Multiple Sequence Alignment (MAS)
|
|
- Vincent Alexander
- 5 years ago
- Views:
Transcription
1 Multiple Sequence lignment (MS) Group-to-group alignments Steven driaensen & Ken Tanaka
2 References Osamu Goto Optimal lignment between groups of sequences and its application to multiple sequence alignment (1993) Further improvements in methods of group-to-group sequence alignment with generalized profile operations (1994)
3 Context Why do Multiple Sequence lignment? Reducing uncertainties Better for identifying Similarities
4 Context How to do Multiple Sequence lignment Generalization of standard DP algorithms Meta-heuristic Optimizations Progressive lignment pproach (e.g. the Clustal system)
5 Context Progressive lignment Step 1 discussed in the first lecture Calculate a distance matrix between all sequence pairs distance between a pair of sequences alignment score aligning of two sequences - global alignment: Needleman-Wunsh - local alignment: Smith-Waterman
6 Context Progressive lignment Step 2 discussed in the second lecture Constructing a guide tree (phylogenetic trees) tree describing the relationships between sequences - Fitch-Margoliash length of branches distance between sequences
7 Context Progressive lignment Step 3 We now have a guide tree, whats next? Grouplign = group-to-group alignment - the 4 algorithms by Osamu Gotoh
8 Group-to-group alignments = a 11 a 1I B = a M1 a MI b 11 b 1J b N1 b NJ a 1 a 2 e.g. N = b 1 b path: J where 3 is a match and 1, 2 a gap in group, B resp. In order to find such an alignment we need 2 things: 1. Measure of how good an alignment is. 2. n algorithm that creates an alignment approximately optimal to this measure.
9 How good is an alignment? We have seen a score for an alignment of 2 sequences extend to multiple. ffine gap penalty: gap penalty = u gap length v d a mi, a ki = Sum of Pairs: M m 1 SP = S mk (a mi = a ki = ) u (a mi = a ki = ) d a mi, a ki (else) S mk = d(a mi, a ki ) v g mk m=2 k=1 i=1 Where g mk is the number of gaps in the pair of sequences (m,k). In context of group-to-group alignments we have SP N = SP SP B SP. B SP. B = S mn I M N m=1 n=1
10 Mind the gap(s) If v we must be able to compute g mk. What is g for these pair of sequences? C C G G B B C D B C B Removing matching from a pair of sequences should not affect SP and by consequence g. s these were not introduced in aligning these sequences. nswer: 5 C C G G B B C D B C B
11 lgorithms: Notations & remarks D ij : The score obtained by the algorithm for the alignment of {a 1,, a i } and {b 1,, b j } given that the last segment of the alignment path was. In algorithm -C these are the candidates retained for a sub-alignment ij. In algorithm D the semantics of the superscript are extended to denote any candidate retained for a sub-alignment ij. The score returned by the algorithms is the Score(.B) Only for C and D we have Score = SP. a mij is the last symbol in the m th row of group in a sub-alignment ij. It is equal to a i if = 1, 3 and if = 2. b nij is the last symbol in the n th row of group B in a sub-alignment ij. It is equal to b j if = 2, 3 and if = 1. e.g. For path path: 1 3 2, N = a 1 a 2 b 1 b J = a 1 a 21 a IJ b IJ b 1 b 21 ll algorithms obtain the same result if nor B contains gaps or if v =!
12 lgorithm Backtrack: Keep a pointer to predecessor for each candidate retained. Reduce memory: Replace records no longer required. (only keep J2 last computed records) Let be the group with the longest sequences (minimize J). Backtrack: Keep path for every candidate retained.
