Sequence Bioinformatics. Multiple Sequence Alignment Waqas Nasir

Size: px
Start display at page:

Download "Sequence Bioinformatics. Multiple Sequence Alignment Waqas Nasir"

Transcription

1 Sequence Bioinformatics Multiple Sequence Alignment Waqas Nasir

2 Multiple Sequence Alignment One amino acid plays coy; a pair of homologous sequences whisper; many aligned sequences shout out loud. (Lesk, 2008) More reliable than pair wise alignments Expose patterns of amino acid conservation Help in better prediction of secondary structure

3 Multiple Sequence Alignment For pairwise alignment we have; How to align 3 or more sequences? How to calculate P abc or P abcd in likelihood ratio? Large amount of data is needed to estimate Is it even possible to obtain optimal multiple sequence alignment?

4 Scoring Schemes Two important features of multiple alignment; Position specific scoring The evolutionary relationship between sequences Enough data is not available to parameterize the evolutionary model Assumption of independence between the columns gives score:

5 Scoring Scheme Minimum Entropy Try to minimize the entropy of the column. The probability of observing residue a in m i can be estimated by; The probability of the column would then be;

6 Scoring Scheme Minimum Entropy

7 Scoring Scheme Minimum Entropy The minimum entropy score for column m i would be; The more variation in the column, the higher the entropy Highly conserved columns give more information Completely conserved column would score 0 Good alignment would minimize the total entropy

8 Scoring Scheme SP scores (Sum of pairs) Independence between columns Score of the column is the sum of all pair wise scores For the column the score becomes; Where s comes from PAM or BLOSSUM

9 Scoring Scheme SP scores (Sum of pairs) The final alignment score would then be; Unrealistic assumption of same evolutionary distance Not enough data to estimate the probabilities of all evolutionary events

10 Scoring Scheme SP scores (Sum of pairs)

11 Multi-dimensional dynamic programming Dynamic programming (D.P.) for multiple sequences Algorithms require a lot of memory High computational cost As many dimensions as the number of sequences Examples of D.P. algorithms include, MSA (Mutliple Sequence Alignment Algorithm) Progressive Alignment (Feng-Doolittle Algorithm)

12 MSA (Multiple Sequence Alignment) Reduces the volume multi-dimensional D.P. matrix Can optimally align up to 7 sequences of residues Makes use of SP scoring scheme The score of multiple alignment is given by;

13 MSA (Multiple Sequence Alignment) Where a kl is the pair wise alignment between sequences k and l. MSA uses lower threshold score β kl Only scores higher than β kl are considered Instead of passing through all the points in DP matrix only those points are added to the search space where the best alignment score > β kl

14 MSA (Multiple Sequence Alignment) Finally multi-dimensional DP algorithm is performed on this subset of hyper-cube.

15 Progressive Alignment The most commonly used approach Uses DP algorithm to align sequences Idea is to start with most related sequences and build on it by adding more sequences and groups Optimal alignment is not guaranteed Fast and efficient, results in reasonable alignments

16 The Feng-Doolittle Algorithm The algorithm works as follows; Perform pair wise alignment of all sequences Convert alignment score to evolutionary distances Construct a guide tree Align the most related sequences in the guide tree Align: The most closely related sequence to the existing alignment OR The next most related pair to each other OR Two sub-alignments (groups)

17 The Feng-Doolittle Algorithm PAM scores and affine gap penalties are used Once a gap, always a gap (Feng & Doolittle, 1987) The highest scoring alignments represent the alignment of the group. The distance D is calculated as follows;

18 Suffix Trees Data structure that represents suffixes of any given string S Defined by a rooted tree with: Every node containing two children except the root No two edges out of a node begin with same character Every edge of the tree defines a non-empty substring of S Facilitates fast retrieval and operations of sub-strings.

