hsn.uk.net Page Circles Paper1SectionA Each correct answer in this section is worth two marks.

Similar documents
Circle. Paper 1 Section A. Each correct answer in this section is worth two marks. 5. A circle has equation. 4. The point P( 2, 4) lies on the circle

Circles. hsn.uk.net. Contents. Circles 1

hsn.uk.net Page 1 Circle Find the equation of the tangent at the point (3, 4) on the circle x 2 +y 2 +2x 4y 15 =0. 4 Higher Mathematics

NAME: Date: HOMEWORK: C1. Question Obtained. Total/100 A 80 B 70 C 60 D 50 E 40 U 39

y hsn.uk.net Straight Line Paper 1 Section A Each correct answer in this section is worth two marks.

5 Find an equation of the circle in which AB is a diameter in each case. a A (1, 2) B (3, 2) b A ( 7, 2) B (1, 8) c A (1, 1) B (4, 0)

Circles, Mixed Exercise 6

Edexcel New GCE A Level Maths workbook Circle.

Recurrence Relations. Each correct answer in this section is worth two marks.

1.4 Recurrence Relations

Integration Past Papers Unit 2 Outcome 2

Additional Mathematics Lines and circles

Vectors. Paper 1 Section A. Each correct answer in this section is worth two marks. 4. The point B has coordinates

DISCRIMINANT EXAM QUESTIONS

Core Mathematics 2 Coordinate Geometry

Prelim practice. Part Marks Level Calc. Content Answer U1 OC1 3 C CR G2 1992P1Q13

1 k. cos tan? Higher Maths Non Calculator Practice Practice Paper A. 1. A sequence is defined by the recurrence relation u 2u 1, u 3.

National Quali cations

The gradient of the radius from the centre of the circle ( 1, 6) to (2, 3) is: ( 6)

S56 (5.3) Recurrence Relations.notebook September 09, 2015

3.1 Vectors. Each correct answer in this section is worth two marks.

Exam Revision. y B A E. Find the coordinates of E, the point of intersection of the diagonals. 3

CBSE X Mathematics 2012 Solution (SET 1) Section B

National Quali cations

Recognise the Equation of a Circle. Solve Problems about Circles Centred at O. Co-Ordinate Geometry of the Circle - Outcomes

Ch 10 Review. Multiple Choice Identify the choice that best completes the statement or answers the question.

Review exercise 2. 1 The equation of the line is: = 5 a The gradient of l1 is 3. y y x x. So the gradient of l2 is. The equation of line l2 is: y =

Old Past Papers- Differentiation. Part Marks Level Calc. Content Answer U1 OC3 4 C NC G2,C4 (2,4) 2002P1Q4. 1 dy dx

Higher Mathematics. Exam Revision. Questions marked [SQA] c SQA All others c Higher Still Notes. hsn.uk.net Page 1

National Quali cations

The CENTRE for EDUCATION in MATHEMATICS and COMPUTING cemc.uwaterloo.ca Euclid Contest. Wednesday, April 15, 2015

Circles - Edexcel Past Exam Questions. (a) the coordinates of A, (b) the radius of C,

CIRCLES, CHORDS AND TANGENTS

2. (i) Find the equation of the circle which passes through ( 7, 1) and has centre ( 4, 3).

chapter 1 vector geometry solutions V Consider the parallelogram shown alongside. Which of the following statements are true?

DEPARTMENT OF MATHEMATICS

PhysicsAndMathsTutor.com

Edexcel New GCE A Level Maths workbook

Sample Paper from Solomon Press Time: 1 hour 30 minutes

Preliminary Mathematics

Higher Mathematics 2009 v C8,C9 cn

*X100/301* X100/301 MATHEMATICS HIGHER. Units 1, 2 and 3 Paper 1 (Non-calculator) Read Carefully

Q1. If (1, 2) lies on the circle. x 2 + y 2 + 2gx + 2fy + c = 0. which is concentric with the circle x 2 + y 2 +4x + 2y 5 = 0 then c =

SYSTEM OF CIRCLES OBJECTIVES (a) Touch each other internally (b) Touch each other externally

WEDNESDAY, 18 MAY 9.00 AM AM. 1 Full credit will be given only where the solution contains appropriate working.


