Prokaryote vs. Eukaryote
|
|
- Marcus Harrell
- 4 years ago
- Views:
Transcription
1 DIVERSITY OF LIVING THINGS Prokaryote vs. Eukaryote 1. Test Monday 2. Lab Report Rough Draft (typed) due Wednesday 3. Lab Report Due Friday Oct 7th 4. Letter to MP due Tuesday Oct 11 th CAROLUS LINNAEUS (18th century Swedish naturalist) Classified plants and animals according to similarities in form Taxonomy- the science of organizing and classifying organisms according to several criteria the more features organisms have in common, the closer the relationship Designed a system in which each organism is given two names. He called this binomial nomenclature His classification system is still used today 1
2 The 3 Domains are: 6 Kingdoms Domain Bacteria: (Kingdom Bacteria) Domain Archaea: (Kingdom Archaea) Domain Eukarya: (Kingdoms Protista, Fungi, Plantae & Animalia) Eubacteria Archaea Protists Fu Plants ngi Clades/ groups 1. Seedless vascular plants (moss- Bryophytes) 2. Vascular plants (ferns- Pterophytes) 3. Gymnosperms (conifers, ginko) 4. Angiosperms (all flowering plants) Diagram Animals Levels of Classification Taxa- categories used to classify organisms. There are 7 taxa: Cellular Organization Eukaryotes, Multicellular 1. Kingdom 2. Phylum 3. Class 4. Order 5. Family 6. Genus 7. Species Trophic level Reproduction Photoautotrophs Alternation of Generation in moss, Sporophyte dominant generation, Vegetative reproduction. Wind dispersed, animal dispersed, water dispersed Each taxon contain characteristics of the taxon prior to it plus specific characteristics that separate each taxon from another. Special features Can be parasitic: causes STD s, meningitis Malaria*** 2
3 binomial nomenclature - each organism is given a 2-part scientific name (latin). 1. Genus is always capitalized 2. species remains uncapitalized The scientific way of writing it would be in italics or underlined. Ex.1 Salmo salar Atlantic salmon Salmo trutta Brown trout HUMAN 1. Kingdom Animalia 2. Phylum Chordata 3. Class Mammalia 4. Order Primates 5. Family Hominidae 6. Genus Homo 7. species sapiens How do you determine whether these are plants or animals? 3
4 Phylogeny The evolutionary history of an organism or groups of organisms the cornerstone of a branch of biology called systematic taxonomy. Phylogenetic Tree A diagram representing the evolutionary history of an organism by a branching tree Phylogenetic trees are usually based on a combination of these lines of evidence: The fossil record Morphology Embryological patterns of development Chromosomes and DNA PHYLOGENETIC TREE The Human Lineage The common ancestor to bears, pandas and raccoons is located at the base of the tree. The branches represent newer, modern day species while the common ancestor to the cluster is represented by the base of the fork in the tree. 4
5 DICHOTOMOUS KEY A TWO-PART KEY USED TO IDENTIFY LIVING THINGS. WHEN CLASSIFYING AN ORGANISM, A SERIES OF CHOICES MUST BE MADE, WITH EACH CHOICE LEADING TO A NEW BRANCH. THE END RESULT IS THE NAME OF THE ORGANISM BEING IDENTIFIED. A Sample Classification Key Cladistics- groupings based on shared commonly derived characteristics. A cladogram may be represented by a. horizontally lines or via b. V-shaped diagram. Based on Cladistics, is the Chinese Shar-Pei more closely related to the Bulldog or the Doberman Pincher? 5
6 DOBERMAN BULL DOG SHAR-PEI Based on Cladistics, which two species are more closely related? crocodile - dinosaur dinosaur- bird crocodile-bird CROCODILE WALLEYE DINOSAUR BIRD Common ancestor to the bird & dinosaur 6
7 Alpha Walleye-C1a2 DRPSVSLLQKSPSSPVSCHATGFYPDRAMMFWRKDGEEHHEDVDVGETLPNHDGSFQ Walleye -C1a N----- Walleye -C N----- Walleye -C1a S Walleye -C N----- African-706 VL----V---TS--QFH N--E V----G-VK--I---N-ET-- African -517 VL T H-N--ELV-----V-L--G-EK--I-T-N--N-- R. trout-uba VP A-----T RDV-VS-Q---QD-----EY------D--T-- Carp-UAA VS-Q------D-L---T--T-----SGVTIT-Q-N-QD-D----L--LII-E--T-- Zebrafish-UBA VS-Q S----V--V-----SGLKIS-QRN-QD-D---EL--LI--E--TY- V-shaped Cladograms OLDEST PRESENT 7
8 8
Section 18-1 Finding Order in Diversity
Name Class Date Section 18-1 Finding Order in Diversity (pages 447-450) Key Concepts How are living things organized for study? What is binomial nomenclature? What is Linnaeus s system of classification?