13 lgorithm D 1 3 ij = min D i 1,j 3 1 V, D i 1j d(a i, ) D 2 ij = min D i,j 1 V, D i,j 1 d(, b j ) D 3 ij = min D i 1,j 1 d(a i, b j ) V = MNv d(a ij, b ij ) = M m=1 N n=1 d(a mij, b nij ) record = {D ij 1, D ij 2, D ij 3 } 2
14 Gap openings and lgorithm lgorithm treats internal gaps in groups, B as an ordinary symbol. From a gap-opening perspective, there are no internal gaps. Count-rule: change in path 3 1, 3 2 is assumed to open a gap in every pairwise comparison. (V = MNv). e.g. path: [3,1]: counts NM = 2x2 = 4 Overestimate: e.g. path: [3,1]: counts NM = 2x2 = 4 Underestimate: e.g. path: [3,3]: counts a 11 a 12 a 21 a 22 b 11 b 21 a 11 a 12 a 21 a 22 b 11 b 21 a 11 = = a 12 a 21 a 22 b 11 b = 12 b 21 b 22 B B B B B actual gaps 4 actual gaps 1 actual gaps 2 m\n m\n m\n
15 Complexity of lgorithm Naively O(NMIJ) = O(NML²) O(L²) assuming you use profiles d(a ij, b ij ) = f B x X xi p xj. M = = x) f x,i m=1 (a mij p B x,j = a ij = a i B y X d(x, y) f yj = a i with f i = f i f a ij = and p i = p i if a ij p if a ij = f i, f B j, p i, p B j can be precomputed (outside loops) Essentially we are rewriting a sum with a fixed number of different terms as a dot product: e.g = 5*24*5 p x,j B gives the possible values for terms 2 5 and f x,i their frequencies 5 4. Beware of large constant X!
16 lgorithm B D ij 1 = min β=1,3 D ij 2 = min β=2,3 D ij 3 = min β=1,2,3 β D i 1,j β D i,j 1 β D i 1,j 1 RecordB = {D ij 1, D ij 2, D ij 3 } g ij β1 v d(ai, ) g ij β2 v d(, bj ) g ij β3 v d(ai, b j ) g i,j β is the estimated # new gaps introduced given the last 2 path segments are β.
17 Gap openings in algorithm B Gap openings: Estimates new gaps based on whether or not the symbols at the 2 last positions for every pair of sequences are gaps in the evaluated candidate alignment. B C C D? B C C? G G? B B
18 g ij β M N g 11 ij = ( γ 11 q m,i 1 )(1 q m,i ) m=1 n=1 M N g 13 ij = (γ 13 q m,i 1 )(1 q m,i )r n,j m=1 n=1 M N g ij 22 = (γ 22 r n,j 1 )(1 r n,j ) g ij 23 = m=1 n=1 M N m=1 n=1 M N (1 q m,i 1 γ 13 q m,i 1 )(1 r n,j )q m,i (1 r n,i,j 1 γ 23 r n,j 1 )(1 q m,i )r n,j (γ 23 r n,j 1 ) (1 r n,j )q m,i g ij 31 = (1 r n,j 1 γ 31 q m,i 1 r n,j 1 )(1 q m,i ) m=1 n=1 M N g ij 32 = (1 q m,i 1 γ 32 r n,j 1 q m,i 1 )(1 r n,j ) g ij 33 = m=1 n=1 M N m=1 n=1 (1 r n,j 1 γ 33 q m,i 1 r n,j 1 )(1 q m,i )r n,j (1 q m,i 1 γ 33 r n,j 1 q m,i 1 )(1 r n,j )q m,i q m,i = a m,i = r n,j = b n,j = γ β 1
19 Complexity of algorithm B Complexity: Naïve O(MNL²) Using profiles both d(a ij, b ij ) and g ij β can be computed using fixed #steps, resulting in O(L²)
20 lgorithm C D ij 1 = min β=1,3 D ij 2 = min β=2,3 D ij 3 = min β=1,2,3 β D i 1,j β D i,j 1 β D i 1,j 1 g ij β1 v d(ai, ) g ij β2 v d(, bj ) g ij β3 v d(ai, b j ) g ij β is the actual # new gaps introduced given the last 2 path segments are β. Q ij, R ij give for every sequence in sub-alignment ij of, B the # consecutive gaps it has at the end. RecordC = {D ij,q ij, R ij } ( = 1,2,3)
21 Gap openings and algorithm C B C C 1 1 D 2 B C C 2 G G 3 B B 1 1 We count a new gap in pairwise sequence comparison if we have non-matching gaps and we are not extending a gap we already counted. The Score(,B) = SP(.B) Note however that some gaps only get counted when they are closed. This extra cost present in the full alignment, but not the sub-alignment is called the retarded gap penalty. Because of the retarded gap penalty, a sub-alignment ij of the optimal alignment IJ is not guaranteed to be a retained alignment for ij.
22 The 55 sub-alignment of the optimal alignment is not the optimal 55 subalignment. However as the better alternative has a different last path segment it is still retained.
23 The 66 sub-alignment of the optimal alignment is not the optimal 66 subalignment. The better alternative now has the same last path segment and is retained instead.