WEDNESDAY, 20 MAY 9.00 AM AM

SYSTEM OF CIRCLES If d is the distance between the centers of two intersecting circles with radii r 1, r 2 and θ is the

Pure Mathematics Year 1 (AS) Unit Test 1: Algebra and Functions

Created by T. Madas VECTOR PRACTICE Part B Created by T. Madas

CBSE Class IX Mathematics Term 1. Time: 3 hours Total Marks: 90. Section A

Paper collated from year 2007 Content Pure Chapters 1-13 Marks 100 Time 2 hours

QUESTION BANK ON STRAIGHT LINE AND CIRCLE

1. In a triangle ABC altitude from C to AB is CF= 8 units and AB has length 6 units. If M and P are midpoints of AF and BC. Find the length of PM.

Add Math (4047/02) Year t years $P

Sample Aptitude Test Questions

DEPARTMENT OF MATHEMATICS

the coordinates of C (3) Find the size of the angle ACB. Give your answer in degrees to 2 decimal places. (4)

Cambridge International Examinations Cambridge Ordinary Level

e x for x 0. Find the coordinates of the point of inflexion and justify that it is a point of inflexion. (Total 7 marks)

Mathematics Extension 1

Calculus With Analytic Geometry by SM. Yusaf & Prof.Muhammad Amin

Christmas Calculated Colouring - C1

Equation of a Straight Line (H)

NATIONAL QUALIFICATIONS

P1 Chapter 6 :: Circles

2. In ABC, the measure of angle B is twice the measure of angle A. Angle C measures three times the measure of angle A. If AC = 26, find AB.

KENDRIYA VIDYALAYA SANGATHAN, HYDERABAD REGION

SOLUTIONS SECTION A [1] = 27(27 15)(27 25)(27 14) = 27(12)(2)(13) = cm. = s(s a)(s b)(s c)

Math : Analytic Geometry

Differentiation Past Papers Unit 1 Outcome 3

St Andrew s Academy Mathematics Department Higher Mathematics VECTORS

Right Triangles

Higher Mathematics Course Notes

2016 SEC 4 ADDITIONAL MATHEMATICS CW & HW

Cambridge International Examinations Cambridge Ordinary Level

(D) (A) Q.3 To which of the following circles, the line y x + 3 = 0 is normal at the point ? 2 (A) 2

H I G H E R M A T H S. Practice Unit Tests (2010 on) Higher Still Higher Mathematics M A T H E M A T I C S. Contents & Information

Question 1 ( 1.0 marks) places of decimals? Solution: Now, on dividing by 2, we obtain =

Old Past Papers- Polynomials

Polynomials and Quadratics

(b) the equation of the perpendicular bisector of AB. [3]

International General Certificate of Secondary Education CAMBRIDGE INTERNATIONAL EXAMINATIONS PAPER 2 MAY/JUNE SESSION 2002

CBSE Board Class X Mathematics Board Paper 2015

Possible C2 questions from past papers P1 P3

Sample Question Paper Mathematics First Term (SA - I) Class IX. Time: 3 to 3 ½ hours

0811ge. Geometry Regents Exam BC, AT = 5, TB = 7, and AV = 10.

STEP Support Programme. STEP 2 Complex Numbers: Solutions

Here is a link to the formula booklet:

2016 AMC 12A. 3 The remainder can be defined for all real numbers x and y with y 0 by x rem(x,y) = x y y

VAISHALI EDUCATION POINT (QUALITY EDUCATION PROVIDER)

King Fahd University of Petroleum and Minerals Prep-Year Math Program Math (001) - Term 181 Recitation (1.1)

1 Line n intersects lines l and m, forming the angles shown in the diagram below. 4 In the diagram below, MATH is a rhombus with diagonals AH and MT.

TARGET : JEE 2013 SCORE. JEE (Advanced) Home Assignment # 03. Kota Chandigarh Ahmedabad

Maharashtra Board Class X Mathematics - Geometry Board Paper 2014 Solution. Time: 2 hours Total Marks: 40

Name: Teacher: GRADE 11 EXAMINATION NOVEMBER 2016 MATHEMATICS PAPER 2 PLEASE READ THE FOLLOWING INSTRUCTIONS CAREFULLY

Maths Higher Prelim Content

1.30 pm 2.30 pm. Mathematics Module M4 Paper 1 (Non-calculator) Higher Tier [GMM41] 1 hour.