Taxonomy and Biodiversity
Chapter 25/26 Taxonomy and Biodiversity Evolutionary biology The major goal of evolutionary biology is to reconstruct the history of life on earth Process: a- natural selection b- mechanisms that change
Concept Modern Taxonomy reflects evolutionary history.
Concept 15.4 Modern Taxonomy reflects evolutionary history. What is Taxonomy: identification, naming, and classification of species. Common Names: can cause confusion - May refer to several species (ex.
9.3 Classification. Lesson Objectives. Vocabulary. Introduction. Linnaean Classification
9.3 Classification Lesson Objectives Outline the Linnaean classification, and define binomial nomenclature. Describe phylogenetic classification, and explain how it differs from Linnaean classification.
Objectives. Classification. Activity. Scientists classify millions of species
Objectives Classification Notes 8.1 Summarize classification Describe the evidence used to classify organisms. List the seven levels of classification. Describe and list the six kingdoms of living organisms
Learning Outcome B1 13/10/2012. Student Achievement Indicators. Taxonomy: Scientific Classification. Student Achievement Indicators
Classification of Living Organisms Learning Outcome B1 Learning Outcome B1 Apply the Kingdom System of classification to study the diversity of organisms. Student Achievement Indicators Students who have
CLASSIFICATION OF LIVING THINGS
CLASSIFICATION OF LIVING THINGS 1. Taxonomy The branch of biology that deals with the classification of living organisms About 1.8 million species of plants and animals have been identified. Some scientists
Biology Classification Unit 11. CLASSIFICATION: process of dividing organisms into groups with similar characteristics
Biology Classification Unit 11 11:1 Classification and Taxonomy CLASSIFICATION: process of dividing organisms into groups with similar characteristics TAXONOMY: the science of classifying living things
Autotrophs capture the light energy from sunlight and convert it to chemical energy they use for food.
Prokaryotic Cell Eukaryotic Cell Autotrophs capture the light energy from sunlight and convert it to chemical energy they use for food. Heterotrophs must get energy by eating autotrophs or other heterotrophs.
The Classification of Plants and Other Organisms. Chapter 18
The Classification of Plants and Other Organisms Chapter 18 LEARNING OBJECTIVE 1 Define taxonomy Explain why the assignment of a scientific name to each species is important for biologists KEY TERMS TAXONOMY
Chapter 17. Table of Contents. Objectives. Taxonomy. Classifying Organisms. Section 1 Biodiversity. Section 2 Systematics
Classification Table of Contents Objectives Relatebiodiversity to biological classification. Explainwhy naturalists replaced Aristotle s classification system. Identifythe main criterion that Linnaeus
What are living things, and how can they be classified?
Classifying Organisms What are living things, and how can they be classified? binomial nomenclature species genus dichotomous key cladogram Classifying Living Things Classification: organizing information
Chapter 17. Organizing Life's Diversity
Chapter 17 Organizing Life's Diversity Key Concepts: Chapter 17 1. List the six kingdoms. 2. Our current system of classification was originally based on structures; scientists now base classification
CLASSIFICATION. Why Classify? 2/18/2013. History of Taxonomy Biodiversity: variety of organisms at all levels from populations to ecosystems.