19 Example Multiple Sequence Alignment Case study 5.2 (Lesk, 2008)

20

21

22 Structural inferences from MSA The most highly conserved regions probably correspond to the active site Regions rich in EDIT operations probably correspond to surface loops A conserved Gly/Pro column probably represents a turn

23 Structural inferences from MSA A conserved pattern of hydrophobicity with spacing 2 with intervening residues more variable and including hydrophilic residues suggests a Betastrand on the surface. (Residues 50-60) A conserved pattern of hydrophobicity with spacing 4 suggests a helix. (Residues 40-49)

24 References Feng DF, Doolittle RF. Progressive sequence alignment as a prerequisite to correct phylogenetic trees. J Mol Evol. 1987;25(4): Lesk AM. Introduction to Bioinformatics. Oxford University Press Inc., New york. 2008; 3rd Edition; ISBN:

InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9

InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9 Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic

More information

Tools and Algorithms in Bioinformatics

Tools and Algorithms in Bioinformatics Tools and Algorithms in Bioinformatics GCBA815, Fall 2015 Week-4 BLAST Algorithm Continued Multiple Sequence Alignment Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and

More information

5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT

5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT 5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT.03.239 03.10.2012 ALIGNMENT Alignment is the task of locating equivalent regions of two or more sequences to maximize their similarity. Homology:

More information

Copyright 2000 N. AYDIN. All rights reserved. 1

Copyright 2000 N. AYDIN. All rights reserved. 1 Introduction to Bioinformatics Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Multiple Sequence Alignment Outline Multiple sequence alignment introduction to msa methods of msa progressive global alignment

More information

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot

More information

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between

More information

Overview Multiple Sequence Alignment

Overview Multiple Sequence Alignment Overview Multiple Sequence Alignment Inge Jonassen Bioinformatics group Dept. of Informatics, UoB Inge.Jonassen@ii.uib.no Definition/examples Use of alignments The alignment problem scoring alignments

More information

Effects of Gap Open and Gap Extension Penalties

Effects of Gap Open and Gap Extension Penalties Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See

More information

Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:

Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17: Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:50 5001 5 Multiple Sequence Alignment The first part of this exposition is based on the following sources, which are recommended reading:

More information

Basics on bioinforma-cs Lecture 7. Nunzio D Agostino

Basics on bioinforma-cs Lecture 7. Nunzio D Agostino Basics on bioinforma-cs Lecture 7 Nunzio D Agostino nunzio.dagostino@entecra.it; nunzio.dagostino@gmail.com Multiple alignments One sequence plays coy a pair of homologous sequence whisper many aligned

More information

Sequence analysis and Genomics

Sequence analysis and Genomics Sequence analysis and Genomics October 12 th November 23 rd 2 PM 5 PM Prof. Peter Stadler Dr. Katja Nowick Katja: group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute

More information

In-Depth Assessment of Local Sequence Alignment

In-Depth Assessment of Local Sequence Alignment 2012 International Conference on Environment Science and Engieering IPCBEE vol.3 2(2012) (2012)IACSIT Press, Singapoore In-Depth Assessment of Local Sequence Alignment Atoosa Ghahremani and Mahmood A.

More information

Bioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre

Bioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre Bioinformatics Scoring Matrices David Gilbert Bioinformatics Research Centre www.brc.dcs.gla.ac.uk Department of Computing Science, University of Glasgow Learning Objectives To explain the requirement

More information

CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018

CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018 CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of

More information

Sequence Alignment: Scoring Schemes. COMP 571 Luay Nakhleh, Rice University

Sequence Alignment: Scoring Schemes. COMP 571 Luay Nakhleh, Rice University Sequence Alignment: Scoring Schemes COMP 571 Luay Nakhleh, Rice University Scoring Schemes Recall that an alignment score is aimed at providing a scale to measure the degree of similarity (or difference)

More information

Week 10: Homology Modelling (II) - HHpred

Week 10: Homology Modelling (II) - HHpred Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 07: profile Hidden Markov Model http://bibiserv.techfak.uni-bielefeld.de/sadr2/databasesearch/hmmer/profilehmm.gif Slides adapted from Dr. Shaojie Zhang

