m a s s s p e c t r o m e t r y LTQ XL Linear Ion Trap Mass Spectrometer More Structural Information with MS n Part of Thermo Fisher Scientific
SUPERIR I TRAP TECHLGY From the leader in Ion Trap Mass Spectrometry, the LTQ XL Linear Ion Trap delivers ultimate sensitivity at breakthrough speed. Proteomics: Maximum protein coverage resulting from superior cycle times and sensitivity Automated MS n triggered Data Dependent neutral loss scan Flexibility of ionization modes, inlets, and chromatographic solutions Metabolite Identification: Superior MS n spectral quality and full-scan acquisition Structural information on low level metabolites without knowing MRM transitions Data Dependent and Dynamic Exclusion acquisition for maximum information in complex samples Discovery Quantitation: Excellent ion statistics for robust quantitation ptimum efficiency with ormalized Collision Energy Simultaneous identification and quantitation for the regulated laboratory environment Forensic and Clinical Analysis: utstanding robustness for reliable quantitation in complex matrices Simultaneous quantitation and confirmation in both positive and negative ionization modes Ease of use for the production laboratory 2
With the Accela High Speed LC System, the LTQ XL is the perfect tool for high throughout applications. Using multiple dissolution techniques, including Pulsed-Q Dissociation (PQD) and Electron Transfer Dissociation (ETD), the LTQ XL generates extensive structural information for the most demanding proteomics samples. The LTQ XL Linear Ion Trap Technology You Can Trust 3
METABLITE IDETIFICATI AD CFIRMATI Automatically find all the metabolites the first time, even the ones that you didn t predict... Metabolic studies are performed both in vivo and in vitro necessitating the analysis of target compounds in complex matrices. These biological matrices contain the parent drug, all of its metabolites in a wide range of concentrations, and additional endogenous metabolic materials. Furthermore, it is not pos sible to predict, in advance, all of the metabolites for a potentially new drug compound. Intelligent precursor ion selection Automated Data Dependent MS n acquisition gives you information on not only the predicted metabolites (parent list), but also on the unpredicted metabolites. In addition, classes of metabolites can be detected using the automated Data Dependent Constant eutral Loss (CL) triggered MS 3 feature. Data analysis can be facilitated using MetWorks and Mass Frontier software that enhances the screening and characterization of metabolites in complex matrices. Metabolite Identification Analog signal-triggered Data Dependent MS n acquisitions Constant eutral Loss Data Dependent MS n acquisitions MetWorks software Mass Frontier software Trace using full-scan data points for quantitation The LC/MS n raw data trace Simultaneous Metabolite Identification and Quantitation for Metabolic Stability Qualitative and quantitative information in a single run RT:. - 4. Relative Abundance 6 4 6 4 6 4 Full Scan MS MS 2 m/z 463 MS 3 m/z 252 91.7 117.3 146.1 195.22 146. 196.7224.8 264.69 196.11 278.75 252.3 323.52 252. 252.8 224.3 263.29 398.32 423.4 463.23 463.51 333.38 386. 432.13 465.27 466.26 521. Quan and ID (LC/MS n ) 9 Data Dependent MS n metabolite identification Warfarin H 3 C H 98% Relative Abundance 7 6 5 4 3 1 Bifonazole Ketoconazole Loperamide H 3 C CH 3 CH 3 Cl C l Cl H 83% 38% 17%..5 1. 1.5 2. 2.5 3. 3.5 Time (min) Reconstructed ion chromatograms for 13 identified drugs and metabolites in less than three minutes. icardipine + CH 3 CH 3 H 3 C CH 3 Quantitation for metabolic stability 1% 4
