Protein domains, function and associated prediction. Experimental. Protein function categories. Issue when elucidating function experimentally
|
|
- Bartholomew Patterson
- 5 years ago
- Views:
Transcription
1 C E T R E F O R I T E G R A T I V E B I O I F O R M A T I C S V U Lecture 14: Protein domains, function and associated prediction Introduction to Bioinformatics Metabolomics fluxomics Functional Genomics Systems Biology TERTIARY STRUCTURE (fold) TERTIARY STRUCTURE (fold) Genome Expressome Proteome Metabolome Experimental Structural genomics Functional genomics Protein-protein interaction Metabolic pathways Expression data Issue when elucidating function experimentally Typically done through knock-out experiments Partial information (indirect interactions) and subsequent filling of the missing steps egative results (elements that have been shown not to interact, enzymes missing in an organism) Putative interactions resulting from computational analyses Protein function categories Catalysis (enzymes) Binding transport (active/passive) Protein-DA/RA binding (e.g. histones, transcription factors) Protein-protein interactions (e.g. antibody-lysozyme) (experimentally determined by yeast two-hybrid (Y2H) or bacterial two-hybrid (B2H) screening ) Protein-fatty acid binding (e.g. apolipoproteins) Protein small molecules (drug interaction, structure decoding) Structural component (e.g. γ-crystallin) Regulation Signalling Transcription regulation Immune system Motor proteins (actin/myosin) Catalytic properties of enzymes K m k cat Michaelis-Menten equation: Moles/s V max V max/2 E + S ES E + P E = enzyme S = substrate K m ES = enzyme-substrate complex (transition state) P = product K m = Michaelis constant K cat = catalytic rate constant (turnover number) K cat /K m = specificity constant (useful for comparison) V max [S] V = K m + [S] [S] 1
2 Protein interaction domains Energy difference upon binding Examples of protein interactions (and of functional importance) include: Protein protein (pathway analysis); Protein small molecules (drug interaction, structure decoding); Protein peptides, DA/RA The change in Gibb s Free Energy of the protein-ligand binding interaction can be monitored and expressed by the following equation: G = H T S (H=Enthalpy, S=Entropy and T=Temperature) Protein function Many proteins combine functions Some immunoglobulin structures are thought to have more than 100 different functions (and active/binding sites) Alternative splicing can generate (partially) alternative structures Protein function & Interaction Active site / binding cleft Protein function evolution Chymotrypsin From a simple ancestral active site for cutting protein chains to a more elaborate active site with four different features, all helping to optimise proteolysis (cleavage) Shape complementarity Gene duplication has resulted in two-domain protein 2
3 Protein function evolution Chymotrypsin The active site lies between the two domains. It consists of residues on the same two loops (firstly between beta-strands 3 and 4, secondly between beta strands 5 and 6) of each of the two barrel domains. Four features of the active site are indicated in the figure. The Substrate Specificity Pocket Main Chain Substrate-binding The Oxyanion Hole (white) Catalytic triad Chymotrypsin cleaves peptides at the carboxyl side of tyrosine, tryptophan, and phenylalanine because those three amino acids contain phenyl rings. How to infer function Experiment Deduction from sequence Multiple sequence alignment conservation patterns Homology searching Deduction from structure Threading Structure-structure comparison Homology modelling A domain is a: Compact, semi-independent unit (Richardson, 1981). Stable unit of a protein structure that can fold autonomously (Wetlaufer, 1973). Recurring functional and evolutionary module (Bork, 1992). ature is a tinkerer and not an inventor (Jacob, 1977). Smallest unit of function Delineating domains is essential for: Obtaining high resolution structures (x-ray but particularly MR size of proteins) Sequence analysis Multiple sequence alignment methods Prediction algorithms (SS, Class, secondary/tertiary structure) Fold recognition and threading Elucidating the evolution, structure and function of a protein family (e.g. Rosetta Stone method) Structural/functional genomics Cross genome comparative analysis Domain connectivity linker Structural domain organisation can be nasty Pyruvate kinase Phosphotransferase β barrel regulatory domain α/β barrel catalytic substrate binding domain α/β nucleotide binding domain 1 continuous + 2 discontinuous domains 3