More information

Pairwise sequence alignment

Pairwise sequence alignment Department of Evolutionary Biology Example Alignment between very similar human alpha- and beta globins: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL G+ +VK+HGKKV A+++++AH+D++ +++++LS+LH KL GNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKL

More information

The PRALINE online server: optimising progressive multiple alignment on the web

The PRALINE online server: optimising progressive multiple alignment on the web Computational Biology and Chemistry 27 (2003) 511 519 Software Note The PRALINE online server: optimising progressive multiple alignment on the web V.A. Simossis a,b, J. Heringa a, a Bioinformatics Unit,

More information

Sequence Analysis 17: lecture 5. Substitution matrices Multiple sequence alignment

Sequence Analysis 17: lecture 5. Substitution matrices Multiple sequence alignment Sequence Analysis 17: lecture 5 Substitution matrices Multiple sequence alignment Substitution matrices Used to score aligned positions, usually of amino acids. Expressed as the log-likelihood ratio of

More information

Phylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches

Phylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell

More information

Quantifying sequence similarity

Quantifying sequence similarity Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity

More information

Multiple Sequence Alignment

Multiple Sequence Alignment Multiple Sequence Alignment BMI/CS 576 www.biostat.wisc.edu/bmi576.html Colin Dewey cdewey@biostat.wisc.edu Multiple Sequence Alignment: Tas Definition Given a set of more than 2 sequences a method for

More information

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison CMPS 6630: Introduction to Computational Biology and Bioinformatics Structure Comparison Protein Structure Comparison Motivation Understand sequence and structure variability Understand Domain architecture

More information

Introduction to Comparative Protein Modeling. Chapter 4 Part I

Introduction to Comparative Protein Modeling. Chapter 4 Part I Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature

More information

Introduction to protein alignments

Introduction to protein alignments Introduction to protein alignments Comparative Analysis of Proteins Experimental evidence from one or more proteins can be used to infer function of related protein(s). Gene A Gene X Protein A compare

More information

Sara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)

Sara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) Bioinformática Sequence Alignment Pairwise Sequence Alignment Universidade da Beira Interior (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) 1 16/3/29 & 23/3/29 27/4/29 Outline

More information

Multiple sequence alignment

Multiple sequence alignment Multiple sequence alignment Multiple sequence alignment: today s goals to define what a multiple sequence alignment is and how it is generated; to describe profile HMMs to introduce databases of multiple

More information

Large-Scale Genomic Surveys

Large-Scale Genomic Surveys Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction

More information

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding

More information

Moreover, the circular logic

Moreover, the circular logic Moreover, the circular logic How do we know what is the right distance without a good alignment? And how do we construct a good alignment without knowing what substitutions were made previously? ATGCGT--GCAAGT

More information

Homology Modeling. Roberto Lins EPFL - summer semester 2005

Homology Modeling. Roberto Lins EPFL - summer semester 2005 Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,

More information

Multiple Sequence Alignments

Multiple Sequence Alignments Multiple Sequence Alignments...... Elements of Bioinformatics Spring, 2003 Tom Carter http://astarte.csustan.edu/ tom/ March, 2003 1 Sequence Alignments Often, we would like to make direct comparisons

More information

Multiple Alignment. Slides revised and adapted to Bioinformática IST Ana Teresa Freitas

Multiple Alignment. Slides revised and adapted to Bioinformática IST Ana Teresa Freitas n Introduction to Bioinformatics lgorithms Multiple lignment Slides revised and adapted to Bioinformática IS 2005 na eresa Freitas n Introduction to Bioinformatics lgorithms Outline Dynamic Programming

More information

BLAST: Basic Local Alignment Search Tool

BLAST: Basic Local Alignment Search Tool .. CSC 448 Bioinformatics Algorithms Alexander Dekhtyar.. (Rapid) Local Sequence Alignment BLAST BLAST: Basic Local Alignment Search Tool BLAST is a family of rapid approximate local alignment algorithms[2].