ELECTR TRASFER DISSCIATI (ETD) FR PRTEMICS AD BIMARKER APPLICATIS Available for the LTQ and LTQ XL mass spectrometers, ETD offers ECD-like fragmentation in a linear ion trap, producing abundant peptide fragmentation while preserving labile PTMs, such as phosphorylation. ETD, combined with the high ion storage capacity of Thermo Scientific linear ion traps, creates a powerful new tool for protein and peptide analysis. ETD Makes the LTQ XL Even More Powerful for Proteomics Complementary with CID Improves protein coverage Preserves labile PTMs, simplifying their analysis Automated CID and ETD in a single injection ETD ion/ion chemistry. The LTQ XL ion trap is the ideally suited device to exploit this technique. Relative Abundance 95 9 85 75 7 65 6 55 5 45 4 35 3 25 15 1 5 Z 1 C 2 Z 4 537.18 75.27 713.82 C 8 89.36 C 9 Z 9 4.36 C 159.9 3 357.18 Z3 17.18 684.36 423.18 242.18 C C 5 4 527.27 C 1185.9 428.27 C6 Z 7 Z Z 7 Z 1 8 775.36 674.27 9.27 C Z 5 2 1 Z 26.9 6 C 1 155.9 63.27 797.45 C 11 1268.36 141.45 1368.45 4 6 1 14 m/z Z 11 1427.45 ETD MS/MS spectrum of VIP 1-12 m/z 476.3 (3+) showing rich production of c and z ion series Detected by CID or ETD or Both fmol VALBUMI (P112): MGSIGAASMEFCFDVFKELKVHHAEIFYCPIAIMSALAMVYLGAKDSTRTQIKVVRFDKLPGF GDSIEAQCGTSVVHSSLRDILQITKPDVYSFSLASRLYAEERYPILPEYLQCVKELYRGGLEPIF QTAADQARELISWVESQTGIIRVLQPSSVDSQTAMVLVAIVFKGLWEKAFKDEDTQAMPFRV TEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTMSMLVLLPDEVSGLEQLESIIFEKLTEW TSSVMEERKIKVYLPRMKMEEKYLTSVLMAMGITDVFSSSALSGISSAESLKISQAVHAAHAEI EAGREVVGSAEAGVDAASVSEEFRADHPFLFCIKHIATAVLFFGRCVSP 4 fmol ALBUMI (P2769): MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEQFKGLVLIAFSQYLQQCPFDEHVKLV ELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERECFLSHKDDS PDLPKLKPDPTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYAKYGVFQDCCQAEDKG ACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKV HKECCHGDLLECADDRADLAKYICDQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPELPPLTAD FAEDKDVCKYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVF DKLKHLVDEPQLIKQCDQFEKLGEYGFQALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTK PESERMPCTEDYLSLILRLCVLHEKTPVSEKVTKCCTESLVRRPCFSALTPDETYVPKAFDEKLFT FHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMEFVAFVDKCCAADDKEACFAVEGPK LVVSTQTALA Comparison of Detection Methods Increase in Coverage CID with CID and ETD and ETD CID ETD Combined Combined valbumin 137 129 184 15% Albumin 239 248 345 18% Improved sequence coverage with ETD; complementary to other methods 5
MULTIPLE IIZATI MDES A variety of ionization techniques are available on the LTQ XL that allow for maximum flexibility in sample analysis. Titanium skimmer for superior ruggedness Vent free removal of ion transfer tube Tool-free interchange of probes Ion Max source ESI, APCI, and APPI probes are based on the revolutionary Ion Max source design. It imparts superior performance and features simple, tool-free switching of ESI and APCI probes. Full probe adjustment in the x, y, and z directions allows optimized positioning for maximum sensitivity and robustness in both low and high flow applications. The 6 angle dramatically improves performance by reducing chemical noise. Maintenance of API sources, as well as switching between various probes, is vent-free. Auto matic source recognition adds to ease of use. anospray source The new anospray ion source features easy coupling with low dead volume and interchangeable probes for static, dynamic, and packed tip nanospray. The liquid junction provides excellent spray stability even when spraying % aqueous mobile phase. The versatile anospray source accommodates uncoated and packed tip needle designs to support low- and high-flow applications. Source Configurations for Every eed Electrospray ionization (ESI) Atmospheric pressure chemical ionization (APCI) Atmospheric pressure photoionization (APPI) Electron transfer dissociation (ETD) anospray ionization (SI) 6