24 We do not find the optimal group-to-group alignment.
25 g ij β Let Q, R be the values for Q, R of the predecessor sub alignment β. We then have M N g ij β1 = 1 qm,i Q m R n g ij β2 = m=1 n=1 M N m=1 n=1 M N (1 rn,j ) (Q m R n) g ij β3 = 1 qm,i r n,j Q m R n (1 r n,j )q m,i (Q m R n) m=1 n=1 Let Q,R be the values for Q, R of the predecessor sub alignment of the retained candidate. Q ij, R ij are then computed as follows: Q m,ij = Q m 1 (if q m,i ) (else) R n,ij = R n 1 (if r n,j ) (else)
26 Complexity of algorithm C Naïve O(MNL²) Problem, not straightforward to use profiles to compute g ij β. We have O(MNL²). In Gotoh(1994) a concept of generalized profiles is introduced. chieving a complexity not directly dependent on M, N.
27 lgorithm D D retains a dynamic set of good candidates (candidate list paradigm), using a series of tests τ 1, τ 2, τ 3 and τ 4 Let T be the filter based on τ 1, τ 2, τ 3 and τ 4. Let us call EV ij the set of candidates evaluated and RE ij the set of candidates retained. EV 1 β ij = D i 1,j β RE i 1,j g ij β1 v d(ai, ) EV 2 β ij = D i,j 1 g ij β2 v d(, bj ) β RE i,j 1 EV 3 β ij = D i 1,j 1 β RE i 1,j 1 EV ij = EV ij 1 EV ij 2 EV ij 3 g ij β3 v d(ai, b j ) RE ij = T(EV ij ) RecordD = {D ij,q ij, R ij } ( ϵ RE ij ) Where g ij β is calculated as in algorithm C.
28 Candidate Tests in algorithm D 4 necessary conditions for being a sub-alignment of an optimal alignment. lgorithm D therefore returns the optimal alignment for two groups. Call C ij the set of candidates that haven t failed any prior test. l = minarg C ij (D ij) τ 1 = M N m=1 n=1 (Q m,ij Rn,ij ) < Qm,ij l R l n,ij m = minarg C ij (E ij ) where Eij = Dij v τ 2 = M N m=1 n=1 (Q m,ij Rn,ij m ) > Qm,ij m Rn,ij n = minarg C ij (E ij ) where Fij = Dij v τ 3 = M N m=1 n=1 (Q m,ij Rn,ij m ) < Qm,ij m Rn,ij = minarg C ij (G ij ) where Gij = Dij v τ 4 = (G ij > Dij ) or Q m,ij M m=1 N n=1 or Q m,ij M m=1 N n=1 or Q m,ij M m=1 N n=1 Rn,ij Qm,ij Rn,ij Qm,ij Rn,ij Qm,ij < Q l m,ij Rn,ij m < Q m,ij Rn,ij m > Q m,ij Rn,ij Test order τ 4 τ 1 τ 2 τ 3... (until none removed or C ij = 1) Note that l, m, n, always automatically pass their corresponding test. R l n,ij m Rn,ij m Rn,ij (Q m,ij Rn,ij )
29 Complexity algorithm D No worst case complexity known. (obvious upper bound: retains all) verage case: O(MNL²) Evaluates/retains less candidates than algorithms -C in practice. Evaluation of candidates takes more time. Using the profiles for C, allow us to compute D β ij and g ij in a time not directly dependent on MN. However the tests in D require MN time: Calculating the test values E ij, F ij, G ij O( C ij MN) Performing the tests τ 1, τ 2, τ 3 O( C ij MN) Gotoh (1994) rewrites these computations and tests using generalized profiles to remove these direct depencies between computation time and MN.
30 Experiments
31 Results General Tradeoff speed vs. accuracy Speed > B > C > D more procedural complexity ccuracy D > C > B > more accuracy in gap penalty estimation
32 Results & Considerations relatedness vs. accuracy for distantly related sequences C, D is better (generalized) profiles vs. no profiles ll have variants using profiles but additional complexity only when M.N is high
33 Conclusions Which algorithm to use? can depend on the groups to be aligned e.g. No internal gaps = B = C = D Distantly related D > C > B > M.N is high (D > C) with generalized profiles >... can depend on preferences e.g. Has to be simple (procedurally) > B > C > D Has to be efficient (time/memory-wise) > B >... Has to be accurate D > C >...
