito
More informationSupplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R)
Supplementary Figure 1 Crystal contacts in COP apo structure (PDB code 3S0R) Shown in cyan and green are two adjacent tetramers from the crystallographic lattice of COP, forming the only unique inter-tetramer
More informationSupplemental Data. Wang et al. (2014). Plant Cell /tpc
Supplemental Figure1: Mock and NPA-treated tomato plants. (A) NPA treated tomato (cv. Moneymaker) developed a pin-like inflorescence (arrowhead). (B) Comparison of first and second leaves from mock and
More information** LCA LCN PCA
% of wild type value % of wild type value a 12 1 8 2 b 12 1 8 2 LCA LCN PCA Col- sod3-1 Supplementary Figure 1 sod3-1 influences cell proliferation. (a) Fifth leaf cell area (LCA) and leaf cell number
More informationSupplementary Information. The protease GtgE from Salmonella exclusively targets. inactive Rab GTPases
Supplementary Information The protease GtgE from Salmonella exclusively targets inactive Rab GTPases Table of Contents Supplementary Figures... 2 Supplementary Figure 1... 2 Supplementary Figure 2... 3
More informationSupplementary Materials for
www.advances.sciencemag.org/cgi/content/full/1/5/e1500358/dc1 Supplementary Materials for Transplantability of a circadian clock to a noncircadian organism Anna H. Chen, David Lubkowicz, Vivian Yeong,
More informationNewly made RNA is called primary transcript and is modified in three ways before leaving the nucleus:
m Eukaryotic mrna processing Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus: Cap structure a modified guanine base is added to the 5 end. Poly-A tail
More information. Supplementary Information
. Supplementary Information Supplementary Figure S1. Mature embryo sac observations. Supplementary Figure S2. STT observations. Supplementary Figure S3. Comparison of the PTB1 cdna with that of the mutant.
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Breker et al., http://www.jcb.org/cgi/content/full/jcb.201301120/dc1 Figure S1. Single-cell proteomics of stress responses. (a) Using
More informationName: TF: Section Time: LS1a ICE 5. Practice ICE Version B
Name: TF: Section Time: LS1a ICE 5 Practice ICE Version B 1. (8 points) In addition to ion channels, certain small molecules can modulate membrane potential. a. (4 points) DNP ( 2,4-dinitrophenol ), as
More informationSchool of Life Sciences, Centre for Cell and Developmental Biology, Chinese University of Hong Kong, Shatin, New Territories, Hong Kong, China b
The Plant Cell, Vol. 22: 4009 4030, December 2010, www.plantcell.org ã 2010 American Society of Plant Biologists EXPO, an Exocyst-Positive Organelle Distinct from Multivesicular Endosomes and Autophagosomes,
More informationRon et al SUPPLEMENTAL DATA
Ron et al SUPPLEMENTAL DATA Hairy root transformation using Agrobacterium rhizogenes as a tool for exploring cell type-specific gene expression and function using tomato as a model Mily Ron, Kaisa Kajala,
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/6/301/ra98/dc1 Supplementary Materials for Regulation of Epithelial Morphogenesis by the G Protein Coupled Receptor Mist and Its Ligand Fog Alyssa J. Manning,
More informationSUPPLEMENTARY INFORMATION
Fig. 1 Influences of crystal lattice contacts on Pol η structures. a. The dominant lattice contact between two hpol η molecules (silver and gold) in the type 1 crystals. b. A close-up view of the hydrophobic
More informationArabidopsis thaliana High-Affinity Phosphate Transporters Exhibit Multiple Levels of Posttranslational Regulation C W
The Plant Cell, Vol. 23: 1523 1535, April 2011, www.plantcell.org ã 2011 American Society of Plant Biologists Arabidopsis thaliana High-Affinity Phosphate Transporters Exhibit Multiple Levels of Posttranslational
More informationStructure and RNA-binding properties. of the Not1 Not2 Not5 module of the yeast Ccr4 Not complex
Structure and RNA-binding properties of the Not1 Not2 Not5 module of the yeast Ccr4 Not complex Varun Bhaskar 1, Vladimir Roudko 2,3, Jerome Basquin 1, Kundan Sharma 4, Henning Urlaub 4, Bertrand Seraphin
More informationTable S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1.