4 Domain size The size of individual structural domains varies widely from 36 residues in E-selectin to 692 residues in lipoxygenase-1 (Jones et al., 1998) the majority (90%) having less than 200 residues (Siddiqui and Barton, 1995) with an average of about 100 residues (Islam et al., 1995). Small domains (less than 40 residues) are often stabilised by metal ions or disulphide bonds. Large domains (greater than 300 residues) are likely to consist of multiple hydrophobic cores (Garel, 1992). 4
5 Analysis of chain hydrophobicity in multidomain proteins Analysis of chain hydrophobicity in multidomain proteins Domain characteristics Domains are genetically mobile units, and multidomain families are found in all three kingdoms (Archaea, Bacteria and Eukarya) underlining the finding that ature is a tinkerer and not an inventor (Jacob, 1977). The majority of genomic proteins, 75% in unicellular organisms and more than 80% in metazoa, are multidomain proteins created as a result of gene duplication events (Apic et al., 2001). Domains in multidomain structures are likely to have once existed as independent proteins, and many domains in eukaryotic multidomain proteins can be found as independent proteins in prokaryotes (Davidson et al., 1993). Protein function evolution - Gene (domain) duplication - Active site Chymotrypsin 5
6 Pyruvate phosphate dikinase 3-domain protein Two domains catalyse 2-step reaction A B C Third so-called swivelling domain actively brings intermediate enzymatic product (B) over 45Å from one active site to the other Pyruvate phosphate dikinase 3-domain protein Two domains catalyse 2-step reaction A B C Third so-called swivelling domain actively brings intermediate enzymatic product (B) over 45Å from one active site to the other / The DEATH Domain Present in a variety of Eukaryotic proteins involved with cell death. Six helices enclose a tightly packed hydrophobic core. Some DEATH domains form homotypic and heterotypic dimers. Detecting Structural Domains A structural domain may be detected as a compact, globular substructure with more interactions within itself than with the rest of the structure (Janin and Wodak, 1983). Therefore, a structural domain can be determined by two shape characteristics: compactness and its extent of isolation (Tsai and ussinov, 1997). Measures of local compactness in proteins have been used in many of the early methods of domain assignment (Rossmann et al., 1974; Crippen, 1978; Rose, 1979; Go, 1978) and in several of the more recent methods (Holm and Sander, 1994; Islam et al., 1995; Siddiqui and Barton, 1995; Zehfus, 1997; Taylor, 1999). Detecting Structural Domains However, approaches encounter problems when faced with discontinuous or highly associated domains and many definitions will require manual interpretation. Detecting Domains using Sequence only Even more difficult than prediction from structure! Consequently there are discrepancies between assignments made by domain databases (Hadley and Jones, 1999). 6
7 Integrating protein multiple sequence alignment, secondary and tertiary structure prediction in order to predict structural domain boundaries in sequence data Protein structure hierarchical levels PRIMARY STRUCTURE (amino acid sequence) SECODARY STRUCTURE (helices, strands) VHLTPEEKSAVTALWGKVVDE VGGEALGRLLVVYPWTQRFFE SFGDLSTPDAVMGPKVKAHG KKVLGAFSDGLAHLDLKGTFA TLSELHCDKLHVDPEFRLLG VLVCVLAHHFGKEFTPPVQAAY QKVVAGVAALAHKYH SnapDRAGO Richard A. George George R.A. and Heringa, J. (2002) J. Mol. Biol., 316, QUATERARY STRUCTURE TERTIARY STRUCTURE (fold) Protein structure hierarchical levels PRIMARY STRUCTURE (amino acid sequence) SECODARY STRUCTURE (helices, strands) Protein structure hierarchical levels PRIMARY STRUCTURE (amino acid sequence) SECODARY STRUCTURE (helices, strands) VHLTPEEKSAVTALWGKVVDE VGGEALGRLLVVYPWTQRFFE SFGDLSTPDAVMGPKVKAHG KKVLGAFSDGLAHLDLKGTFA TLSELHCDKLHVDPEFRLLG VLVCVLAHHFGKEFTPPVQAAY QKVVAGVAALAHKYH VHLTPEEKSAVTALWGKVVDE VGGEALGRLLVVYPWTQRFFE SFGDLSTPDAVMGPKVKAHG KKVLGAFSDGLAHLDLKGTFA TLSELHCDKLHVDPEFRLLG VLVCVLAHHFGKEFTPPVQAAY QKVVAGVAALAHKYH QUATERARY STRUCTURE TERTIARY STRUCTURE (fold) QUATERARY STRUCTURE TERTIARY STRUCTURE (fold) Protein structure hierarchical levels PRIMARY STRUCTURE (amino acid sequence) SECODARY STRUCTURE (helices, strands) VHLTPEEKSAVTALWGKVVDE VGGEALGRLLVVYPWTQRFFE SFGDLSTPDAVMGPKVKAHG KKVLGAFSDGLAHLDLKGTFA TLSELHCDKLHVDPEFRLLG VLVCVLAHHFGKEFTPPVQAAY QKVVAGVAALAHKYH SAPDRAGO Domain boundary prediction protocol using sequence information alone (Richard George)! "# $ ##! % #"#! &'((( ) % $ # ##"# ' #% $ # $$ QUATERARY STRUCTURE TERTIARY STRUCTURE (fold) *+, # " '+-!.'/!(,/0 7
