Molecular Clocks. The Holy Grail. Rate Constancy? Protein Variability. Evidence for Rate Constancy in Hemoglobin. Given

Size: px
Start display at page:

Download "Molecular Clocks. The Holy Grail. Rate Constancy? Protein Variability. Evidence for Rate Constancy in Hemoglobin. Given"

Transcription

1 Molecular Clocks Rose Hoberman The Holy Grail Fossil evidence is sparse and imprecise (or nonexistent) Predict divergence times by comparing molecular data Given a phylogenetic tree branch lengths (rt) a time estimate for one (or more) node C D R M 110 MYA H Rate Constancy? Can we date other nodes in the tree? Yes... if the rate of molecular change is constant across all branches Page & Holmes p240 Protein Variability Protein structures & functions differ Proportion of neutral sites differ Rate constancy does not hold across different protein types However... Each protein does appear to have a characteristic rate of evolution Evidence for Rate Constancy in Hemoglobin Large carniverous marsupial Page and Holmes p229 1

2 The Molecular Clock Hypothesis Amount of genetic difference between sequences is a function of time since separation. Rate of molecular change is constant (enough) to predict times of divergence Outline Methods for estimating time under a molecular clock Estimating genetic distance Determining and using calibration points Sources of error Rate heterogeneity reasons for variation how its taken into account when estimating times Reliability of time estimates Estimating gene duplication times Measuring Evolutionary time with a molecular clock 1. Estimate genetic distance d = number amino acid replacements 2. Use paleontological data to determine date of common ancestor T = time since divergence 3. Estimate calibration rate (number of genetic changes expected per unit time) r = d / 2T 4. Calculate time of divergence for novel sequences T_ij = d_ij / 2r Estimating Genetic Differences If all nt equally likely, observed difference would plateau at 0.75 Simply counting differences underestimates distances Fails to count for multiple hits (Page & Holmes p148) Estimating Genetic Distance with a Substitution Model accounts for relative frequency of different types of substitutions allows variation in substitution rates between sites given learned parameter values nucleotide frequencies transition/transversion bias alpha parameter of gamma distribution can infer branch length from differences Distances from Gamma-Distributed Rates rate variation among sites fast/variable sites 3 rd codon positions codons on surface of globular protein slow/invariant sites Trytophan (1 codon) structurally required 1 st or 2 nd codon position when di-sulfide bond needed alpha parameter of gamma distribution describes degree of variation of rates across positions modeling rate variation changes branch length/ sequence differences curve 2

3 Gamma Corrected Distances high rate sites saturate quickly sequence difference rises much more slowly as the low-rate sites gradually accumulate differences Felsenstein Inferring Phylogenies p219 The Sloppy Clock Ticks are stochastic, not deterministic Mutations happen randomly according to a Poisson distribution. Many divergence times can result in the same number of mutations Actually over-dispersed Poisson Correlations due to structural constraints Poisson Variance (Assuming A Pefect Molecular Clock) If mutation every MY Poisson variance 95% lineages 15 MYA old have 8-22 substitutions 8 substitutions also could be 5 MYA Molecular Systematics p532 Need for Calibrations Changes = rate*time Can explain any observed branch length Fast rate, short time Slow rate, long time Suppose 16 changes along a branch Could be 2 * 8 or 8 * 2 No way to distinguish If told time = 8, then rate = 2 Assume rate=2 along all branches Can infer all times Estimating Calibration Rate Calculate separate rate for each data set (species/genes) using known date of divergence (from fossil, biogeography) One calibration point Rate = d/2t More than one calibration point use regression use generative model that constrains time estimates (more later) Calibration Complexities Cannot date fossils perfectly Fossils usually not direct ancestors branched off tree before (after?) splitting event. Impossible to pinpoint the age of last common ancestor of a group of living species 3

4 Linear Regression Fix intercept at (0,0) Fit line between divergence estimates and calibration times Calculate regression and prediction confidence limits Molecular Systematics p536 Molecular Dating Sources of Error Both X and Y values only estimates substitution model could be incorrect tree could be incorrect errors in orthology assignment Poisson variance is large Pairwise divergences correlated (Systematics p534?) inflates correlation between divergence & time Sometimes calibrations correlated if using derived calibration points Error in inferring slope Confidence interval for predictions much larger than confidence interval for slope Rate Heterogeneity Rate of molecular evolution can differ between nucleotide positions genes genomic regions genomes (nuclear vs organelle), species species over time If not considered, introduces bias into time estimates Rate Heterogeneity among Lineages Cause Repair equipment Metabolic rate Generation time Population size Reason e.g. RNA viruses have error-prone polymerases More free radicals Copies DNA more frequently Effects mutation fixation rate Local Clocks? Closely related species often share similar properties, likely to have similar rates For example murid rodents on average 2-6 times faster than apes and humans (Graur & Li p150) mouse and rat rates are nearly equal (Graur & Li p146) Rate Changes within a Lineage Cause Population size changes Strength of selection changes over time Reason Genetic drift more likely to fix neutral alleles in small population 1. new role/environment 2. gene duplication 3. change in another gene 4