Multiple Alignment. Slides revised and adapted to Bioinformática IST Ana Teresa Freitas
n Introduction to Bioinformatics lgorithms Multiple lignment Slides revised and adapted to Bioinformática IS 2005 na eresa Freitas n Introduction to Bioinformatics lgorithms Outline Dynamic Programming
More informationTHEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
More informationLecture 2: Pairwise Alignment. CG Ron Shamir
Lecture 2: Pairwise Alignment 1 Main source 2 Why compare sequences? Human hexosaminidase A vs Mouse hexosaminidase A 3 www.mathworks.com/.../jan04/bio_genome.html Sequence Alignment עימוד רצפים The problem:
More informationInDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
More informationAlgorithm Design and Analysis
Algorithm Design and Analysis LECTURE 18 Dynamic Programming (Segmented LS recap) Longest Common Subsequence Adam Smith Segmented Least Squares Least squares. Foundational problem in statistic and numerical
More informationSequence Bioinformatics. Multiple Sequence Alignment Waqas Nasir
Sequence Bioinformatics Multiple Sequence Alignment Waqas Nasir 2010-11-12 Multiple Sequence Alignment One amino acid plays coy; a pair of homologous sequences whisper; many aligned sequences shout out
More informationSequence Comparison. mouse human
Sequence Comparison Sequence Comparison mouse human Why Compare Sequences? The first fact of biological sequence analysis In biomolecular sequences (DNA, RNA, or amino acid sequences), high sequence similarity
More information20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, Global and local alignment of two sequences using dynamic programming
20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, 2008 4 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance 4. Global and local alignment
More information5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT
5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT.03.239 03.10.2012 ALIGNMENT Alignment is the task of locating equivalent regions of two or more sequences to maximize their similarity. Homology:
More informationLecture 4: September 19
CSCI1810: Computational Molecular Biology Fall 2017 Lecture 4: September 19 Lecturer: Sorin Istrail Scribe: Cyrus Cousins Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes
More informationAlgorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot
More informationTree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
More informationCFG PSA Algorithm. Sequence Alignment Guided By Common Motifs Described By Context Free Grammars
FG PS lgorithm Sequence lignment Guided By ommon Motifs Described By ontext Free Grammars motivation Find motifs- conserved regions that indicate a biological function or signature. Other algorithm do
More informationMultiple Sequence Alignment using Profile HMM
Multiple Sequence Alignment using Profile HMM. based on Chapter 5 and Section 6.5 from Biological Sequence Analysis by R. Durbin et al., 1998 Acknowledgements: M.Sc. students Beatrice Miron, Oana Răţoi,
More informationMoreover, the circular logic
Moreover, the circular logic How do we know what is the right distance without a good alignment? And how do we construct a good alignment without knowing what substitutions were made previously? ATGCGT--GCAAGT
More informationPairwise sequence alignment
Department of Evolutionary Biology Example Alignment between very similar human alpha- and beta globins: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL G+ +VK+HGKKV A+++++AH+D++ +++++LS+LH KL GNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKL
More information3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT
3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode
More informationCISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I)
CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) Contents Alignment algorithms Needleman-Wunsch (global alignment) Smith-Waterman (local alignment) Heuristic algorithms FASTA BLAST
More informationSequence Alignment (chapter 6)
Sequence lignment (chapter 6) he biological problem lobal alignment Local alignment Multiple alignment Introduction to bioinformatics, utumn 6 Background: comparative genomics Basic question in biology:
More informationSara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)
Bioinformática Sequence Alignment Pairwise Sequence Alignment Universidade da Beira Interior (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) 1 16/3/29 & 23/3/29 27/4/29 Outline
More informationIntroduction to sequence alignment. Local alignment the Smith-Waterman algorithm
Lecture 2, 12/3/2003: Introduction to sequence alignment The Needleman-Wunsch algorithm for global sequence alignment: description and properties Local alignment the Smith-Waterman algorithm 1 Computational
More informationProtein Threading. BMI/CS 776 Colin Dewey Spring 2015
Protein Threading BMI/CS 776 www.biostat.wisc.edu/bmi776/ Colin Dewey cdewey@biostat.wisc.edu Spring 2015 Goals for Lecture the key concepts to understand are the following the threading prediction task
More informationPairwise alignment, Gunnar Klau, November 9, 2005, 16:
Pairwise alignment, Gunnar Klau, November 9, 2005, 16:36 2012 2.1 Growth rates For biological sequence analysis, we prefer algorithms that have time and space requirements that are linear in the length
More informationPair Hidden Markov Models
Pair Hidden Markov Models Scribe: Rishi Bedi Lecturer: Serafim Batzoglou January 29, 2015 1 Recap of HMMs alphabet: Σ = {b 1,...b M } set of states: Q = {1,..., K} transition probabilities: A = [a ij ]
More informationIntroduction to Sequence Alignment. Manpreet S. Katari