8 SnapDragon SAPDRAGO Domain boundary prediction protocol using sequence information alone (Richard George) # 12,-3& # ((4 "$ % " -&5 6&* ((! %132 7* '((( 8 ) 17& *+, # " '+-!.'/!(,/0 Domain prediction using DRAGO Distance Regularisation Algorithm for Geometry Optimisatio (Aszodi & Taylor, 1994) Folded protein models based on the requirement that (conserved) hydrophobic residues cluster together. First construct a random high dimensional Cα distance matrix. Distance geometry is used to find the 3D conformation corresponding to a prescribed target matrix of desired distances between residues. SAPDRAGO Domain boundary prediction protocol using sequence information alone (Richard George) 9: &'(() "# $ ## ; " % ## <##% # ; 1 "# %$ %$ #" β, ; 2" ## 6α 6β = ; "#!" %=" %$ %>% DRAGO = Distance Regularisation Algorithm for Geometry Optimisatio Cα distance matrix Target matrix 3 9)9 100 randomised initial matrices 100 predictions 3 Input data 1- The Cα distance matrix is divided into smaller clusters. Separately, each cluster is embedded into a local centroid. The final predicted structure is generated from full embedding of the multiple centroids and their corresponding local structures. 8
9 # " " 1# # ##, 1-1- Taylor method (1999) DOMAI-3D Taylor method (1999)! % #" #! &'((( Easy and clever method Uses a notion of spin glass theory (disordered magnetic systems) to delineate domains in a protein 3D structure Steps: 1. Take sequence with residue numbers (1..) 2. Look at neighbourhood of each residue (first shell) 3. If ( average nghhood residue number > res no) resno = resno+1 else resno = resno-1 4. If (convergence) then take regions with identical residue number as domains and terminate repeat until convergence if 41 < ( )/5 then Res (up 1) else Res (down 1) Taylor,WR. (1999) Protein structural domain identification. Protein Engineering 12 : Taylor method (1999) Iterate until convergence initial situation SAPDRAGO Domain boundary prediction protocol using sequence information alone (Richard George) ) % $ # ##"# ' #% $ # $ $ continuous discontinuous? i A? E 2"$ *+, # " '+-!.'/!(,/0 W i i 9
10 SAPDRAGO "F 8 6<G H, 8 2" I# % " F 8 & ##% < %" ##%< 8 G0 % # 8 G "# 8 6 <"#% %<#0 8 2"% <G I <" # % SnapDRAGO prediction assessment Test set of 414 multiple alignments;183 single and 231 multiple domain proteins. Boundary predictions are compared to the region of the protein connecting two domains (maximally ±10 residues from true boundary) SnapDRAGO prediction assessment Baseline method I: Divide sequence in equal parts based on number of domains predicted by SnapDRAGO Baseline method II: Similar to Wheelan et al., based on domain length partition density function (PDF) PDF derived from 2750 non-redundant structures (deposited at CBI) Given sequence, calculate probability of onedomain, two-domain,.., protein Highest probability taken and sequence split equally as in baseline method I Average prediction results per protein SnapDRAGO Baseline 1 Baseline 2 Continuous set Discontinuous set Full set Coverage 63.9 (± 43.0) 35.4 (± 25.0) 51.8 (± 39.1) Success 46.8 (± 36.4) 44.4 (± 33.9) 45.8 (± 35.4) Coverage 43.6 (± 45.3) 20.5 (± 27.1) 34.7 (± 40.8) Success 34.3 (± 39.6) 22.2 (± 29.5) 29.6 (± 36.6) Coverage 45.3 (± 46.9) 22.7 (± 27.3) 35.7 (± 41.3) Success 37.1 (± 42.0) 23.1 (± 29.6) 31.2 (± 37.9) Coverage is the % linkers predicted (TP/TP+F) Success is the % of correct predictions made (TP/TP+FP) Average prediction results per protein Protein-protein interaction networks 10
11 Protein Function Prediction How can we get the edges (connections) of the cellular networks? We can predict functions of genes or proteins so we know where they would fit in a metabolic network There are also techniques to predict whether two proteins interact, either functionally (e.g. they are involved in a two-step metabolic process) or directly physically (e.g. are together in a protein complex) Protein Function Prediction The state of the art it s not complete Many genes are not annotated, and many more are partially or erroneously annotated. Given a genome which is partially annotated at best, how do we fill in the blanks? Of each sequenced genome, 20%-50% of the functions of proteins encoded by the genomes remains unknown! How then do we build a reasonably complete networks when the parts