5 Working Around Rate Heterogeneity 1. Identify lineages that deviate and remove them 2. Quantify degree of rate variation to put limits on possible divergence dates requires several calibration dates, not always available gives very conservative estimates of molecular dates 3. Explicity model rate variation Search for Genes with Uniform Rate across Taxa Many clock tests: Relative rates tests compares rates of sister nodes using an outgroup Tajima test Number of sites in which character shared by outgroup and only one of two ingroups should be equal for both ingroups Branch length test deviation of distance from root to leaf compared to average distance Likelihood ratio test identifies deviance from clock but not the deviant sequences Likelihood Ratio Test estimate a phylogeny under molecular clock and without it e.g. root-to-tip distances must be equal difference in likelihood ~ 2*Chi^2 with n-2 degrees of freedom asymptotically when models are nested when nested parameters aren t set to boundary Relative Rates Tests Tests whether distance between two taxa and an outgroup are equal (or average rate of two clades vs an outgroup) need to compute expected variance many triples to consider, and not independent Lacks power, esp short sequences low rates of change Given length and number of variable sites in typical sequences used for dating, (Bronham et al 2000) says: unlikely to detect moderate variation between lineages (1.5-4x) likely to result in substantial error in date estimates Modeling Rate Variation Relaxing the Molecular Clock D E F Learn rates and times, not just M branch lengths A B C Assume root-to-tip times equal Allow different rates on different branches Rates of descendants correlate with that of common acnestor Restricts choice of rates, but still too much flexibility to choose rates well R N Relaxing the Molecular Clock Likelihood analysis Assign each branch a rate parameter explosion of parameters, not realistic User can partition branches based on domain knowledge Rates of partitions are independent Nonparametric methods smooth rates along tree Bayesian approach stochastic model of evolutionary change prior distribution of rates Bayes theorem MCMC 5

6 Parsimonious Approaches Sanderson 1997, 2002 infer branch lengths via parsimony fit divergence times to minimize difference between rates in successive branches (unique solution?) Cutler 2000 infer branch lengths via parsimony rates drawn from a normal distribution (negative rates set to zero) Bayesian Approaches Learn rates, times, and substitution parameters simultaneously Devise model of relationship between rates Thorne/Kishino et al Assigns new rates to descendant lineages from a lognormal distribution with mean equal to ancestral rate and variance increasing with branch length Huelsenbeck et al Poisson process generates random rate changes along tree new rate is current rate * gamma-distributed random variable Comparison of Likelihood & Bayesan Approaches for Estimating Divergence Times (Yang & Yoder 2003) Analyzed two mitochondrial genes each codon position treated separately tested different model assumptions used 7 calibration points Neither model reliable when using only one codon position using a single model for all positions Results similar for both methods using the most complex model use separate parameters for each codon position (could use codon model?) Sources of Error/Variance Lack of rate constancy (due to lineage, population size or selection effects) Wrong assumptions in evolutionary model Errors in orthology assignment Incorrect tree Stochastic variability Imprecision of calibration points Imprecision of regression Human sloppiness in analysis self-fulfilling prophecies Reading the entrails of chickens (Graur and Martin 2004) single calibration point error bars removed from calibration points standard error bars instead of 95% confidence intervals secondary/tertiary calibration points treated as reliable and precise based on incorrect initial estimates variance increases with distance from original estimate few proteins used Multiple Gene Loci Trying to estimate time of divergence from one protein is like trying to estimate the average height of humans by measuring one human --Molecular Systematics p539 Use multiple genes! (and multiple calibration points) 6

7 Even so... Be Very Wary Of Molecular Times Point estimates are absurd Sample errors often based only on the difference between estimates in the same study Even estimates with confidence intervals unlikely to really capture all sources of variance McLysaght, Hokamp, Wolfe 2002 Dating Human Gene Duplications [758] Trees generated (ML method using PAM matrix) [602] Alpha parameter for gamma distribution learned (Gu and Zhang 1997) faster than ML, more accurate than parsimony Thrown out if variance > mean. Why would this happen? May be problematic to apply this model for gene family evolution because of the possible functional divergence among paralogous genes [481] NJ trees built from Gamma-corrected distances Family kept only if worm/fly group together [191] Two-cluster test of rate constancy (Takezaki et al 1995) Blanc, Hokamp, Wolfe Dating Arabadopsis Duplications Create nucleotide alignments Estimate Level of Synonymous substitutions (Yang s ML method) per site? per synonymous site? Ks values > 10 ignored (Yang; Anisimova) Why used different method than for human? How reliable is ranking of Ks values? How much variance expected? Ks > 10 unreliable? Yang (abstract) calculates effect of evolutionary rate on accuracy of phylogenic reconstruction Anisimova calculates accuracy and power of LRT in detecting adaptive molecular evolution Neither seems to give any cutoff regarding ds > 10. Future Improvements Calculate accurate confidence intervals taking into account multiple sources of variance Novel models that account for variation in rates between taxa Build explicit models that predict rates based on an understanding of the underlying processes that generate differences in substitutions rates General References Reviews/Critiques 1. Bronham and Penny. The modern molecular clock, Nature review in genetics?, Graur and Martin. Reading the entrails of chickens...the illusion of precision. Trends in Genetics, Textbooks: 1. Molecular Systematics. 2 nd edition. Edited by Hillis, Moritz, and Mable. 2. Inferring Phylogenies. Felsenstein. 3. Molecular Evolution, a phylogenetic approach. Page and Holmes. 7