Table S1. Overview of used PDZK1 constructs and their binding affinities to peptides. Related to figure 1. PDZK1 constru cts Amino acids MW [kda] KD [μm] PEPT2-CT- FITC KD [μm] NHE3-CT- FITC KD [μm] PDZK1-CT-
More informationChapter 12: Intracellular sorting
Chapter 12: Intracellular sorting Principles of intracellular sorting Principles of intracellular sorting Cells have many distinct compartments (What are they? What do they do?) Specific mechanisms are
More informationJMJ14-HA. Col. Col. jmj14-1. jmj14-1 JMJ14ΔFYR-HA. Methylene Blue. Methylene Blue
Fig. S1 JMJ14 JMJ14 JMJ14ΔFYR Methylene Blue Col jmj14-1 JMJ14-HA Methylene Blue Col jmj14-1 JMJ14ΔFYR-HA Fig. S1. The expression level of JMJ14 and truncated JMJ14 with FYR (FYRN + FYRC) domain deletion
More informationA synthetic oscillatory network of transcriptional regulators
A synthetic oscillatory network of transcriptional regulators Michael B. Elowitz & Stanislas Leibler, Nature, 403, 2000 igem Team Heidelberg 2008 Journal Club Andreas Kühne Introduction Networks of interacting
More informationSupplementary Figure 1
Supplementary Figure 1 Supplementary Figure 1. HSP21 expression in 35S:HSP21 and hsp21 knockdown plants. (a) Since no T- DNA insertion line for HSP21 is available in the publicly available T-DNA collections,
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature12242 C. thermophilum 666 RPAVLDNVYIRPALE-GKRVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNIRHLFFQPCQN S. pombe 659 RPAHINDVYVRPAID-GKRLPGFIEIHQNGIRYQSPLRSDSHIDLLFSNMKHLFFQPCEG
More informationSupplemental Information. The Mitochondrial Fission Receptor MiD51. Requires ADP as a Cofactor
Structure, Volume 22 Supplemental Information The Mitochondrial Fission Receptor MiD51 Requires ADP as a Cofactor Oliver C. Losón, Raymond Liu, Michael E. Rome, Shuxia Meng, Jens T. Kaiser, Shu-ou Shan,
More informationLaboratory of Plant Physiology and Biophysics, University of Glasgow, Glasgow G12 8QQ, United Kingdom b
This article is a Plant Cell Advance Online Publication. The date of its first appearance online is the official date of publication. The article has been edited and the authors have corrected proofs,
More informationCover Page. The handle holds various files of this Leiden University dissertation
Cover Page The handle http://hdl.handle.net/1887/41480 holds various files of this Leiden University dissertation Author: Tleis, Mohamed Title: Image analysis for gene expression based phenotype characterization
More informationTransmembrane Domains (TMDs) of ABC transporters
Transmembrane Domains (TMDs) of ABC transporters Most ABC transporters contain heterodimeric TMDs (e.g. HisMQ, MalFG) TMDs show only limited sequence homology (high diversity) High degree of conservation
More informationA single lysine in the N-terminal region of store-operated channels is critical for STIM1-mediated gating
Published Online: 29 November, 2010 Supp Info: http://doi.org/10.1085/jgp.201010484 Downloaded from jgp.rupress.org on December 25, 2018 A r t i c l e A single lysine in the N-terminal region of store-operated
More informationQuantitative and Qualitative Analysis of Plant Membrane TraYc Using Fluorescent Proteins
Comp. by: aaruldurai Date://0 Time::: Stage:First Proof File Path://pchns0/WOMAT/ Production/PRODENV/000000000/000000/00000000/0000.D Proof by: QC by: ProjectAcronym:bs:MCB Volume:0 0 0 CHAPTER Quantitative
More informationTHE CRYSTAL STRUCTURE OF THE SGT1-SKP1 COMPLEX: THE LINK BETWEEN
THE CRYSTAL STRUCTURE OF THE SGT1-SKP1 COMPLEX: THE LINK BETWEEN HSP90 AND BOTH SCF E3 UBIQUITIN LIGASES AND KINETOCHORES Oliver Willhoft, Richard Kerr, Dipali Patel, Wenjuan Zhang, Caezar Al-Jassar, Tina
More informationTNFα 18hr. Control. CHX 18hr. TNFα+ CHX 18hr. TNFα: 18 18hr (KDa) PARP. Cleaved. Cleaved. Cleaved. Caspase3. Pellino3 shrna. Control shrna.
Survival ( %) a. TNFα 18hr b. Control sirna Pellino3 sirna TNFα: 18 18hr c. Control shrna Pellino3 shrna Caspase3 Actin Control d. Control shrna Pellino3 shrna *** 100 80 60 CHX 18hr 40 TNFα+ CHX 18hr
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11085 Supplementary Tables: Supplementary Table 1. Summary of crystallographic and structure refinement data Structure BRIL-NOP receptor Data collection Number of crystals 23 Space group
More informationSupplemental Data. Chen and Thelen (2010). Plant Cell /tpc
Supplemental Data. Chen and Thelen (2010). Plant Cell 10.1105/tpc.109.071837 1 C Total 5 kg 20 kg 100 kg Transmission Image 100 kg soluble pdtpi-gfp Plastid (PDH-alpha) Mito (PDH-alpha) GFP Image vector
More informationLeucine-rich repeat receptor-like kinases (LRR-RLKs), HAESA, ERECTA-family
Leucine-rich repeat receptor-like kinases (LRR-RLKs), HAESA, ERECTA-family GENES & DEVELOPMENT (2000) 14: 108 117 INTRODUCTION Flower Diagram INTRODUCTION Abscission In plant, the process by which a plant
More information