Why Classify? Classification has been around ever since people paid attention to organisms. CLASSIFICATION One primeval system was based on harmful and non-harmful organisms. Life is easier when we organize
Classification of Organisms
Classification of Organisms Main Idea *****Chapter 14***** Students should be able to: * Understand why a classification system is important * Understand that there are a variety of ways to classify organisms
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin
Characteristics of Life
UNIT 2 BIODIVERSITY Chapter 4- Patterns of Life Biology 2201 Characteristics of Life All living things share some basic characteristics: 1) living things are organized systems made up of one or more cells
Outline. Classification of Living Things
Outline Classification of Living Things Chapter 20 Mader: Biology 8th Ed. Taxonomy Binomial System Species Identification Classification Categories Phylogenetic Trees Tracing Phylogeny Cladistic Systematics
Fig. 26.7a. Biodiversity. 1. Course Outline Outcomes Instructors Text Grading. 2. Course Syllabus. Fig. 26.7b Table
Fig. 26.7a Biodiversity 1. Course Outline Outcomes Instructors Text Grading 2. Course Syllabus Fig. 26.7b Table 26.2-1 1 Table 26.2-2 Outline: Systematics and the Phylogenetic Revolution I. Naming and
Vocabulary: Fill in the definition for each word. Use your book and/or class notes. You can put the words in your own words. Animalia: Archaea:
Name: _ Due Date: _ Per: _ Unit 4.2 Study Guide Directions: Complete all sections to the best of your ability. On the day of the Quiz (the due date for this assignment) turn this in with all of your Unit
CLASSIFICATION NOTES
CLASSIFICATION NOTES Classification Classification = arrangement of living things into groups according to their observed similarities. Important because it allows us to be able to study life easier Living
Classification Notes
Name Living Environment Classification Notes Characteristics of Living Things All living things have a cellular organization, contain similar chemicals, use energy, grow and develop, respond to their surroundings,
SECTION 17-1 REVIEW BIODIVERSITY. VOCABULARY REVIEW Distinguish between the terms in each of the following pairs of terms.
SECTION 17-1 REVIEW BIODIVERSITY VOCABULARY REVIEW Distinguish between the terms in each of the following pairs of terms. 1. taxonomy, taxon 2. kingdom, species 3. phylum, division 4. species name, species
Finding Order in Diversity
Finding Order in Diversity Videos Scishow Taxonomy: https://youtu.be/f38bmgpcz_i Bozeman Taxonomy: https://youtu.be/tyl_8gv7rie Terms to Know 1. Radiometric Dating 12. Miller and Urey s 2. Geologic Time
Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26
Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,
Chapter 18: Classification
Chapter 18: Classification Dichotomous Key A way to identify unknown organisms Contains major characteristics of groups of organisms Pairs of CONTRASTING descriptions 4. After each description key either
Classification of Living Things. Unit II pp 98
Classification of Living Things Unit II pp 98 Why There is a Need for Classifying There are over 2 million different types of organisms known. biologists can organize living things into groups. Taxonomy
First things first: What IS classification and WHY do we do it (or DO we)? How are living things classified? Classification Systems
How are living things classified? Objective: Describe the system used today to classify organisms (including the seven levels of classification as well as scientific names) First things first: What IS
UNIT 4 TAXONOMY AND CLASSIFICATION
UNIT 4 TAXONOMY AND CLASSIFICATION CHAPTER 13 IN TEXT READ P. 4.0 CLASSIFICATION AND TAXONOMY 4.1 Define taxonomy 4.2 Discuss the reasons for classifying organisms 4.3 Define species and binomial nomenclature
Name: Class: Date: ID: A
Class: _ Date: _ Ch 17 Practice test 1. A segment of DNA that stores genetic information is called a(n) a. amino acid. b. gene. c. protein. d. intron. 2. In which of the following processes does change
Classification Cladistics & The Three Domains of Life. Biology Mrs. Flannery
Classification Cladistics & The Three Domains of Life Biology Mrs. Flannery Finding Order in Diversity Earth is over 4.5 billion years old. Life on Earth appeared approximately 3.5 billion years ago and
Taxonomy. Taxonomy is the science of classifying organisms. It has two main purposes: to identify organisms to represent relationships among organisms
Taxonomy Taxonomy Taxonomy is the science of classifying organisms. It has two main purposes: to identify organisms to represent relationships among organisms Binomial Nomenclature Our present biological
Classification Practice Test
Classification Practice Test Modified True/False Indicate whether the statement is true or false. If false, change the identified word or phrase to make the statement true. 1. An organism may have different
Carolus Linnaeus System for Classifying Organisms. Unit 3 Lesson 2
Carolus Linnaeus System for Classifying Organisms Unit 3 Lesson 2 Students will be able to: Conclude some of the classification benefits and importance. Define what is meant by species. Describe the binomial
Background: Why Is Taxonomy Important?