EdExcel Further Pure 2

Draft Version 1 Mark scheme Further Maths Core Pure (AS/Year 1) Unit Test 1: Complex numbers 1

Transcription:

2.4 Circles Paper1SectionA Each correct answer in this section is worth two marks. 1.Thepoint (2, 3)liesonthecircle with equation x 2 +y 2 +6x 2y +c =0. Whatisthevalueofc? A. 31 B. 13 C. 1 3. The point P(2, 3) lies on the circle with centre C as shown.the gradient of CP is 2.What is the equation of thetangentatp? C y O P(2, 3) x D. 9 A. y +3 = 2(x 2) B. y 3 = 2(x +2) C. y +3 = 1 2 (x 2) D. y 3 = 1 2 (x +2) 2.Acirclehascentre (2,4)andpasses through ( 1, 1). Whatistheequationofthecircle? A. (x 2) 2 + (y 4) 2 = 18 4.ThepointP( 2,4)liesonthecircle with equation x 2 +y 2 2x +2y 32 =0. Whatisthegradientofthetangent tothecircleatp? A. 1 3 B. (x 2) 2 + (y 4) 2 =18 C. (x +2) 2 + (y +4) 2 =18 D. (x +2) 2 + (y +4) 2 =26 hsn.uk.net Page 1 B. 3 5 C. 1 D. 3 Questions marked c SQA

5.Acirclehasequation (x +1) 2 + (y 2) 2 =29. Whatisthegradientofthetangent tothecircleatthepoint (1, 3)? A. 2 5 B. 0 C. 5 2 D. 1 2 8.Acirclehasequation x 2 +y 2 2x 4y +1 =0. Here are two statements about the circle: I.Thecirclehascentre ( 2, 4). II.Thecirclehasradius1. Which of the following is true? A. neither statement is correct B. only statement I is correct C. only statement II is correct D. both statements are correct 6.Thelinewithequationy =2x intersects the circle with equation x 2 +y 2 =5atthepointsJandK. Whatarethex-coordinatesofJand K? A. x J =1,x K = 1 B. x J =2,x K = 2 C. x J =1,x K = 2 D. x J = 1,x K =2 7.Acirclehasequation x 2 +y 2 +8x +6y 75 =0. Whatistheradiusofthecircle? A. 5 B. 10 9.Acirclehasequation x 2 +y 2 4x +6y +4 =0. Here are two statements about the circle: I.Thecirclehascentre ( 2,3). II.Thecirclehasradius3units. Which of the following is true? A. neither statement is correct B. only statement I is correct C. 75 C. only statement II is correct D. 175 hsn.uk.net Page 2 D. both statements are correct Questions marked c SQA

10. A circle has equation x 2 +y 2 ax +2by +c =0.The centreofthecircleis ( 1,4). Whatarethevaluesofaandb? a b A. 2 4 B. 1 2 C. 2 4 D. 2 4 11. A circle has equation (x 3) 2 + (y +4) 2 =20. Findthegradientofthetangentto thecircleatthepoint (1,0). A. 2 B. 1 2 C. 1 2 13.Theequationofthecircleshownin the diagram is x 2 +y 2 6x 10y +9 =0.The x-axisandthelinelareparallel tangents to the circle. y O Whatistheequationoflinel? A. y =5 B. y =10 C. y =18 D. y =20 l x D. 2 12.Acirclehascentre (2, 1),andhas they-axisasatangent. Whatistheequationofthecircle? A. (x +2) 2 + (y 1) 2 =4 B. (x 2) 2 + (y +1) 2 =4 C. (x +2) 2 + (y 1) 2 =1 D. (x 2) 2 + (y +1) 2 =1 14.Whatisthelargestrangeofvalues ofkforwhichtheequation x 2 +y 2 6x +4y +k =0represents acircle? A. k <52 B. k <13 C. k > 13 D. Allrealk hsn.uk.net Page 3 Questions marked c SQA