Introduction to Sequence Alignment Manpreet S. Katari 1 Outline 1. Global vs. local approaches to aligning sequences 1. Dot Plots 2. BLAST 1. Dynamic Programming 3. Hash Tables 1. BLAT 4. BWT (Burrow Wheeler
More informationApplication of the LCS Problem to High Frequency Financial Data
Application of the LCS Problem to High Frequency Financial Data Kevin Ngan Lady Margaret Hall University of Oxford A thesis submitted in partial fulfillment of the MSc in Mathematical and Computational
More informationCollected Works of Charles Dickens
Collected Works of Charles Dickens A Random Dickens Quote If there were no bad people, there would be no good lawyers. Original Sentence It was a dark and stormy night; the night was dark except at sunny
More informationSequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013
Sequence Alignments Dynamic programming approaches, scoring, and significance Lucy Skrabanek ICB, WMC January 31, 213 Sequence alignment Compare two (or more) sequences to: Find regions of conservation
More informationHeuristic Alignment and Searching
3/28/2012 Types of alignments Global Alignment Each letter of each sequence is aligned to a letter or a gap (e.g., Needleman-Wunsch). Local Alignment An optimal pair of subsequences is taken from the two
More informationSynthesis of 2-level Logic Exact and Heuristic Methods. Two Approaches
Synthesis of 2-level Logic Exact and Heuristic Methods Lecture 7: Branch & Bound Exact Two Approaches Find all primes Find a complete sum Find a minimum cover (covering problem) Heuristic Take an initial
More informationPhylogenetic trees 07/10/13
Phylogenetic trees 07/10/13 A tree is the only figure to occur in On the Origin of Species by Charles Darwin. It is a graphical representation of the evolutionary relationships among entities that share
More informationTransportation Theory and Applications
Fall 2017 - MTAT.08.043 Transportation Theory and Applications Lecture IV: Trip distribution A. Hadachi outline Our objective Introducing two main methods for trip generation objective Trip generation
More informationDynamic Programming. Prof. S.J. Soni
Dynamic Programming Prof. S.J. Soni Idea is Very Simple.. Introduction void calculating the same thing twice, usually by keeping a table of known results that fills up as subinstances are solved. Dynamic
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 07: profile Hidden Markov Model http://bibiserv.techfak.uni-bielefeld.de/sadr2/databasesearch/hmmer/profilehmm.gif Slides adapted from Dr. Shaojie Zhang
More informationSequence analysis and Genomics
Sequence analysis and Genomics October 12 th November 23 rd 2 PM 5 PM Prof. Peter Stadler Dr. Katja Nowick Katja: group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute
More informationFirst generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences
First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences 140.638 where do sequences come from? DNA is not hard to extract (getting DNA from a
More informationCONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018
CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of
More informationLocal Alignment: Smith-Waterman algorithm
Local Alignment: Smith-Waterman algorithm Example: a shared common domain of two protein sequences; extended sections of genomic DNA sequence. Sensitive to detect similarity in highly diverged sequences.
More informationA greedy, graph-based algorithm for the alignment of multiple homologous gene lists
A greedy, graph-based algorithm for the alignment of multiple homologous gene lists Jan Fostier, Sebastian Proost, Bart Dhoedt, Yvan Saeys, Piet Demeester, Yves Van de Peer, and Klaas Vandepoele Bioinformatics
More informationImplementing Approximate Regularities
Implementing Approximate Regularities Manolis Christodoulakis Costas S. Iliopoulos Department of Computer Science King s College London Kunsoo Park School of Computer Science and Engineering, Seoul National
More informationMultiple Sequence Alignment
Multiple Sequence Alignment BMI/CS 576 www.biostat.wisc.edu/bmi576.html Colin Dewey cdewey@biostat.wisc.edu Multiple Sequence Alignment: Tas Definition Given a set of more than 2 sequences a method for
More informationUnsupervised Vocabulary Induction
Infant Language Acquisition Unsupervised Vocabulary Induction MIT (Saffran et al., 1997) 8 month-old babies exposed to stream of syllables Stream composed of synthetic words (pabikumalikiwabufa) After
More informationGlobal alignments - review
Global alignments - review Take two sequences: X[j] and Y[j] M[i-1, j-1] ± 1 M[i, j] = max M[i, j-1] 2 M[i-1, j] 2 The best alignment for X[1 i] and Y[1 j] is called M[i, j] X[j] Initiation: M[,]= pply
More informationTools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2015 Week-4 BLAST Algorithm Continued Multiple Sequence Alignment Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and
More informationSingle alignment: Substitution Matrix. 16 march 2017
Single alignment: Substitution Matrix 16 march 2017 BLOSUM Matrix BLOSUM Matrix [2] (Blocks Amino Acid Substitution Matrices ) It is based on the amino acids substitutions observed in ~2000 conserved block
More informationEvolutionary Tree Analysis. Overview
CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based
More informationBackground: comparative genomics. Sequence similarity. Homologs. Similarity vs homology (2) Similarity vs homology. Sequence Alignment (chapter 6)
Sequence lignment (chapter ) he biological problem lobal alignment Local alignment Multiple alignment Background: comparative genomics Basic question in biology: what properties are shared among organisms?