8 Rate Heterogeneity References Dealing with Rate Heterogeneity 1. Yang and Yoder. Comparison of likelihood and bayesian methods for estimating divergence times... Syst. Biol, Kishino, Thorne, and Bruno. Performance of a divergence time estimation method under a probabilistic model of rate evolution. Mol. Biol. Evol, Huelsenbeck, Larget, and Swofford. A compound poisson process for relaxing the molecular clock. Genetics, Testing for Rate heterogeneity 1. Takezaki, Rzhetsky and Nei. Phylogenetic test of the molecular clock and linearized trees. Mol. Bio. Evol., Bronham, Penny, Rambaut, and Hendy. The power of relative rates test depends on the data. J Mol Evol, Dating Duplications References Dating duplications: McLysaght, Hokamp, and Wolfe. Extensive genomic duplication during early chordate evolution. Nature Genetics?, Blanc, Hokamp, and Wolfe. Recent polyploidy superimposed on older large-scale duplications in the Arabidopsis genome. Genome Research, Reference used for dating duplications in above papers Gu and Zhang. A simple method for estimating the parameter of substitution rate variation among sites. Mol. Biol. Evol., Yang Z. On the best evolutionary rate for phylogenetic analysis. Syst. Biol, Anisimova, Bielawski, Yang. Accuracy and power of the likelihood ratio test in detecting adaptive molecular evolution. Mol. Biol. Evol., Relative vs Absolute Rates M. Systematics p540 Differences in rates of divergence among lineages detract only from methods of analysis that require clocklike behavior of molecules, and alternative methods of analysis exist for all applications of molecular systematics except for the absolute estimation of time. t1 = 2 * t2 still requires clocklike behavior? Synonymous vs Nonsynonymous Distance Syn sites are sites where a nt change does not cause an AA change only ~25% of sites, so become saturated more quickly Between proteins more variation in non-synonymous rates Within same protein more variation in synonymous rates Which are used? What is effect? Two-cluster Test Takezaki, Rzhetsky and Nei (1995?) estimate tree for each nonroot interior node: calculate average rate for both descendant clades test equality of rates (using variance & covariance of branch lengths) [doesn t appear to correct for multiple testing] move up from leaves, eliminating a cluster if not equal finally, linear tree created reestimate branch lengths under clock constraint Neutral Hypothesis Most mutations have no influence on fitness of the organism Advantageous mutations rare Deleterious mutations rapidly removed Greatest proportion of mutations have no effect on protein function Rate of change is thus affected only by mutation rate, and so should be relatively constant within a species Variation in rate among genes b/c differences in selective constraints 8

9 Mutation Rate in Nuclear Genes of Mammals (Yang & Nielsen 1997) Acid phosphotase Myelin Proteolipid Interleukin 6 IGF binding 1 Thrombomodulin Average ds (P) ds (R) dn (P) dn(r) Perfect Molecular Clock Change linear function time (substitutions ~ Poisson) Rates constant (positions/lineages) Tree perfect Molecular distance estimated perfectly Calibration dates without error Regression (time vs substitutions) without error Yang, effect of evol. rate abstract Yang calculates effect of evolutionary rate on accuracy of phylogenic reconstruction simulation study branch length = expected total number nt substitutions per site (not synonymous?) estimates proportion of correctly recovered branch partitions optimum levels of sequence divergence were even higher than previously suggested for saturation of substitutions, indicating that the problem of saturation may have been exaggerated Bayesian parametric estimation Density function for x, given the training data set ( n) 1 N X = x x {,..., } ( ) ( ) ( n n p x X ) p( x, θ X ) d From the definition of conditional probability densities p X p X p X ( x, θ ) = ( x θ, ) ( θ ). ( ) ( ) ( ) The first factor is independent of X (n) since it just our ( n) assumed form p( x θ, X ) p( x θ ) for parameterized density. Therefore ( ) ( ) ( n n p x X ) p( x ) p( X ) d = = θ θ θ θ Bayesian parametric estimation Instead of choosing a specific value θ, the Bayesian approach performs a weighted average over all values of θ. ( n) If the weighting factor p( θ X ), which is a posterior of θ peaks very sharply about some value we obtain ( n) $θ p( x X ) p( x $ θ ). Thus the optimal estimator is the most likely value of θ given the data and the prior of θ. The Holy Grail Fossil evidence is sparse and imprecise (or nonexistent) Predict divergence times by comparing molecular data 9

C3020 Molecular Evolution. Exercises #3: Phylogenetics

C3020 Molecular Evolution. Exercises #3: Phylogenetics C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from

More information

Concepts and Methods in Molecular Divergence Time Estimation

Concepts and Methods in Molecular Divergence Time Estimation Concepts and Methods in Molecular Divergence Time Estimation 26 November 2012 Prashant P. Sharma American Museum of Natural History Overview 1. Why do we date trees? 2. The molecular clock 3. Local clocks

More information

Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2018 University of California, Berkeley

Integrative Biology 200 PRINCIPLES OF PHYLOGENETICS Spring 2018 University of California, Berkeley Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2018 University of California, Berkeley B.D. Mishler Feb. 14, 2018. Phylogenetic trees VI: Dating in the 21st century: clocks, & calibrations;

More information

Dr. Amira A. AL-Hosary

Dr. Amira A. AL-Hosary Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

More information

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological

More information

CHAPTERS 24-25: Evidence for Evolution and Phylogeny

CHAPTERS 24-25: Evidence for Evolution and Phylogeny CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology

More information

Using phylogenetics to estimate species divergence times... Basics and basic issues for Bayesian inference of divergence times (plus some digression)

Using phylogenetics to estimate species divergence times... Basics and basic issues for Bayesian inference of divergence times (plus some digression) Using phylogenetics to estimate species divergence times... More accurately... Basics and basic issues for Bayesian inference of divergence times (plus some digression) "A comparison of the structures

More information

POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics

POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the

More information

Inferring Speciation Times under an Episodic Molecular Clock

Inferring Speciation Times under an Episodic Molecular Clock Syst. Biol. 56(3):453 466, 2007 Copyright c Society of Systematic Biologists ISSN: 1063-5157 print / 1076-836X online DOI: 10.1080/10635150701420643 Inferring Speciation Times under an Episodic Molecular

More information

Constructing Evolutionary/Phylogenetic Trees

Constructing Evolutionary/Phylogenetic Trees Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood

More information

8/23/2014. Phylogeny and the Tree of Life

8/23/2014. Phylogeny and the Tree of Life Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major

More information

Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata.

Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata. Supplementary Note S2 Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata. Phylogenetic trees reconstructed by a variety of methods from either single-copy orthologous loci (Class

More information

7. Tests for selection

7. Tests for selection Sequence analysis and genomics 7. Tests for selection Dr. Katja Nowick Group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute for Brain Research www. nowicklab.info

More information

Understanding relationship between homologous sequences

Understanding relationship between homologous sequences Molecular Evolution Molecular Evolution How and when were genes and proteins created? How old is a gene? How can we calculate the age of a gene? How did the gene evolve to the present form? What selective

More information

DATING LINEAGES: MOLECULAR AND PALEONTOLOGICAL APPROACHES TO THE TEMPORAL FRAMEWORK OF CLADES

DATING LINEAGES: MOLECULAR AND PALEONTOLOGICAL APPROACHES TO THE TEMPORAL FRAMEWORK OF CLADES Int. J. Plant Sci. 165(4 Suppl.):S7 S21. 2004. Ó 2004 by The University of Chicago. All rights reserved. 1058-5893/2004/1650S4-0002$15.00 DATING LINEAGES: MOLECULAR AND PALEONTOLOGICAL APPROACHES TO THE

More information

Bio 1B Lecture Outline (please print and bring along) Fall, 2007

Bio 1B Lecture Outline (please print and bring along) Fall, 2007 Bio 1B Lecture Outline (please print and bring along) Fall, 2007 B.D. Mishler, Dept. of Integrative Biology 2-6810, bmishler@berkeley.edu Evolution lecture #5 -- Molecular genetics and molecular evolution

More information

Estimating Divergence Dates from Molecular Sequences

Estimating Divergence Dates from Molecular Sequences Estimating Divergence Dates from Molecular Sequences Andrew Rambaut and Lindell Bromham Department of Zoology, University of Oxford The ability to date the time of divergence between lineages using molecular

More information

Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships

Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic

More information

Likelihood Ratio Tests for Detecting Positive Selection and Application to Primate Lysozyme Evolution

Likelihood Ratio Tests for Detecting Positive Selection and Application to Primate Lysozyme Evolution Likelihood Ratio Tests for Detecting Positive Selection and Application to Primate Lysozyme Evolution Ziheng Yang Department of Biology, University College, London An excess of nonsynonymous substitutions

More information

Phylogenetics. BIOL 7711 Computational Bioscience

Phylogenetics. BIOL 7711 Computational Bioscience Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium

More information

Constructing Evolutionary/Phylogenetic Trees

Constructing Evolutionary/Phylogenetic Trees Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood

More information

Assessing an Unknown Evolutionary Process: Effect of Increasing Site- Specific Knowledge Through Taxon Addition

Assessing an Unknown Evolutionary Process: Effect of Increasing Site- Specific Knowledge Through Taxon Addition Assessing an Unknown Evolutionary Process: Effect of Increasing Site- Specific Knowledge Through Taxon Addition David D. Pollock* and William J. Bruno* *Theoretical Biology and Biophysics, Los Alamos National

More information

Lecture Notes: BIOL2007 Molecular Evolution

Lecture Notes: BIOL2007 Molecular Evolution Lecture Notes: BIOL2007 Molecular Evolution Kanchon Dasmahapatra (k.dasmahapatra@ucl.ac.uk) Introduction By now we all are familiar and understand, or think we understand, how evolution works on traits

More information

Letter to the Editor. Department of Biology, Arizona State University

Letter to the Editor. Department of Biology, Arizona State University Letter to the Editor Traditional Phylogenetic Reconstruction Methods Reconstruct Shallow and Deep Evolutionary Relationships Equally Well Michael S. Rosenberg and Sudhir Kumar Department of Biology, Arizona

More information

UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)

UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the

More information

Letter to the Editor. Temperature Hypotheses. David P. Mindell, Alec Knight,? Christine Baer,$ and Christopher J. Huddlestons

Letter to the Editor. Temperature Hypotheses. David P. Mindell, Alec Knight,? Christine Baer,$ and Christopher J. Huddlestons Letter to the Editor Slow Rates of Molecular Evolution Temperature Hypotheses in Birds and the Metabolic Rate and Body David P. Mindell, Alec Knight,? Christine Baer,$ and Christopher J. Huddlestons *Department

More information

Inferring phylogeny. Constructing phylogenetic trees. Tõnu Margus. Bioinformatics MTAT

Inferring phylogeny. Constructing phylogenetic trees. Tõnu Margus. Bioinformatics MTAT Inferring phylogeny Constructing phylogenetic trees Tõnu Margus Contents What is phylogeny? How/why it is possible to infer it? Representing evolutionary relationships on trees What type questions questions

More information

Some of these slides have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks!