list is so incomplete? Protein Function Prediction For all these reasons, improving automated protein function prediction is now a cornerstone of bioinformatics and computational biology ew methods will need to integrate signals coming from sequence, expression, interaction and structural data, etc. Classes of function prediction methods (recap) Sequence based approaches protein A has function X, and protein B is a homolog (ortholog) of protein A; Hence B has function X Structure-based approaches protein A has structure X, and X has so-so structural features; Hence A s function sites are. Motif-based approaches a group of genes have function X and they all have motif Y; protein A has motif Y; Hence protein A s function might be related to X Function prediction based on guilt-by-association gene A has function X and gene B is often associated with gene A, B might have function related to X Phylogenetic profile analysis Function prediction of genes based on guilt-byassociation a non-homologous approach The phylogenetic profile of a protein is a string that encodes the presence or absence of the protein in every sequenced genome Because proteins that participate in a common structural complex or metabolic pathway are likely to co-evolve, the phylogenetic profiles of such proteins are often ``similar' This means that such proteins have a good chance of being physically or metabolically connected Phylogenetic profile analysis Phylogenetic profile (against genomes) For each gene X in a target genome (e.g., E coli), build a phylogenetic profile as follows If gene X has a homolog in genome #i, the ith bit of X s phylogenetic profile is 1 otherwise it is 0 11
12 gene Phylogenetic profile analysis Example phylogenetic profiles based on 60 genomes genome orf1034: orf1036: orf1037: orf1038: orf1039: orf104: orf1040: orf1041: orf1042: orf1043: orf1044: orf1045: orf1046: orf1047: orf105: orf1054: By correlating the rows (open reading frames (ORF) or genes) you find out about joint presence or absence of genes: this is a signal for a functional connection Genes with similar phylogenetic profiles have related functions or functionally linked D Eisenberg and colleagues (1999) Phylogenetic profile analysis Phylogenetic profiles contain great amount of functional information Phlylogenetic profile analysis can be used to distinguish orthologous genes from paralogous genes Example: Subcellular localization: 361 yeast nucleusencoded mitochondrial proteins were identified at 50% accuracy with 58% coverage through phylogenetic profile analysis Functional complementarity: By examining inverse phylogenetic profiles, one can find functionally complementary genes that might have evolved through one of several mechanisms of convergent evolution. Phylogenetic profiling typically has low accuracy (specificity) but can have high coverage. Domain fusion example n Vertebrates have a multi-enzyme protein (GARs- AIRs-GARt) comprising the enzymes GAR synthetase (GARs), AIR synthetase (AIRs), and GAR transformylase (GARt) n In insects, the polypeptide appears as GARs- (AIRs) 2 -GARt nin yeast, GARs-AIRs is encoded separately from GARt nin bacteria each domain is encoded separately (Henikoff et al., 1997). GAR: glycinamide ribonucleotide AIR: aminoimidazole ribonucleotide Using observed domain fusion for prediction of protein-protein interactions Rosetta stone method Gene fusion is the an effective method for prediction of protein-protein interactions If proteins A and B are homologous to two domains of a multidomain protein C, A and B are predicted to have interaction A Though gene-fusion has low prediction coverage, its false-positive rate is low (high specificity) B C Protein interaction database There are numerous databases of protein-protein interactions DIP is a popular protein-protein interaction database The DIP database catalogs experimentally determined interactions between proteins. It combines information from a variety of sources to create a single, consistent set of protein-protein interactions. Protein interaction databases BID - Biomolecular Interaction etwork Database DIP - Database of Interacting Proteins PIM Hybrigenics PathCalling Yeast Interaction Database MIT - a Molecular Interactions Database GRID - The General Repository for Interaction Datasets InterPreTS - protein interaction prediction through tertiary structure STRIG - predicted functional associations among genes/proteins Mammalian protein-protein interaction database (PPI) InterDom - database of putative interacting protein domains FusionDB - database of bacterial and archaeal gene fusion events IntAct Project The Human Protein Interaction Database (HPID) ADVICE - Automated Detection and Validation of Interaction by Co-evolution InterWeaver - protein interaction reports with online evidence PathBLAST - alignment of protein interaction networks ClusPro - a fully automated algorithm for protein-protein docking HPRD - Human Protein Reference Database 12