[ENDOFPAPER1SECTIONA] Paper1SectionB 15. The diagram below shows the graph of the cubic with equation y =x 3 3x 2 +5x +4andacirclewith centre C. AtthepointPthelinelisatangentto boththecurveandthecircle. (a)thetangentline l hasgradient 2. Find the coordinates of P. Q 5 (b) The circle has equation l O x x 2 +y 2 14x 8y +c =0. 2 Determine the value of c. (c)the line PQ is a diameter of the circle. Determine the coordinates ofq. 2 y y =x 3 3x 2 +5x +4 P C 16.Acirclehasequationx 2 +y 2 ax +2by +c =0,wherea,bandcareconstants. (a)giventhatthecentreofthecircleis ( 1,4),determinethevaluesofaandb. 2 (b)giventhatthepoint (5,4)liesonthecircle,determinethevalueofc. 2 17.AcirclehasP(0,1)andQ( 10,9)asendpointsofitsdiameter. Find the equation of this circle. 3 18.Findtheequationofthecirclecentredat (1, 3)andpassingthrough (7,5). Determine whether or not the point (8, 4) lies within this circle. 3 19. CirclePhasequationx 2 +y 2 8x 10y +9 =0. CircleQhascentre ( 2, 1) andradius2 2. (a) (i)showthattheradiusofcirclepis4 2. (ii)henceshowthatcirclespandqtouch. 4 (b)findtheequationofthetangenttothecircleqatthepoint ( 4,1). 3 (c)thetangentin(b)intersectscirclepintwopoints.findthex-coordinatesof thepointsofintersection,expressingyouanswersintheforma ±b 3. 3 hsn.uk.net Page 4 Questions marked c SQA

20. ThepointP(2,3)liesonthecircle (x +1) 2 + (y 1) 2 =13.Findtheequationof thetangentatp. 4 21.Acirclehasequationx 2 +y 2 8x +6y +15 =0. FindtheequationofthetangenttothecircleatthepointA(1, 2). 4 22. (a)find the equation of the line which passes through ( 1, 4) and is perpendiculartothelinewithequationx +3y =2. 3 (b)showthatthelinedoesnotintersectthecirclewithequation (x 2) 2 + (y +3) 2 =6. 3 23.Forwhichvaluesofkisthelinewithequationy= 3 4 x +katangenttothecircle withequationx 2 +y 2 =16? 5 24. The points A and B have coordinates (6, 8) and (18, 8) respectively. (a)findtheequationofl,theperpendicularbisectorofab. 4 (b)showthatlisatangenttothecirclewithequationx 2 +y 2 2x +4y 20 =0 and find the coordinates of the point of contact. 6 25.Forwhichvaluesofkdoestheequationx 2 +y 2 +10x 14y +k =0representa circle? 3 26.Findtherangeofvaluesofkforwhichtheequationx 2 +y 2 kx (k+1)y+ 5 4 =0 represents a circle. 6 27. Forwhatrangeofvaluesofkdoestheequationx 2 +y 2 +4kx 2ky k 2 =0 represent a circle? 5 28.Thecirclewithcentre (8,a)passesthroughthepoints (3,3)and (5,1). Findthevalueofaandhencefindtheequationofthecircle. 5 hsn.uk.net Page 5 Questions marked c SQA

29. (a)findtheradiusandequationofthecirclecentredattheoriginandpassing through the point (3, 4). 2 (b) Determine whether the point (8, 5) lies inside, outside or on this circle. 2 30.Findtherangeofvaluesofkforwhich2x 2 +2y 2 6x +4y +k =0representsa circle. 4 [ENDOFPAPER1SECTIONB] hsn.uk.net Page 6 Questions marked c SQA

Paper 2 1. Find the equation of the tangent at the point (3, 4) on the circle x 2 +y 2 +2x 4y 15 =0. 4 2. Triangle ABC has vertices A(2, 2), B(12, 2) and C(8, 6). (a)writedowntheequationofl 1, the perpendicular bisector of AB. 1 A(2, 2) B(12, 2) (b)find the equation of l 2, the perpendicular bisector of AC. O x 4 (c) Find the point of intersection of linesl 1 andl 2. 1 (d)hencefindtheequationofthe circle passing through A, B and C. 2 y C(8, 6) 3. (a) Find the equation of AB, the perpendicular bisector of the line y Q(1, 9) joing the points P( 3,1) and Q(1,9). A 4 (b)cisthecentreofacirclepassing throughpandq.giventhatqcis parallel to the y-axis, determine the C equation of the circle. 3 (c)thetangentsatpandqintersectat T. Write down (i)theequationofthetangentatq P( 3, 1) (ii) the coordinates of T. 2 O B x hsn.uk.net Page 7 Questions marked c SQA

4. 5. FindtheequationofthecirclewhichhasP( 2, 1)andQ(4,5)astheendpoints of a diameter. 3 6. Theliney = 1isatangenttoacirclewhichpassesthrough (0,0)and (6,0). Find the equation of this circle. 6 7. hsn.uk.net Page 8 Questions marked c SQA