Background: Why Is Taxonomy Important? Taxonomy is the system of classifying, or organizing, living organisms into a system based on their similarities and differences. Imagine you are a scientist who
Test: Classification of Living Things
: Classification of Living Things Date: Name: Class: Word Bank: Biodiversity Classification Taxonomy Binomial Nomenclature Phylogeny Cladistics Cladogram Specific Epithet Use the word bank above to match
Classification of Living Things Ch.11 Notes
Classification of Living Things Ch.11 Notes Why do we classify things?! Supermarket aisles! Libraries! Classes! Teams/sports! Members of a family! Roads! Cities! Money What is classification?! Classification:
The Living Environment Unit 4 History of Biological Diversity Unit 17: Organizing the Diversity of Life-class key.
Name: Period: Chapter 17 assignments Pages/Sections Date Assigned Date Due Topic: The Tree of Life Objective: How may we organize so many different organisms? The Tree of Life o organize organisms by structure
The Road to the Six Kingdoms
Bio 2201 Unit 2 The Road to the Six Kingdoms A 2011study estimated there are about 8.6 million species on earth. Only 1.8 million species have been identified and named. *Chromista is a sub-kingdom group
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Biologists estimate that there are about 5 to 100 million species of organisms living on Earth today. Evidence from morphological, biochemical, and gene sequence
Unit Two: Biodiversity. Chapter 4
Unit Two: Biodiversity Chapter 4 A. Classifying Living Things (Ch.4 - page 100) Scientific knowledge is constantly evolving ( changing ): new evidence is discovered laws and theories are tested and possibly
NAME: DATE: PER: CLASSIFICATION OF LIFE Powerpoint Notes
NAME: DATE: PER: CLASSIFICATION OF LIFE Powerpoint Notes 1. Species of Organisms a) There are known species of organisms b) This is only of all organisms that ever lived. c) are still being found and identified.
Classification Systems. Classification is just a fancy word for organization. So this chapter is equivalent to Biology cleaning its room!
Classification Systems Classification is just a fancy word for organization. So this chapter is equivalent to Biology cleaning its room! A Vast Science Biology, the study of life, is no simple science.
Multiple Choice Write the letter on the line provided that best answers the question or completes the statement.
Chapter 18 Classification Chapter Test A Multiple Choice Write the letter on the line provided that best answers the question or completes the statement. 1. Scientists assign each kind of organism a universally
What makes things alive? CRITERIA FOR LIFE
What makes things alive? CRITERIA FOR LIFE Learning Goals I can determine if something is alive based on the criteria for life. I can describe the history of life on Earth. I can describe how organisms
Summary Finding Order in Diversity Modern Evolutionary Classification
( Is (.'I.isiifiuilimi Summary 18-1 Finding Order in Diversity There are millions of different species on Earth. To study this great diversity of organisms, biologists must give each organ ism a name.
Classification Systems. - Taxonomy
Classification Systems - Taxonomy Why Classify? 2.5 million kinds of organisms Not complete- 20 million organisms estimated Must divide into manageable groups To work with the diversity of life we need
Unit 8 Classification
Unit 8 Classification Chapter 18: Classification www.pearsonrealize.com 18.1 Finding Order in Diversity (510) 18.2 Modern Evolutionary Classification (516) 18.3 Building the Tree of Life (523) Name: Teacher:
8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
Adv. Biology: Classification Unit Study Guide
Adv. Biology: Classification Unit Study Guide Chapter 17 and 24.1-24.2 All notes/handouts/activities from class Early taxonomists: Aristotle/Linnaeus o Aristotle (394-32 B.C.) a Greek Philosopher, who
Chapter 17. Organizing Life's Diversity
Chapter 17 Organizing Life's Diversity Key Concepts: Chapter 17 1. List the 3 domains and the 6 kingdoms. 2. Our current system of classification was originally based on structures; scientists now base
Organizing Life s Diversity Section 17.1 Classification
Organizing Life s Diversity Section 17.1 Classification Scan Section 1 of your book. Write three questions that come to mind from reading the headings and the illustration captions. 1. 2. 3. Review species
How are living things classified?