13 Protein interaction database etwork of protein interactions and predicted functional links involving silencing information regulator (SIR) proteins. Filled circles represent proteins of known function; open circles represent proteins of unknown function, represented only by their Saccharomyces genome sequence numbers ( Solid lines show experimentally determined interactions, as summarized in the Database of Interacting Proteins 19 ( Dashed lines show functional links predicted by the Rosetta Stone method 12. Dotted lines show functional links predicted by phylogenetic profiles 16. Some predicted links are omitted for clarity. etwork of predicted functional linkages involving the yeast prion protein 20 Sup35. The dashed line shows the only experimentally determined interaction. The other functional links were calculated from genome and expression data 11 by a combination of methods, including phylogenetic profiles, Rosetta stone linkages and mra expression. Linkages predicted by more than one method, and hence particularly reliable, are shown by heavy lines. Adapted from ref. 11. STRIG - predicted functional associations among genes/proteins STRIG is a database of predicted functional associations among genes/proteins. Genes of similar function tend to be maintained in close neighborhood, tend to be present or absent together, i.e. to have the same phylogenetic occurrence, and can sometimes be found fused into a single gene encoding a combined polypeptide. STRIG integrates this information from as many genomes as possible to predict functional links between proteins. Berend Snel (UU), Martijn Huynen (RU) and the group of Peer Bork (EMBL, Heidelberg) STRIG - predicted functional associations among genes/proteins STRIG is a database of known and predicted protein-protein interactions. The interactions include direct (physical) and indirect (functional) associations; they are derived from four sources: STRIG - predicted functional associations among genes/proteins Conserved eighborhood 1. Genomic Context (Synteny) 2. High-throughput Experiments 3. (Conserved) Co-expression 4. Previous Knowledge STRIG quantitatively integrates interaction data from these sources for a large number of organisms, and transfers information between these organisms where applicable. The database currently contains proteins in 179 species This view shows runs of genes that occur repeatedly in close neighborhood in (prokaryotic) genomes. Genes located together in a run are linked with a black line (maximum allowed intergenic distance is 300 bp). ote that if there are multiple runs for a given species, these are separated by white space. If there are other genes in the run that are below the current score threshold, they are drawn as small white triangles. Gene fusion occurences are also drawn, but only if they are present in a run. 13
14 Wrapping up Understand chymotrypsin example: evolution via gene duplication of an optimised two-domain barrel enzyme with active site residues from either domain. Understand domain issues: structural and functional Understand the basic steps of the Snap-DRAGO method for domain boundary prediction but no need to memorize it all Understand phylogenetic profiling and the Rosetta Stone method (guilt-by-association) Understand that conservation patterns in the order of genes that are nearby on the genome (synteny) indicate functional relationships (used in STRIG method) Also co-expression (genes being expressed (or not) at the same time) indicates a functional relationship (used in STRIG method) 14
CSCE555 Bioinformatics. Protein Function Annotation
CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The
More informationComputational methods for predicting protein-protein interactions
Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational
More informationIntracellular Networks
C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Intracellular Networks (2) Intracellular Network Behaviour Slides on: http://www.ibi.vu.nl/teaching/masters/icn/icn_2008.php Networks