More information

Multiple Sequence Alignment using Profile HMM

Multiple Sequence Alignment using Profile HMM Multiple Sequence Alignment using Profile HMM. based on Chapter 5 and Section 6.5 from Biological Sequence Analysis by R. Durbin et al., 1998 Acknowledgements: M.Sc. students Beatrice Miron, Oana Răţoi,

More information

Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center

Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods

More information

Sequence analysis and comparison

Sequence analysis and comparison The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species

More information

Sequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013

Sequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013 Sequence Alignments Dynamic programming approaches, scoring, and significance Lucy Skrabanek ICB, WMC January 31, 213 Sequence alignment Compare two (or more) sequences to: Find regions of conservation

More information

Multiple Sequence Alignment

Multiple Sequence Alignment Multiple equence lignment Four ami Khuri Dept of omputer cience an José tate University Multiple equence lignment v Progressive lignment v Guide Tree v lustalw v Toffee v Muscle v MFFT * 20 * 0 * 60 *

More information

Bioinformatics for Computer Scientists (Part 2 Sequence Alignment) Sepp Hochreiter

Bioinformatics for Computer Scientists (Part 2 Sequence Alignment) Sepp Hochreiter Bioinformatics for Computer Scientists (Part 2 Sequence Alignment) Institute of Bioinformatics Johannes Kepler University, Linz, Austria Sequence Alignment 2. Sequence Alignment Sequence Alignment 2.1

More information

Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins

Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins J. Baussand, C. Deremble, A. Carbone Analytical Genomics Laboratoire d Immuno-Biologie Cellulaire

More information

Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment

Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Introduction to Bioinformatics online course : IBT Jonathan Kayondo Learning Objectives Understand

More information

Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science

Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.

More information

Evolutionary Tree Analysis. Overview

Evolutionary Tree Analysis. Overview CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based

More information

Tools and Algorithms in Bioinformatics

Tools and Algorithms in Bioinformatics Tools and Algorithms in Bioinformatics GCBA815, Fall 2013 Week3: Blast Algorithm, theory and practice Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and Systems Biology

More information

Motivating the need for optimal sequence alignments...

Motivating the need for optimal sequence alignments... 1 Motivating the need for optimal sequence alignments... 2 3 Note that this actually combines two objectives of optimal sequence alignments: (i) use the score of the alignment o infer homology; (ii) use

More information

Large Grain Size Stochastic Optimization Alignment

Large Grain Size Stochastic Optimization Alignment Brigham Young University BYU ScholarsArchive All Faculty Publications 2006-10-01 Large Grain Size Stochastic Optimization Alignment Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu

More information

Lecture 5,6 Local sequence alignment

Lecture 5,6 Local sequence alignment Lecture 5,6 Local sequence alignment Chapter 6 in Jones and Pevzner Fall 2018 September 4,6, 2018 Evolution as a tool for biological insight Nothing in biology makes sense except in the light of evolution

More information

Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment

Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value

More information

First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences

First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences 140.638 where do sequences come from? DNA is not hard to extract (getting DNA from a

More information

Pairwise Alignment. Guan-Shieng Huang. Dept. of CSIE, NCNU. Pairwise Alignment p.1/55

Pairwise Alignment. Guan-Shieng Huang. Dept. of CSIE, NCNU. Pairwise Alignment p.1/55 Pairwise Alignment Guan-Shieng Huang shieng@ncnu.edu.tw Dept. of CSIE, NCNU Pairwise Alignment p.1/55 Approach 1. Problem definition 2. Computational method (algorithms) 3. Complexity and performance Pairwise

More information

Today s Lecture: HMMs

Today s Lecture: HMMs Today s Lecture: HMMs Definitions Examples Probability calculations WDAG Dynamic programming algorithms: Forward Viterbi Parameter estimation Viterbi training 1 Hidden Markov Models Probability models

More information

BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University

BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University Measures of Sequence Similarity Alignment with dot