Some of these slides have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks! Some of these slides have been borrowed from Dr. Paul Lewis, Dr. Joe Felsenstein. Thanks! Paul has many great tools for teaching phylogenetics at his web site: http://hydrodictyon.eeb.uconn.edu/people/plewis

More information

"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky

Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally

More information

Phylogenetic inference

Phylogenetic inference Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types

More information

Lecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) p.1/30

Lecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) p.1/30 Lecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) Joe Felsenstein Department of Genome Sciences and Department of Biology Lecture 27. Phylogeny methods, part 7 (Bootstraps, etc.) p.1/30 A non-phylogeny

More information

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species

More information

Accuracy and Power of the Likelihood Ratio Test in Detecting Adaptive Molecular Evolution

Accuracy and Power of the Likelihood Ratio Test in Detecting Adaptive Molecular Evolution Accuracy and Power of the Likelihood Ratio Test in Detecting Adaptive Molecular Evolution Maria Anisimova, Joseph P. Bielawski, and Ziheng Yang Department of Biology, Galton Laboratory, University College

More information

GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.

GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS. !! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory

More information

EVOLUTIONARY DISTANCES

EVOLUTIONARY DISTANCES EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:

More information

Phylogenetic Tree Reconstruction

Phylogenetic Tree Reconstruction I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven

More information

Bioinformatics tools for phylogeny and visualization. Yanbin Yin

Bioinformatics tools for phylogeny and visualization. Yanbin Yin Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and

More information

Consensus Methods. * You are only responsible for the first two

Consensus Methods. * You are only responsible for the first two Consensus Trees * consensus trees reconcile clades from different trees * consensus is a conservative estimate of phylogeny that emphasizes points of agreement * philosophy: agreement among data sets is

More information

FUNDAMENTALS OF MOLECULAR EVOLUTION

FUNDAMENTALS OF MOLECULAR EVOLUTION FUNDAMENTALS OF MOLECULAR EVOLUTION Second Edition Dan Graur TELAVIV UNIVERSITY Wen-Hsiung Li UNIVERSITY OF CHICAGO SINAUER ASSOCIATES, INC., Publishers Sunderland, Massachusetts Contents Preface xiii

More information

Lecture 11 Friday, October 21, 2011

Lecture 11 Friday, October 21, 2011 Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system

More information

T R K V CCU CG A AAA GUC T R K V CCU CGG AAA GUC. T Q K V CCU C AG AAA GUC (Amino-acid

T R K V CCU CG A AAA GUC T R K V CCU CGG AAA GUC. T Q K V CCU C AG AAA GUC (Amino-acid Lecture 11 Increasing Model Complexity I. Introduction. At this point, we ve increased the complexity of models of substitution considerably, but we re still left with the assumption that rates are uniform

More information

SEQUENCE DIVERGENCE,FUNCTIONAL CONSTRAINT, AND SELECTION IN PROTEIN EVOLUTION

SEQUENCE DIVERGENCE,FUNCTIONAL CONSTRAINT, AND SELECTION IN PROTEIN EVOLUTION Annu. Rev. Genomics Hum. Genet. 2003. 4:213 35 doi: 10.1146/annurev.genom.4.020303.162528 Copyright c 2003 by Annual Reviews. All rights reserved First published online as a Review in Advance on June 4,

More information

Efficiencies of maximum likelihood methods of phylogenetic inferences when different substitution models are used

Efficiencies of maximum likelihood methods of phylogenetic inferences when different substitution models are used Molecular Phylogenetics and Evolution 31 (2004) 865 873 MOLECULAR PHYLOGENETICS AND EVOLUTION www.elsevier.com/locate/ympev Efficiencies of maximum likelihood methods of phylogenetic inferences when different

More information

A (short) introduction to phylogenetics

A (short) introduction to phylogenetics A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field

More information

Q1) Explain how background selection and genetic hitchhiking could explain the positive correlation between genetic diversity and recombination rate.

Q1) Explain how background selection and genetic hitchhiking could explain the positive correlation between genetic diversity and recombination rate. OEB 242 Exam Practice Problems Answer Key Q1) Explain how background selection and genetic hitchhiking could explain the positive correlation between genetic diversity and recombination rate. First, recall

More information

Reconstructing the history of lineages

Reconstructing the history of lineages Reconstructing the history of lineages Class outline Systematics Phylogenetic systematics Phylogenetic trees and maps Class outline Definitions Systematics Phylogenetic systematics/cladistics Systematics

More information

Processes of Evolution

Processes of Evolution 15 Processes of Evolution Forces of Evolution Concept 15.4 Selection Can Be Stabilizing, Directional, or Disruptive Natural selection can act on quantitative traits in three ways: Stabilizing selection

More information

Maximum Likelihood Estimation on Large Phylogenies and Analysis of Adaptive Evolution in Human Influenza Virus A