More informationApplication of new distance matrix to phylogenetic tree construction
Application of new distance matrix to phylogenetic tree construction P.V.Lakshmi Computer Science & Engg Dept GITAM Institute of Technology GITAM University Andhra Pradesh India Allam Appa Rao Jawaharlal
More informationCS473 - Algorithms I
CS473 - Algorithms I Lecture 10 Dynamic Programming View in slide-show mode CS 473 Lecture 10 Cevdet Aykanat and Mustafa Ozdal, Bilkent University 1 Introduction An algorithm design paradigm like divide-and-conquer
More informationPhylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
More information9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
More informationCSE182-L7. Protein Sequence Analysis Patterns (regular expressions) Profiles HMM Gene Finding CSE182
CSE182-L7 Protein Sequence Analysis Patterns (regular expressions) Profiles HMM Gene Finding 10-07 CSE182 Bell Labs Honors Pattern matching 10-07 CSE182 Just the Facts Consider the set of all substrings
More informationDid you know that Multiple Alignment is NP-hard? Isaac Elias Royal Institute of Technology Sweden
Did you know that Multiple Alignment is NP-hard? Isaac Elias Royal Institute of Technology Sweden 1 Results Multiple Alignment with SP-score Star Alignment Tree Alignment (with given phylogeny) are NP-hard
More informationPhylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
More informationA Survey of the Longest Common Subsequence Problem and Its. Related Problems
Survey of the Longest Common Subsequence Problem and Its Related Problems Survey of the Longest Common Subsequence Problem and Its Related Problems Thesis Submitted to the Faculty of Department of Computer
More informationEvaluation Measures of Multiple Sequence Alignments. Gaston H. Gonnet, *Chantal Korostensky and Steve Benner. Institute for Scientic Computing
Evaluation Measures of Multiple Sequence Alignments Gaston H. Gonnet, *Chantal Korostensky and Steve Benner Institute for Scientic Computing ETH Zurich, 8092 Zuerich, Switzerland phone: ++41 1 632 74 79
More informationMultiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:
Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:50 5001 5 Multiple Sequence Alignment The first part of this exposition is based on the following sources, which are recommended reading:
More informationIn-Depth Assessment of Local Sequence Alignment
2012 International Conference on Environment Science and Engieering IPCBEE vol.3 2(2012) (2012)IACSIT Press, Singapoore In-Depth Assessment of Local Sequence Alignment Atoosa Ghahremani and Mahmood A.