A PLATFRM FR HIGH RESLUTI AD HIGH MASS ACCURACY Linear Ion Trap FT-ICR The LTQ XL hybrid mass spectrometers have established themselves as the new analytical standard for research in Proteomics and Drug Discovery. LTQ rbitrap Breakthrough Technology Combining patented rbitrap technology with the LTQ XL linear ion trap, the LTQ rbitrap offers fast, sensitive, reliable detection and iden ti fication of compounds in complex mixtures. Its outstanding mass accuracy, mass resolution and reliable, high sensi - tivity MS n performance make it a clear alternative to existing hybrid time-of-flight systems. LTQ FT Ultra Ultimate Performance The LTQ FT Ultra combines the most advanced Ion Trap and Fourier Trans - form Ion Cyclotron Resonance (FT-ICR) technologies into a single instrument, with unprecedented analytical power and versatility. Ultra-high resolution and sensitivity, coupled with sub ppm mass accuracy and accuracy, enable routine analysis of even the most complex samples. ECD and IRMPD are available for top down protein analysis. Accurate Mass on a Chromatographic Time Scale Robust and reliable high mass accuracy Simultaneous high mass resolution, mass accuracy, and sensitivity Fast data acquisition rate with ultra high mass resolution RT: 4.85-8.83 Relative Abundance 9 7 6 5 4 3 1 5.24 Base Peak Chromatogram 5.34 5.51 5.79 6.45 6. 6.84 7.39 7.11 7.55 7.55 L: 6.16E7 Base Peak F: FTMS + c ESI Full ms [1.-1.] MS FT_FT_Busprione_In_Vitro_ HCD_9V_3 7.89 8.1 8.48 8.7 386.25522 Experimental.44 ppm 1.6 ppm 387.25861 2.6 ppm 388.26172 391.28415 386.2555 9 7 6 5 Extracted Ion Chromatogram m/z 386.25 L: 6.16E7 Base Peak m/z= 385.76-386.76 F: FTMS + c ESI Full ms [1.-1.] MS FT_FT_Busprione_In_Vitro_ HCD_9V_3 Theoretical 4 3 1 7.89 4.9 5.24 5.73 5.9 6.12 6.34 6.61 6.94 8.32 7.17 8.1 8.65 8. 8.5 5. 5.5 6. 6.5 7. 7.5 Time (min) 387.25799 388.2671 384 385 386 387 388 389 39 391 392 m/z Accurate mass determination of an in vitro buspirone sample analyzed on the LTQ rbitrap 7
Laboratory Solutions Backed by Worldwide Service and Support Tap our expertise throughout the life of your instrument. Thermo Scientific Services extends its support throughout our worldwide network of highly trained and certified engineers who are experts in laboratory technologies and applications. Put our team of experts to work for you in a range of disciplines from system installation, training and technical support, to complete asset management and regulatory compliance consulting. Improve your productivity and lower the cost of instrument ownership through our product support services. Maximize uptime while eliminating the uncontrollable cost of unplanned maintenance and repairs. When it s time to enhance your system, we also offer certified parts and a range of accessories and consumables suited to your application. To learn more about our products and comprehensive service offerings, visit us at www.thermo.com. In addition to these offices, Thermo Fisher Scientific maintains a network of representative organizations throughout the world. Africa +43 1 333 534 127 analyze.emea@thermo.com Australia +61 2 8844 95 analyze.au@thermo.com Austria +43 1 333 534 analyze.at@thermo.com Belgium +32 2 482 3 3 analyze.be@thermo.com Canada +1 53 8447 analyze.ca@thermo.com China +86 1 8419 3588 analyze.cn@thermo.com Denmark +45 7 23 62 6 analyze.dk@thermo.com Europe-ther +43 1 333 534 127 analyze.emea@thermo.com France +33 1 6 92 48 analyze.fr@thermo.com Germany +49 613 48 114 analyze.de@thermo.com India +91 22 6742 9434 analyze.in@thermo.com Italy +39 2 95 591 analyze.it@thermo.com Japan +81 45 453 9 analyze.jp@thermo.com Latin America +1 68 276 5659 analyze.la@thermo.com Middle East +43 1 333 534 127 analyze.emea@thermo.com etherlands +31 76 579 55 55 analyze.nl@thermo.com South Africa +27 11 57 184 analyze.sa@thermo.com Spain +34 914 845 965 analyze.es@thermo.com Sweden / orway / Finland +46 8 556 468 analyze.se@thermo.com Switzerland +41 61 48784 analyze.ch@thermo.com UK +44 1442 233555 analyze.uk@thermo.com USA +1 532 4752 analyze.us@thermo.com www.thermo.com 16 Thermo Fisher Scientific Inc. All rights reserved. Mass Frontier is a trademark of HighChem, Ltd. All other trademarks are the property of Thermo Fisher Scientific Inc. and its subsidiaries. Specifications, terms and pricing are subject to change. ot all products are available in all countries. Please consult your local sales representative for details. BR628_E 8/16S