More information

A New Similarity Measure among Protein Sequences

A New Similarity Measure among Protein Sequences A New Similarity Measure among Protein Sequences Kuen-Pin Wu, Hsin-Nan Lin, Ting-Yi Sung and Wen-Lian Hsu * Institute of Information Science Academia Sinica, Taipei 115, Taiwan Abstract Protein sequence

More information

3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT

3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT 3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode

More information

Protein Structure Prediction, Engineering & Design CHEM 430

Protein Structure Prediction, Engineering & Design CHEM 430 Protein Structure Prediction, Engineering & Design CHEM 430 Eero Saarinen The free energy surface of a protein Protein Structure Prediction & Design Full Protein Structure from Sequence - High Alignment

More information

CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I)

CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) Contents Alignment algorithms Needleman-Wunsch (global alignment) Smith-Waterman (local alignment) Heuristic algorithms FASTA BLAST

More information

Pairwise sequence alignments

Pairwise sequence alignments Pairwise sequence alignments Volker Flegel VI, October 2003 Page 1 Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs VI, October

More information

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its

More information

CMPSCI 311: Introduction to Algorithms Second Midterm Exam

CMPSCI 311: Introduction to Algorithms Second Midterm Exam CMPSCI 311: Introduction to Algorithms Second Midterm Exam April 11, 2018. Name: ID: Instructions: Answer the questions directly on the exam pages. Show all your work for each question. Providing more

More information

Neural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha

Neural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this

More information

Algorithms in Bioinformatics: A Practical Introduction. Sequence Similarity

Algorithms in Bioinformatics: A Practical Introduction. Sequence Similarity Algorithms in Bioinformatics: A Practical Introduction Sequence Similarity Earliest Researches in Sequence Comparison Doolittle et al. (Science, July 1983) searched for platelet-derived growth factor (PDGF)

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of omputer Science San José State University San José, alifornia, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Pairwise Sequence Alignment Homology

More information

Ch. 9 Multiple Sequence Alignment (MSA)

Ch. 9 Multiple Sequence Alignment (MSA) Ch. 9 Multiple Sequence Alignment (MSA) - gather seqs. to make MSA - doing MSA with ClustalW - doing MSA with Tcoffee - comparing seqs. that cannot align Introduction - from pairwise alignment to MSA -

More information

CSE 549: Computational Biology. Substitution Matrices

CSE 549: Computational Biology. Substitution Matrices CSE 9: Computational Biology Substitution Matrices How should we score alignments So far, we ve looked at arbitrary schemes for scoring mutations. How can we assign scores in a more meaningful way? Are

More information

Figure A1. Phylogenetic trees based on concatenated sequences of eight MLST loci. Phylogenetic trees were constructed based on concatenated sequences

Figure A1. Phylogenetic trees based on concatenated sequences of eight MLST loci. Phylogenetic trees were constructed based on concatenated sequences A. B. Figure A1. Phylogenetic trees based on concatenated sequences of eight MLST loci. Phylogenetic trees were constructed based on concatenated sequences of eight housekeeping loci for 12 unique STs

More information

Can protein model accuracy be. identified? NO! CBS, BioCentrum, Morten Nielsen, DTU

Can protein model accuracy be. identified? NO! CBS, BioCentrum, Morten Nielsen, DTU Can protein model accuracy be identified? Morten Nielsen, CBS, BioCentrum, DTU NO! Identification of Protein-model accuracy Why is it important? What is accuracy RMSD, fraction correct, Protein model correctness/quality

More information

Study and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis

Study and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis Study and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis Kumud Joseph Kujur, Sumit Pal Singh, O.P. Vyas, Ruchir Bhatia, Varun Singh* Indian Institute of Information

More information

Computational Biology

Computational Biology Computational Biology Lecture 6 31 October 2004 1 Overview Scoring matrices (Thanks to Shannon McWeeney) BLAST algorithm Start sequence alignment 2 1 What is a homologous sequence? A homologous sequence,

More information

Sequence Analysis, '18 -- lecture 9. Families and superfamilies. Sequence weights. Profiles. Logos. Building a representative model for a gene.