More information/633 Introduction to Algorithms Lecturer: Michael Dinitz Topic: Dynamic Programming II Date: 10/12/17
601.433/633 Introduction to Algorithms Lecturer: Michael Dinitz Topic: Dynamic Programming II Date: 10/12/17 12.1 Introduction Today we re going to do a couple more examples of dynamic programming. While
More informationBioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment
Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value
More informationBuilding Phylogenetic Trees UPGMA & NJ
uilding Phylogenetic Trees UPGM & NJ UPGM UPGM Unweighted Pair-Group Method with rithmetic mean Unweighted = all pairwise distances contribute equally. Pair-Group = groups are combined in pairs. rithmetic
More informationSequence comparison: Score matrices
Sequence comparison: Score matrices http://facultywashingtonedu/jht/gs559_2013/ Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas FYI - informal inductive proof of best
More informationChapter 6. Weighted Interval Scheduling. Dynamic Programming. Algorithmic Paradigms. Dynamic Programming Applications
lgorithmic Paradigms hapter Dynamic Programming reedy. Build up a solution incrementally, myopically optimizing some local criterion. Divide-and-conquer. Break up a problem into sub-problems, solve each
More informationBiochemistry 324 Bioinformatics. Pairwise sequence alignment
Biochemistry 324 Bioinformatics Pairwise sequence alignment How do we compare genes/proteins? When we have sequenced a genome, we try and identify the function of unknown genes by finding a similar gene
More informationPairwise Alignment. Guan-Shieng Huang. Dept. of CSIE, NCNU. Pairwise Alignment p.1/55
Pairwise Alignment Guan-Shieng Huang shieng@ncnu.edu.tw Dept. of CSIE, NCNU Pairwise Alignment p.1/55 Approach 1. Problem definition 2. Computational method (algorithms) 3. Complexity and performance Pairwise
More informationLecture 1, 31/10/2001: Introduction to sequence alignment. The Needleman-Wunsch algorithm for global sequence alignment: description and properties
Lecture 1, 31/10/2001: Introduction to sequence alignment The Needleman-Wunsch algorithm for global sequence alignment: description and properties 1 Computational sequence-analysis The major goal of computational
More informationComputational Complexity. This lecture. Notes. Lecture 02 - Basic Complexity Analysis. Tom Kelsey & Susmit Sarkar. Notes
Computational Complexity Lecture 02 - Basic Complexity Analysis Tom Kelsey & Susmit Sarkar School of Computer Science University of St Andrews http://www.cs.st-andrews.ac.uk/~tom/ twk@st-andrews.ac.uk
More informationAlignment Strategies for Large Scale Genome Alignments
Alignment Strategies for Large Scale Genome Alignments CSHL Computational Genomics 9 November 2003 Algorithms for Biological Sequence Comparison algorithm value scoring gap time calculated matrix penalty
More informationCopyright 2000 N. AYDIN. All rights reserved. 1
Introduction to Bioinformatics Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Multiple Sequence Alignment Outline Multiple sequence alignment introduction to msa methods of msa progressive global alignment
More informationStephen Scott.
1 / 21 sscott@cse.unl.edu 2 / 21 Introduction Designed to model (profile) a multiple alignment of a protein family (e.g., Fig. 5.1) Gives a probabilistic model of the proteins in the family Useful for
More informationMore Dynamic Programming
CS 374: Algorithms & Models of Computation, Spring 2017 More Dynamic Programming Lecture 14 March 9, 2017 Chandra Chekuri (UIUC) CS374 1 Spring 2017 1 / 42 What is the running time of the following? Consider
More informationSequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas
Sequence comparison: Score matrices Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas FYI - informal inductive proof of best alignment path onsider the last step in
More informationStudy and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis
Study and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis Kumud Joseph Kujur, Sumit Pal Singh, O.P. Vyas, Ruchir Bhatia, Varun Singh* Indian Institute of Information
More informationMore Dynamic Programming
Algorithms & Models of Computation CS/ECE 374, Fall 2017 More Dynamic Programming Lecture 14 Tuesday, October 17, 2017 Sariel Har-Peled (UIUC) CS374 1 Fall 2017 1 / 48 What is the running time of the following?
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of omputer Science San José State University San José, alifornia, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Pairwise Sequence Alignment Homology
More informationBioinformatics and BLAST
Bioinformatics and BLAST Overview Recap of last time Similarity discussion Algorithms: Needleman-Wunsch Smith-Waterman BLAST Implementation issues and current research Recap from Last Time Genome consists
More informationLecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm. Alignment scoring schemes and theory: substitution matrices and gap models
Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm Alignment scoring schemes and theory: substitution matrices and gap models 1 Local sequence alignments Local sequence alignments are necessary
More informationPairwise alignment. 2.1 Introduction GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSD----LHAHKL
2 Pairwise alignment 2.1 Introduction The most basic sequence analysis task is to ask if two sequences are related. This is usually done by first aligning the sequences (or parts of them) and then deciding