Maximum Likelihood Estimation on Large Phylogenies and Analysis of Adaptive Evolution in Human Influenza Virus A J Mol Evol (2000) 51:423 432 DOI: 10.1007/s002390010105 Springer-Verlag New York Inc. 2000 Maximum Likelihood Estimation on Large Phylogenies and Analysis of Adaptive Evolution in Human Influenza Virus

More information

Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline

Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying

More information

Intraspecific gene genealogies: trees grafting into networks

Intraspecific gene genealogies: trees grafting into networks Intraspecific gene genealogies: trees grafting into networks by David Posada & Keith A. Crandall Kessy Abarenkov Tartu, 2004 Article describes: Population genetics principles Intraspecific genetic variation

More information

Natural selection on the molecular level

Natural selection on the molecular level Natural selection on the molecular level Fundamentals of molecular evolution How DNA and protein sequences evolve? Genetic variability in evolution } Mutations } forming novel alleles } Inversions } change

More information

Maximum Likelihood Until recently the newest method. Popularized by Joseph Felsenstein, Seattle, Washington.

Maximum Likelihood Until recently the newest method. Popularized by Joseph Felsenstein, Seattle, Washington. Maximum Likelihood This presentation is based almost entirely on Peter G. Fosters - "The Idiot s Guide to the Zen of Likelihood in a Nutshell in Seven Days for Dummies, Unleashed. http://www.bioinf.org/molsys/data/idiots.pdf

More information

Consistency Index (CI)

Consistency Index (CI) Consistency Index (CI) minimum number of changes divided by the number required on the tree. CI=1 if there is no homoplasy negatively correlated with the number of species sampled Retention Index (RI)

More information

Bootstrapping and Tree reliability. Biol4230 Tues, March 13, 2018 Bill Pearson Pinn 6-057

Bootstrapping and Tree reliability. Biol4230 Tues, March 13, 2018 Bill Pearson Pinn 6-057 Bootstrapping and Tree reliability Biol4230 Tues, March 13, 2018 Bill Pearson wrp@virginia.edu 4-2818 Pinn 6-057 Rooting trees (outgroups) Bootstrapping given a set of sequences sample positions randomly,

More information

Dating r8s, multidistribute

Dating r8s, multidistribute Phylomethods Fall 2006 Dating r8s, multidistribute Jun G. Inoue Software of Dating Molecular Clock Relaxed Molecular Clock r8s multidistribute r8s Michael J. Sanderson UC Davis Estimation of rates and

More information

AUTHOR COPY ONLY. Hetero: a program to simulate the evolution of DNA on a four-taxon tree

AUTHOR COPY ONLY. Hetero: a program to simulate the evolution of DNA on a four-taxon tree APPLICATION NOTE Hetero: a program to simulate the evolution of DNA on a four-taxon tree Lars S Jermiin, 1,2 Simon YW Ho, 1 Faisal Ababneh, 3 John Robinson, 3 Anthony WD Larkum 1,2 1 School of Biological

More information

9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)

9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree) I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by

More information

Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny

More information

Anatomy of a tree. clade is group of organisms with a shared ancestor. a monophyletic group shares a single common ancestor = tapirs-rhinos-horses

Anatomy of a tree. clade is group of organisms with a shared ancestor. a monophyletic group shares a single common ancestor = tapirs-rhinos-horses Anatomy of a tree outgroup: an early branching relative of the interest groups sister taxa: taxa derived from the same recent ancestor polytomy: >2 taxa emerge from a node Anatomy of a tree clade is group

More information

MOLECULAR SYSTEMATICS: A SYNTHESIS OF THE COMMON METHODS AND THE STATE OF KNOWLEDGE

MOLECULAR SYSTEMATICS: A SYNTHESIS OF THE COMMON METHODS AND THE STATE OF KNOWLEDGE CELLULAR & MOLECULAR BIOLOGY LETTERS http://www.cmbl.org.pl Received: 16 August 2009 Volume 15 (2010) pp 311-341 Final form accepted: 01 March 2010 DOI: 10.2478/s11658-010-0010-8 Published online: 19 March

More information

BINF6201/8201. Molecular phylogenetic methods

BINF6201/8201. Molecular phylogenetic methods BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics

More information

METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.

METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern

More information

Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics

Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods

More information

How Molecules Evolve. Advantages of Molecular Data for Tree Building. Advantages of Molecular Data for Tree Building

How Molecules Evolve. Advantages of Molecular Data for Tree Building. Advantages of Molecular Data for Tree Building How Molecules Evolve Guest Lecture: Principles and Methods of Systematic Biology 11 November 2013 Chris Simon Approaching phylogenetics from the point of view of the data Understanding how sequences evolve

More information

PAML 4: Phylogenetic Analysis by Maximum Likelihood

PAML 4: Phylogenetic Analysis by Maximum Likelihood PAML 4: Phylogenetic Analysis by Maximum Likelihood Ziheng Yang* *Department of Biology, Galton Laboratory, University College London, London, United Kingdom PAML, currently in version 4, is a package

More information

MOLECULAR PHYLOGENY AND GENETIC DIVERSITY ANALYSIS. Masatoshi Nei"