Classification Systems How are living things classified?! Learning Goals 12, 13, 14, 15 & 16 on your rubric! TAXONOMY: The study of classification, or how living things are grouped! Aristotle classified
CH. 18 Classification
CH. 18 Classification Name:_ 1. Biologists use a classification system to group organisms in part because organisms a. are going extinct. b. are very numerous and diverse. c. are too much alike. d. share
9/19/2012. Chapter 17 Organizing Life s Diversity. Early Systems of Classification
Section 1: The History of Classification Section 2: Modern Classification Section 3: Domains and Kingdoms Click on a lesson name to select. Early Systems of Classification Biologists use a system of classification
PSI Biology Classification Classification
Classification Classification & Naming Classwork 1. What is the correct order of the current classification hierarchy, from most general to most specific? 2. Are two organisms in domain more or less closely
Chapter 18 Systematics: Seeking Order Amidst Diversity
Chapter 18 Systematics: Seeking Order Amidst Diversity Bird Diversity in Indonesia Chapter 18 At a Glance 18.1 How Are Organisms Named and Classified? 18.2 What Are the Domains of Life? 18.1 How Are Organisms
What is classification?
Classification Table of Contents Objectives Explain why and how organisms are classified. List the eight levels of classification. Explain scientific names. Describe how dichotomous keys help in identifying
Station 1. Explain how scientists use each item below to determine the evolutionary relationships among organisms. 1. Structural similarities:
Station 1 Explain how scientists use each item below to determine the evolutionary relationships among organisms. 1. Structural similarities: 2. Breeding behavior: 3. Geographical distribution: 4. Chromosome
Taxonomy. The science of naming organisms.
Taxonomy The science of naming organisms. Why Classify? Aristotle Did It Plant or animal? If an animal, does it Fly Swim Crawl Simple classifications Used common names Carolus Linnaeus did it better
Evolution and Taxonomy Laboratory
Evolution and Taxonomy Laboratory 1 Introduction Evolution refers to the process by which forms of life have changed through time by what is described as descent with modification. Evolution explains the
Evolution and Biodiversity 5.3- Classification and Biodiversity
Essential idea: Species are named and classified using an internationally agreed system. Evolution and Biodiversity 5.3- Classification and Biodiversity Nature of science: Cooperation and collaboration
2 Big Challenges of Classification
Classification Classification Classify to group things together based on similarities Why Classify? To make organisms/items easier to identify To make organisms/items easier to compare Allows us to predict
Classification. Essential Question Why is it important to place living things into categories?