Sequence Analysis, '18 -- lecture 9. Families and superfamilies. Sequence weights. Profiles. Logos. Building a representative model for a gene. Sequence Analysis, '18 -- lecture 9 Families and superfamilies. Sequence weights. Profiles. Logos. Building a representative model for a gene. How can I represent thousands of homolog sequences in a compact

More information

20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, Global and local alignment of two sequences using dynamic programming

20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, Global and local alignment of two sequences using dynamic programming 20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, 2008 4 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance 4. Global and local alignment

More information

An Introduction to Sequence Similarity ( Homology ) Searching

An Introduction to Sequence Similarity ( Homology ) Searching An Introduction to Sequence Similarity ( Homology ) Searching Gary D. Stormo 1 UNIT 3.1 1 Washington University, School of Medicine, St. Louis, Missouri ABSTRACT Homologous sequences usually have the same,

More information

Pairwise sequence alignments. Vassilios Ioannidis (From Volker Flegel )

Pairwise sequence alignments. Vassilios Ioannidis (From Volker Flegel ) Pairwise sequence alignments Vassilios Ioannidis (From Volker Flegel ) Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs Importance

More information

Basic Local Alignment Search Tool

Basic Local Alignment Search Tool Basic Local Alignment Search Tool Alignments used to uncover homologies between sequences combined with phylogenetic studies o can determine orthologous and paralogous relationships Local Alignment uses

More information

Sequence Analysis '17- lecture 8. Multiple sequence alignment

Sequence Analysis '17- lecture 8. Multiple sequence alignment Sequence Analysis '17- lecture 8 Multiple sequence alignment Ex5 explanation How many random database search scores have e-values 10? (Answer: 10!) Why? e-value of x = m*p(s x), where m is the database

More information

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded

More information

Comparison of Cost Functions in Sequence Alignment. Ryan Healey

Comparison of Cost Functions in Sequence Alignment. Ryan Healey Comparison of Cost Functions in Sequence Alignment Ryan Healey Use of Cost Functions Used to score and align sequences Mathematically model how sequences mutate and evolve. Evolution and mutation can be

More information

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and

More information

Network alignment and querying

Network alignment and querying Network biology minicourse (part 4) Algorithmic challenges in genomics Network alignment and querying Roded Sharan School of Computer Science, Tel Aviv University Multiple Species PPI Data Rapid growth

More information

Grundlagen der Bioinformatik Summer semester Lecturer: Prof. Daniel Huson

Grundlagen der Bioinformatik Summer semester Lecturer: Prof. Daniel Huson Grundlagen der Bioinformatik, SS 10, D. Huson, April 12, 2010 1 1 Introduction Grundlagen der Bioinformatik Summer semester 2010 Lecturer: Prof. Daniel Huson Office hours: Thursdays 17-18h (Sand 14, C310a)

More information

Sequence comparison: Score matrices

Sequence comparison: Score matrices Sequence comparison: Score matrices http://facultywashingtonedu/jht/gs559_2013/ Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas FYI - informal inductive proof of best

More information

MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE

MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE Manmeet Kaur 1, Navneet Kaur Bawa 2 1 M-tech research scholar (CSE Dept) ACET, Manawala,Asr 2 Associate Professor (CSE Dept) ACET, Manawala,Asr

More information

114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009

114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009 114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009 9 Protein tertiary structure Sources for this chapter, which are all recommended reading: D.W. Mount. Bioinformatics: Sequences and Genome

More information

Multiple Alignment. Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis

Multiple Alignment. Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis Multiple Alignment Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis gorm@cbs.dtu.dk Refresher: pairwise alignments 43.2% identity; Global alignment score: 374 10 20

More information

Bioinformatics. Molecular Biophysics & Biochemistry 447b3 / 747b3. Class 3, 1/19/98. Mark Gerstein. Yale University