8. 9. hsn.uk.net Page 9 Questions marked c SQA

10. 11. 12.Thecirclewithequationx 2 +y 2 10x +9 =0isshownbelow. y x 2 +y 2 10x +9 =0 O A x ThepointAliesonthecircumferenceofthecircleandthex-axis. FindtheequationofthetangenttothecircleatA. 5 hsn.uk.net Page 10 Questions marked c SQA

13. Find the equation of the tangent at the point (3, 1) on the circle x 2 +y 2 4x +6y 4 =0. 5 14. 15.Agardenisbeingdesignedsothattherearethree areas for planting around a triangular decked area. A diagram of the garden, relative to a set of coordinate axes is shown to the right. The points P, Q and R lie on the circle with equation x 2 +y 2 = 4. The triangle PQR is equilateral, and the line PR is parallel to the x-axis. (a)findtheequationofthelinethroughpand Q. 4 (b) (i)findthecoordinatesofthepointp. (ii) Hence calculate the shaded area. 7 P y O Q x 2 +y 2 =4 R x 16.Thelinewithequationy +x =5meetsthecirclewithequation x 2 +y 2 8x +2y 3 =0atthepointsPandQ. (a)findthecoordinatesofpandq. 4 (b)findtheequationofthecirclewhichhaspqasitsdiameter. 3 hsn.uk.net Page 11 Questions marked c SQA

17. 18.Thecirclewithequation (x 8) 2 + (y 4) 2 =16 isshowninthediagram. ThelineOAisanon-horizontaltangenttothe circle. (a)giventhatoahasgradientm,writedown the equation of OA. 1 (b) Hence or otherwise determine the value O ofm. x 7 y A hsn.uk.net Page 12 Questions marked c SQA

19. (a) (i)showthatthelinewithequationy=3 xisatangenttothecirclewith equationx 2 +y 2 +14x +4y 19 =0. (ii) Find the coordinates of the points of contact, P. 5 (b)relativetoasuitablesetofcoordinateaxes,thediagrambelowshowsthe circlefrom(a)andasecondsmallercirclewithcentrec. P C Theliney =3 xisacommontangentatthepointp. Theradiusofthelargercircleisthreetimestheradiusofthesmallercircle. Find the equation of the smaller circle. 6 20.Findthevaluesofkforwhichthelinex +y =kisatangenttothe circlex 2 +y 2 4x +2 =0. 5 21. Findthepossiblevaluesofkforwhichthelinex y =kisatangenttothecircle x 2 +y 2 =18. 5 hsn.uk.net Page 13 Questions marked c SQA

22.The larger circle shown in the diagram has equation y B x 2 +y 2 10x 4y +12 =0. Thesmallercirclehascentre (10, 13 4 )andradius 17 4. Thelinethrough AandBpassesthrough the centre of both circles. Point A has coordinates (1, 1). (a) Show that the circles touch externally. 4 (b) (i)findtheequationofthetangenttothelargercircleata. (ii)hencestatethegradientofthetangenttothesmallercircleatb. 4 O A x 23. (a)showthatthepointp(5,10)liesoncirclec 1 withequation (x +1) 2 + (y 2) 2 =100. 1 (b)pqisadiameterofthiscircleas y showninthediagram. Findthe equationofthetangentatq. P(5, 10) 5 O x Q (c)twocircles,c 2 andc 3,touchcircleC 1 atq. TheradiusofeachofthesecirclesistwicetheradiusofcircleC 1. FindtheequationsofcirclesC 2 andc 3. 4 24. hsn.uk.net Page 14 Questions marked c SQA

25. Explainwhytheequationx 2 +y 2 +2x +3y +5 =0doesnotrepresentacircle. 2 26. Forwhatrangeofvaluesofcdoestheequationx 2 +y 2 6x +4y+c =0represent acircle? 3 27. hsn.uk.net Page 15 Questions marked c SQA

28. 29. 30. hsn.uk.net Page 16 Questions marked c SQA

31. 32. hsn.uk.net Page 17 Questions marked c SQA

33. hsn.uk.net Page 18 Questions marked c SQA

34.Showthattheequationx 2 +y 2 +kx 4y 2 =0representsacircleforallvalues ofk. 3 35. 36.CircleC 1 hasequation (x +1) 2 + (y 1) 2 =121. AcircleC 2 withequationx 2 +y 2 4x +6y +p =0isdrawninsideC 1. The circles have no points of contact. Whatistherangeofvaluesofp? 9 [ENDOFPAPER2] hsn.uk.net Page 19 Questions marked c SQA