MOLECULAR PHYLOGENY AND GENETIC DIVERSITY ANALYSIS. Masatoshi Nei MOLECULAR PHYLOGENY AND GENETIC DIVERSITY ANALYSIS Masatoshi Nei" Abstract: Phylogenetic trees: Recent advances in statistical methods for phylogenetic reconstruction and genetic diversity analysis were

More information

Bootstrap confidence levels for phylogenetic trees B. Efron, E. Halloran, and S. Holmes, 1996

Bootstrap confidence levels for phylogenetic trees B. Efron, E. Halloran, and S. Holmes, 1996 Bootstrap confidence levels for phylogenetic trees B. Efron, E. Halloran, and S. Holmes, 1996 Following Confidence limits on phylogenies: an approach using the bootstrap, J. Felsenstein, 1985 1 I. Short

More information

Phylogenetics: Bayesian Phylogenetic Analysis. COMP Spring 2015 Luay Nakhleh, Rice University

Phylogenetics: Bayesian Phylogenetic Analysis. COMP Spring 2015 Luay Nakhleh, Rice University Phylogenetics: Bayesian Phylogenetic Analysis COMP 571 - Spring 2015 Luay Nakhleh, Rice University Bayes Rule P(X = x Y = y) = P(X = x, Y = y) P(Y = y) = P(X = x)p(y = y X = x) P x P(X = x 0 )P(Y = y X

More information

Phylogenomics. Jeffrey P. Townsend Department of Ecology and Evolutionary Biology Yale University. Tuesday, January 29, 13

Phylogenomics. Jeffrey P. Townsend Department of Ecology and Evolutionary Biology Yale University. Tuesday, January 29, 13 Phylogenomics Jeffrey P. Townsend Department of Ecology and Evolutionary Biology Yale University How may we improve our inferences? How may we improve our inferences? Inferences Data How may we improve

More information

Phylogenetics: Distance Methods. COMP Spring 2015 Luay Nakhleh, Rice University

Phylogenetics: Distance Methods. COMP Spring 2015 Luay Nakhleh, Rice University Phylogenetics: Distance Methods COMP 571 - Spring 2015 Luay Nakhleh, Rice University Outline Evolutionary models and distance corrections Distance-based methods Evolutionary Models and Distance Correction

More information

Estimating the Rate of Evolution of the Rate of Molecular Evolution

Estimating the Rate of Evolution of the Rate of Molecular Evolution Estimating the Rate of Evolution of the Rate of Molecular Evolution Jeffrey L. Thorne,* Hirohisa Kishino, and Ian S. Painter* *Program in Statistical Genetics, Statistics Department, North Carolina State

More information

Multiple Sequence Alignment. Sequences

Multiple Sequence Alignment. Sequences Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe

More information

Systematics - Bio 615

Systematics - Bio 615 Bayesian Phylogenetic Inference 1. Introduction, history 2. Advantages over ML 3. Bayes Rule 4. The Priors 5. Marginal vs Joint estimation 6. MCMC Derek S. Sikes University of Alaska 7. Posteriors vs Bootstrap

More information

Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies

Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies 1 What is phylogeny? Essay written for the course in Markov Chains 2004 Torbjörn Karfunkel Phylogeny is the evolutionary development

More information

RELATING PHYSICOCHEMMICAL PROPERTIES OF AMINO ACIDS TO VARIABLE NUCLEOTIDE SUBSTITUTION PATTERNS AMONG SITES ZIHENG YANG

RELATING PHYSICOCHEMMICAL PROPERTIES OF AMINO ACIDS TO VARIABLE NUCLEOTIDE SUBSTITUTION PATTERNS AMONG SITES ZIHENG YANG RELATING PHYSICOCHEMMICAL PROPERTIES OF AMINO ACIDS TO VARIABLE NUCLEOTIDE SUBSTITUTION PATTERNS AMONG SITES ZIHENG YANG Department of Biology (Galton Laboratory), University College London, 4 Stephenson

More information

Inference of Viral Evolutionary Rates from Molecular Sequences

Inference of Viral Evolutionary Rates from Molecular Sequences Inference of Viral Evolutionary Rates from Molecular Sequences Alexei Drummond 1,2, Oliver G. Pybus 1 and Andrew Rambaut 1 * 1 Department of Zoology, University of Oxford, South Parks Road, Oxford, OX1

More information

1 ATGGGTCTC 2 ATGAGTCTC

1 ATGGGTCTC 2 ATGAGTCTC We need an optimality criterion to choose a best estimate (tree) Other optimality criteria used to choose a best estimate (tree) Parsimony: begins with the assumption that the simplest hypothesis that

More information

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods

More information

molecular evolution and phylogenetics

molecular evolution and phylogenetics molecular evolution and phylogenetics Charlotte Darby Computational Genomics: Applied Comparative Genomics 2.13.18 https://www.thinglink.com/scene/762084640000311296 Internal node Root TIME Branch Leaves

More information

Statistical nonmolecular phylogenetics: can molecular phylogenies illuminate morphological evolution?