Bioinformatics. Molecular Biophysics & Biochemistry 447b3 / 747b3. Class 3, 1/19/98. Mark Gerstein. Yale University Molecular Biophysics & Biochemistry 447b3 / 747b3 Bioinformatics Mark Gerstein Class 3, 1/19/98 Yale University 1 Aligning Text Strings Raw Data??? T C A T G C A T T G 2 matches, 0 gaps T C A T G C A T

More information

Lecture Notes: Markov chains

Lecture Notes: Markov chains Computational Genomics and Molecular Biology, Fall 5 Lecture Notes: Markov chains Dannie Durand At the beginning of the semester, we introduced two simple scoring functions for pairwise alignments: a similarity

More information

Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm. Alignment scoring schemes and theory: substitution matrices and gap models

Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm. Alignment scoring schemes and theory: substitution matrices and gap models Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm Alignment scoring schemes and theory: substitution matrices and gap models 1 Local sequence alignments Local sequence alignments are necessary

More information

CSE182-L7. Protein Sequence Analysis Patterns (regular expressions) Profiles HMM Gene Finding CSE182

CSE182-L7. Protein Sequence Analysis Patterns (regular expressions) Profiles HMM Gene Finding CSE182 CSE182-L7 Protein Sequence Analysis Patterns (regular expressions) Profiles HMM Gene Finding 10-07 CSE182 Bell Labs Honors Pattern matching 10-07 CSE182 Just the Facts Consider the set of all substrings

More information

Substitution matrices

Substitution matrices Introduction to Bioinformatics Substitution matrices Jacques van Helden Jacques.van-Helden@univ-amu.fr Université d Aix-Marseille, France Lab. Technological Advances for Genomics and Clinics (TAGC, INSERM

More information

Dr. Amira A. AL-Hosary

Dr. Amira A. AL-Hosary Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

More information

Multiple Sequence Alignment

Multiple Sequence Alignment Multiple Sequence Alignment Multiple Alignment versus Pairwise Alignment Up until now we have only tried to align two sequences.! What about more than two? And what for?! A faint similarity between two

More information

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas Sequence comparison: Score matrices Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas FYI - informal inductive proof of best alignment path onsider the last step in

More information

Sequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University

Sequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University Sequence Alignment: A General Overview COMP 571 - Fall 2010 Luay Nakhleh, Rice University Life through Evolution All living organisms are related to each other through evolution This means: any pair of

More information

Phylogenetic inference

Phylogenetic inference Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types

More information

Inferring Phylogenetic Trees. Distance Approaches. Representing distances. in rooted and unrooted trees. The distance approach to phylogenies

Inferring Phylogenetic Trees. Distance Approaches. Representing distances. in rooted and unrooted trees. The distance approach to phylogenies Inferring Phylogenetic Trees Distance Approaches Representing distances in rooted and unrooted trees The distance approach to phylogenies given: an n n matrix M where M ij is the distance between taxa

More information

Page 1. References. Hidden Markov models and multiple sequence alignment. Markov chains. Probability review. Example. Markovian sequence

Page 1. References. Hidden Markov models and multiple sequence alignment. Markov chains. Probability review. Example. Markovian sequence Page Hidden Markov models and multiple sequence alignment Russ B Altman BMI 4 CS 74 Some slides borrowed from Scott C Schmidler (BMI graduate student) References Bioinformatics Classic: Krogh et al (994)

More information

Similarity searching summary (2)

Similarity searching summary (2) Similarity searching / sequence alignment summary Biol4230 Thurs, February 22, 2016 Bill Pearson wrp@virginia.edu 4-2818 Pinn 6-057 What have we covered? Homology excess similiarity but no excess similarity

More information

Introduction to Bioinformatics Online Course: IBT

Introduction to Bioinformatics Online Course: IBT Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple

More information

Introduction to Evolutionary Concepts

Introduction to Evolutionary Concepts Introduction to Evolutionary Concepts and VMD/MultiSeq - Part I Zaida (Zan) Luthey-Schulten Dept. Chemistry, Beckman Institute, Biophysics, Institute of Genomics Biology, & Physics NIH Workshop 2009 VMD/MultiSeq

More information