Classification Essential Question Why is it important to place living things into categories? Compare and contrast Taxonomy comparison 18.1 History of Taxonomy Objectives Describe Aristotle s classification
6 Kingdoms 1.Eubacteria 2.Archaebacteria 3.Protista 4.Fungi 5.Plantae 6.Animalia "Dear King Phillip Came Over From Greece Saturday"
Unit 7 Classification & Plants What you Need to Know: Classification: Classification, Taxonomy, Binomial Nomenclature + Scientific Names, Kingdoms, Cladograms, Kingdoms and Domains // Characteristics of
Biology Test Review: Classification/Taxonomy
Name: Period: Biology Test Review: Classification/Taxonomy MAKE SURE YOUR BOOKLET IS COMPLETELY FINISHED! If you are missing information, it can be found on your teacher s webpage. I. Definitions Try to
Introduction. Recall: 1) Life is both similar and diverse 2) Evolution helps us understand who is related to who
Biology 11 Taxonomy Objectives By the end of the lesson you should be able to: State the levels of classification and the man who created the classification system Describe the 3 domains and the 4 kingdoms
The Tree of Life. Phylogeny
The Tree of Life Phylogeny Phylogenetics Phylogenetic trees illustrate the evolutionary relationships among groups of organisms, or among a family of related nucleic acid or protein sequences Each branch
Organizing Life on Earth
Organizing Life on Earth Inquire: Organizing Life on Earth Overview Scientists continually obtain new information that helps to understand the evolutionary history of life on Earth. Each group of organisms
Biology 2201 Unit Test Holy Spirit High Mr. Pretty Name: ANSWER KEY
Biology 2201 Unit Test Holy Spirit High Mr. Pretty Name: ANSWER KEY 1.) Which of the following increases as you proceed down classification levels from kingdom to species? A) Activity B) Diversity among
Classification of organisms. The grouping of objects or information based on similarities Taxonomy: branch of biology that classifies organisms
Bell Work: Think about your CD, video game, DVD or book collection at home. How would you separate this collection into different groups? What would the groups be? Try to come up with 4 or 5. Classification
Biology Unit 02 Biodiversity Section 01 Test Taxonomy/Classification
Biology 2201(A) Unit 02 Biodiversity Page 1 of 12 Biology 2201 Unit 02 Biodiversity Section 01 Test Taxonomy/Classification Instructions for Students: 1. This test is composed of two parts. Part 1 consists
Building the Tree of Life
18.3 Building the Tree of Life Changing Ideas About Kingdoms This diagram shows some of the ways in which organisms have been classified into kingdoms since the 1700s. Three Domains Genetic analysis has
Kingdoms in Eukarya: Protista, Fungi, Plantae, & Animalia Each Eukarya kingdom has distinguishing characteristics:
NAME pg. 1 Classification Domain Kingdom Phylum Class Order Family Genus species Eukarya Animalia Chordata Mammalia Primate Hominidae Homo sapiens Mnemonic: DUMB KING PHILIP CAME OVER FOR GOOD SOUP Domain
The Tree of Life Classification Based on Evolutionary Relationships Modern classification is based on evolutionary relationships.
CHAPTER 17 The Tree of Life GETTING READY TO LEARN Preview Key Concepts 17.1 The Linnaean System of Classification Organisms can be classified based on physical similarities. 17.2 Classification Based
Classification. A. Why classify?
Classification A. Why classify? 1. Organize in a meaningful way Too many living things to talk about without organization 2. Universal naming All scientists everywhere use the one same name. For example:
Chapter 18: Classification Structured Notes
Chapter 18: Classification Structured Notes Why Classify? 1) ) Taxon = Taxonomy = Field of biology that deals with classifying and naming organisms Taxonomist = is a scientists who determines relationships
1. Construct and use dichotomous keys to identify organisms. 2. Define scientific name and the binomial system of nomenclature.
OBJECTIVE SHEET TAXONOMY 1. Construct and use dichotomous keys to identify organisms. 2. Define scientific name and the binomial system of nomenclature. 3. Name and describe the general characteristics
Vocabulary Classification the process of arranging organisms into groups based on similarities Taxonomy the science of naming and classifying
Classification.. Vocabulary Classification the process of arranging organisms into groups based on similarities Taxonomy the science of naming and classifying organisms trait a characteristic or behavior
Biologists use a system of classification to organize information about the diversity of living things.
Section 1: Biologists use a system of classification to organize information about the diversity of living things. K What I Know W What I Want to Find Out L What I Learned Essential Questions What are
CHAPTER 10 Taxonomy and Phylogeny of Animals
CHAPTER 10 Taxonomy and Phylogeny of Animals 10-1 10-2 Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. Linnaeus and Taxonomy More than 1.5 million species of
Classification Classification key Kingdom Organism Species Class Genus Binomial Nomenclature
Classification Classification key Kingdom Organism Species Class Genus Binomial Nomenclature Plants Animals Protists Fungi Scientific Name Eubacteria Archeobacteria Domain What does it mean to classify
Zoology. Classification
Zoology Zoology involves studying all aspects of organisms belonging to the animal kingdom taxonomy, animal physiology, comparative anatomy, and ecology. Our study of Zoology will be focused on the different
CLASSIFICATION. Similarities and Differences
CLASSIFICATION Similarities and Differences TEKS 8A: Students will define taxonomy and recognize the importance of a standard system to the scientific community 8B: Students will categorize organisms using
The Tree of Life. Chapter 17
The Tree of Life Chapter 17 1 17.1 Taxonomy The science of naming and classifying organisms 2000 years ago Aristotle Grouped plants and animals Based on structural similarities Greeks and Romans included
Speciation and Classification
Speciation and Classification Species- a group of organisms capable of interbreeding and producing fertile offspring Forming a new species Each population of a single species lives in a different place.