Statistical nonmolecular phylogenetics: can molecular phylogenies illuminate morphological evolution? Statistical nonmolecular phylogenetics: can molecular phylogenies illuminate morphological evolution? 30 July 2011. Joe Felsenstein Workshop on Molecular Evolution, MBL, Woods Hole Statistical nonmolecular

More information

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

More information

Introduction to Bioinformatics Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics Dr. rer. nat. Gong Jing Cancer Research Center Medicine School of Shandong University 2012.11.09 1 Chapter 4 Phylogenetic Tree 2 Phylogeny Evidence from morphological ( 形态学的 ), biochemical, and gene sequence

More information

Sequence Divergence & The Molecular Clock. Sequence Divergence

Sequence Divergence & The Molecular Clock. Sequence Divergence Sequence Divergence & The Molecular Clock Sequence Divergence v simple genetic distance, d = the proportion of sites that differ between two aligned, homologous sequences v given a constant mutation/substitution

More information

What Is Conservation?

What Is Conservation? What Is Conservation? Lee A. Newberg February 22, 2005 A Central Dogma Junk DNA mutates at a background rate, but functional DNA exhibits conservation. Today s Question What is this conservation? Lee A.

More information

Letter to the Editor. The Effect of Taxonomic Sampling on Accuracy of Phylogeny Estimation: Test Case of a Known Phylogeny Steven Poe 1

Letter to the Editor. The Effect of Taxonomic Sampling on Accuracy of Phylogeny Estimation: Test Case of a Known Phylogeny Steven Poe 1 Letter to the Editor The Effect of Taxonomic Sampling on Accuracy of Phylogeny Estimation: Test Case of a Known Phylogeny Steven Poe 1 Department of Zoology and Texas Memorial Museum, University of Texas

More information

Estimating Absolute Rates of Molecular Evolution and Divergence Times: A Penalized Likelihood Approach

Estimating Absolute Rates of Molecular Evolution and Divergence Times: A Penalized Likelihood Approach Estimating Absolute Rates of Molecular Evolution and Divergence Times: A Penalized Likelihood Approach Michael J. Sanderson Section of Evolution and Ecology, University of California, Davis Rates of molecular

More information

Unit 7: Evolution Guided Reading Questions (80 pts total)

Unit 7: Evolution Guided Reading Questions (80 pts total) AP Biology Biology, Campbell and Reece, 10th Edition Adapted from chapter reading guides originally created by Lynn Miriello Name: Unit 7: Evolution Guided Reading Questions (80 pts total) Chapter 22 Descent

More information

Lecture 27. Phylogeny methods, part 4 (Models of DNA and protein change) p.1/26

Lecture 27. Phylogeny methods, part 4 (Models of DNA and protein change) p.1/26 Lecture 27. Phylogeny methods, part 4 (Models of DNA and protein change) Joe Felsenstein Department of Genome Sciences and Department of Biology Lecture 27. Phylogeny methods, part 4 (Models of DNA and

More information

Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis

Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis 10 December 2012 - Corrections - Exercise 1 Non-vertebrate chordates generally possess 2 homologs, vertebrates 3 or more gene copies; a Drosophila

More information

Phylogeny and Systematics

Phylogeny and Systematics Chapter 25 Phylogeny and Systematics PowerPoint Lectures for Biology, Seventh Edition Neil Campbell and Jane Reece Lectures by Chris Romero Modified by Maria Morlin racing phylogeny Phylogeny: he evolutionary

More information

Theory of Evolution Charles Darwin

Theory of Evolution Charles Darwin Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties

More information

Phylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki

Phylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki Phylogene)cs IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, 2016 Joyce Nzioki Phylogenetics The study of evolutionary relatedness of organisms. Derived from two Greek words:» Phle/Phylon: Tribe/Race» Genetikos:

More information

Proceedings of the SMBE Tri-National Young Investigators Workshop 2005

Proceedings of the SMBE Tri-National Young Investigators Workshop 2005 Proceedings of the SMBE Tri-National Young Investigators Workshop 25 Control of the False Discovery Rate Applied to the Detection of Positively Selected Amino Acid Sites Stéphane Guindon,* Mik Black,*à

More information

Taming the Beast Workshop

Taming the Beast Workshop Workshop and Chi Zhang June 28, 2016 1 / 19 Species tree Species tree the phylogeny representing the relationships among a group of species Figure adapted from [Rogers and Gibbs, 2014] Gene tree the phylogeny

More information

Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University

Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary

More information

Phylogeny and the Tree of Life

Phylogeny and the Tree of Life LECTURE PRESENTATIONS For CAMPBELL BIOLOGY, NINTH EDITION Jane B. Reece, Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Robert B. Jackson Chapter 26 Phylogeny and the Tree of Life

More information

Chapter 19: Taxonomy, Systematics, and Phylogeny

Chapter 19: Taxonomy, Systematics, and Phylogeny Chapter 19: Taxonomy, Systematics, and Phylogeny AP Curriculum Alignment Chapter 19 expands on the topics of phylogenies and cladograms, which are important to Big Idea 1. In order for students to understand

More information

POPULATION GENETICS Biology 107/207L Winter 2005 Lab 5. Testing for positive Darwinian selection

POPULATION GENETICS Biology 107/207L Winter 2005 Lab 5. Testing for positive Darwinian selection POPULATION GENETICS Biology 107/207L Winter 2005 Lab 5. Testing for positive Darwinian selection A growing number of statistical approaches have been developed to detect natural selection at the DNA sequence

More information

Phylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction. Lesser Tenrec (Echinops telfairi)

Phylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction. Lesser Tenrec (Echinops telfairi) Phylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction Lesser Tenrec (Echinops telfairi) Goals: 1. Use phylogenetic experimental design theory to select optimal taxa to

More information