More informationC E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 5 G R A T I V. Pair-wise Sequence Alignment
C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Introduction to bioinformatics 2007 Lecture 5 Pair-wise Sequence Alignment Bioinformatics Nothing in Biology makes sense except in
More informationTime/Memory Tradeoffs
Rigorous Bounds on Cryptanalytic Time/Memory Tradeoffs Elad Barkan Technion Israel Institute of Technology Joint work with Eli Biham and Adi Shamir 1 The Basic Problem of Cryptanalysis Invert a one-way
More informationCounting k-marked Durfee Symbols
Counting k-marked Durfee Symbols Kağan Kurşungöz Department of Mathematics The Pennsylvania State University University Park PA 602 kursun@math.psu.edu Submitted: May 7 200; Accepted: Feb 5 20; Published:
More informationSequence alignment methods. Pairwise alignment. The universe of biological sequence analysis
he universe of biological sequence analysis Word/pattern recognition- Identification of restriction enzyme cleavage sites Sequence alignment methods PstI he universe of biological sequence analysis - prediction
More informationLecture 5: September Time Complexity Analysis of Local Alignment
CSCI1810: Computational Molecular Biology Fall 2017 Lecture 5: September 21 Lecturer: Sorin Istrail Scribe: Cyrus Cousins Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes
More informationAlgorithm Design CS 515 Fall 2015 Sample Final Exam Solutions
Algorithm Design CS 515 Fall 2015 Sample Final Exam Solutions Copyright c 2015 Andrew Klapper. All rights reserved. 1. For the functions satisfying the following three recurrences, determine which is the
More informationAn Introduction to Sequence Similarity ( Homology ) Searching
An Introduction to Sequence Similarity ( Homology ) Searching Gary D. Stormo 1 UNIT 3.1 1 Washington University, School of Medicine, St. Louis, Missouri ABSTRACT Homologous sequences usually have the same,
More informationSequence Alignment Techniques and Their Uses
Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this
More informationEVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
More informationLecture 13. More dynamic programming! Longest Common Subsequences, Knapsack, and (if time) independent sets in trees.
Lecture 13 More dynamic programming! Longest Common Subsequences, Knapsack, and (if time) independent sets in trees. Announcements HW5 due Friday! HW6 released Friday! Last time Not coding in an action
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri RNA Structure Prediction Secondary
More informationCopyright 2000, Kevin Wayne 1
/9/ lgorithmic Paradigms hapter Dynamic Programming reed. Build up a solution incrementally, myopically optimizing some local criterion. Divide-and-conquer. Break up a problem into two sub-problems, solve
More informationMath Models of OR: Branch-and-Bound
Math Models of OR: Branch-and-Bound John E. Mitchell Department of Mathematical Sciences RPI, Troy, NY 12180 USA November 2018 Mitchell Branch-and-Bound 1 / 15 Branch-and-Bound Outline 1 Branch-and-Bound
More informationPartha Sarathi Mandal
MA 252: Data Structures and Algorithms Lecture 32 http://www.iitg.ernet.in/psm/indexing_ma252/y12/index.html Partha Sarathi Mandal Dept. of Mathematics, IIT Guwahati The All-Pairs Shortest Paths Problem
More informationHidden Markov Models
Hidden Markov Models Slides revised and adapted to Bioinformática 55 Engª Biomédica/IST 2005 Ana Teresa Freitas Forward Algorithm For Markov chains we calculate the probability of a sequence, P(x) How
More informationSequence Alignment. Johannes Starlinger
Sequence Alignment Johannes Starlinger his Lecture Approximate String Matching Edit distance and alignment Computing global alignments Local alignment Johannes Starlinger: Bioinformatics, Summer Semester
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 05: Index-based alignment algorithms Slides adapted from Dr. Shaojie Zhang (University of Central Florida) Real applications of alignment Database search
More informationPairwise & Multiple sequence alignments
Pairwise & Multiple sequence alignments Urmila Kulkarni-Kale Bioinformatics Centre 411 007 urmila@bioinfo.ernet.in Basis for Sequence comparison Theory of evolution: gene sequences have evolved/derived
More informationEvolutionary Models. Evolutionary Models
Edit Operators In standard pairwise alignment, what are the allowed edit operators that transform one sequence into the other? Describe how each of these edit operations are represented on a sequence alignment
More informationIntroduction to Computation & Pairwise Alignment
Introduction to Computation & Pairwise Alignment Eunok Paek eunokpaek@hanyang.ac.kr Algorithm what you already know about programming Pan-Fried Fish with Spicy Dipping Sauce This spicy fish dish is quick
More informationDNA Phylogeny. Signals and Systems in Biology Kushal EE, IIT Delhi
DNA Phylogeny Signals and Systems in Biology Kushal Shah @ EE, IIT Delhi Phylogenetics Grouping and Division of organisms Keeps changing with time Splitting, hybridization and termination Cladistics :
More informationMultiple Sequence Alignment
Multiple equence lignment Four ami Khuri Dept of omputer cience an José tate University Multiple equence lignment v Progressive lignment v Guide Tree v lustalw v Toffee v Muscle v MFFT * 20 * 0 * 60 *
More information