Unit 5: Taxonomy. KEY CONCEPT Organisms can be classified based on physical similarities.
KEY CONCEPT Organisms can be classified based on physical similarities. Linnaeus developed the scientific naming system still used today. Taxonomy is the science of naming and classifying organisms. White
When I vomit it Makes me want To throw up That s so Escher!? Famous. I Love Words That Rhyme With Bipalicontorsinectomy
When I vomit it Makes me want To throw up That s so Escher!? I Love Words That Rhyme With Bipalicontorsinectomy High Fructose Pancreas Destroyer YUM? Famous Weasel Oligarchies. Well perhaps famous Is a
Chapter 19 Organizing Information About Species: Taxonomy and Cladistics
Chapter 19 Organizing Information About Species: Taxonomy and Cladistics An unexpected family tree. What are the evolutionary relationships among a human, a mushroom, and a tulip? Molecular systematics
The practice of naming and classifying organisms is called taxonomy.
Chapter 18 Key Idea: Biologists use taxonomic systems to organize their knowledge of organisms. These systems attempt to provide consistent ways to name and categorize organisms. The practice of naming
Need for systematics. Applications of systematics. Linnaeus plus Darwin. Approaches in systematics. Principles of cladistics
Topics Need for systematics Applications of systematics Linnaeus plus Darwin Approaches in systematics Principles of cladistics Systematics pp. 474-475. Systematics - Study of diversity and evolutionary
Classification of Living Things
Classification of Living Things What is classification? Classification: putting things into orderly groups based on similar characteristics. Ways we classify things Supermarket aisles Libraries Classes
Chapter 26. Phylogeny and the Tree of Life. Lecture Presentations by Nicole Tunbridge and Kathleen Fitzpatrick Pearson Education, Inc.
Chapter 26 Phylogeny and the Tree of Life Lecture Presentations by Nicole Tunbridge and Kathleen Fitzpatrick Investigating the Tree of Life Phylogeny is the evolutionary history of a species or group of
Unit 9: Taxonomy (Classification) Notes
Name Exam Date Class Unit 9: Taxonomy (Classification) Notes What is Classification? is when we place organisms into based on their. Classification is also known as. Taxonomists are scientists that & organisms
TAXONOMY. The Science of Classifying Organisms
TAXONOMY The Science of Classifying Organisms Why do we need to classify? Imagine a store..how do you know where to find the milk or the cereal? Are they in the same aisle? How is the store organized?
Friday April 8 th 2016
Friday April 8 th 2016 Warm-Up Select a highlighter. Get a bottle of glue. Update your Table of Contents (see whiteboard). Today In Science Classification Presentation and Notes How many different types
Chapter 18 Classification
Chapter 18 Classification 18.1 Finding Order in Diversity I. Assigning Scientific Names Common names confusing=varies w/lang & location Scientific name (latin) same worldwide The many names of Boletus
What is the purpose of the Classifying System? To allow the accurate identification of a particular organism
What is the purpose of the Classifying System? To allow the accurate identification of a particular organism Taxonomy The practice of classifying organisms -Taxonomy was founded nearly 300 years ago by
Name Class Date. In the space provided, write the letter of the description that best matches the term or phrase.
Assessment Chapter Test B Classification of Organisms In the space provided, write the letter of the description that best matches the term or phrase. 1. Archaea 2. Bacteria a. kingdom; includes Euglena
TAXONOMY. The Science of Classifying Organisms
TAXONOMY The Science of Classifying Organisms Why do we need to classify? Imagine a store..how do you know where to find the milk or the cereal? Are they in the same aisle? How is the store organized?