More informationC E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 5 G R A T I V. Pair-wise Sequence Alignment
C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Introduction to bioinformatics 2007 Lecture 5 Pair-wise Sequence Alignment Bioinformatics Nothing in Biology makes sense except in
More informationComputational approaches for functional genomics
Computational approaches for functional genomics Kalin Vetsigian October 31, 2001 The rapidly increasing number of completely sequenced genomes have stimulated the development of new methods for finding
More information2 Genome evolution: gene fusion versus gene fission
2 Genome evolution: gene fusion versus gene fission Berend Snel, Peer Bork and Martijn A. Huynen Trends in Genetics 16 (2000) 9-11 13 Chapter 2 Introduction With the advent of complete genome sequencing,
More informationHomology Modeling. Roberto Lins EPFL - summer semester 2005
Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,
More informationFrom gene to protein. Premedical biology
From gene to protein Premedical biology Central dogma of Biology, Molecular Biology, Genetics transcription replication reverse transcription translation DNA RNA Protein RNA chemically similar to DNA,
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein
More informationProtein Structure. W. M. Grogan, Ph.D. OBJECTIVES
Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate
More informationLecture 18 June 2 nd, Gene Expression Regulation Mutations
Lecture 18 June 2 nd, 2016 Gene Expression Regulation Mutations From Gene to Protein Central Dogma Replication DNA RNA PROTEIN Transcription Translation RNA Viruses: genome is RNA Reverse Transcriptase
More informationGenome Annotation. Bioinformatics and Computational Biology. Genome sequencing Assembly. Gene prediction. Protein targeting.
Genome Annotation Bioinformatics and Computational Biology Genome Annotation Frank Oliver Glöckner 1 Genome Analysis Roadmap Genome sequencing Assembly Gene prediction Protein targeting trna prediction
More informationNewly made RNA is called primary transcript and is modified in three ways before leaving the nucleus:
m Eukaryotic mrna processing Newly made RNA is called primary transcript and is modified in three ways before leaving the nucleus: Cap structure a modified guanine base is added to the 5 end. Poly-A tail
More informationProteomics. Yeast two hybrid. Proteomics - PAGE techniques. Data obtained. What is it?
Proteomics What is it? Reveal protein interactions Protein profiling in a sample Yeast two hybrid screening High throughput 2D PAGE Automatic analysis of 2D Page Yeast two hybrid Use two mating strains
More informationBasics of protein structure
Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu
More informationStructure to Function. Molecular Bioinformatics, X3, 2006
Structure to Function Molecular Bioinformatics, X3, 2006 Structural GeNOMICS Structural Genomics project aims at determination of 3D structures of all proteins: - organize known proteins into families
More informationOrganization of Genes Differs in Prokaryotic and Eukaryotic DNA Chapter 10 p
Organization of Genes Differs in Prokaryotic and Eukaryotic DNA Chapter 10 p.110-114 Arrangement of information in DNA----- requirements for RNA Common arrangement of protein-coding genes in prokaryotes=
More informationProtein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche
Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its
More informationBioinformatics Chapter 1. Introduction
Bioinformatics Chapter 1. Introduction Outline! Biological Data in Digital Symbol Sequences! Genomes Diversity, Size, and Structure! Proteins and Proteomes! On the Information Content of Biological Sequences!
More information4 Examples of enzymes
Catalysis 1 4 Examples of enzymes Adding water to a substrate: Serine proteases. Carbonic anhydrase. Restrictions Endonuclease. Transfer of a Phosphoryl group from ATP to a nucleotide. Nucleoside monophosphate
More informationComputational Biology: Basics & Interesting Problems
Computational Biology: Basics & Interesting Problems Summary Sources of information Biological concepts: structure & terminology Sequencing Gene finding Protein structure prediction Sources of information
More informationBioinformatics 2. Yeast two hybrid. Proteomics. Proteomics
GENOME Bioinformatics 2 Proteomics protein-gene PROTEOME protein-protein METABOLISM Slide from http://www.nd.edu/~networks/ Citrate Cycle Bio-chemical reactions What is it? Proteomics Reveal protein Protein
More informationHonors Biology Reading Guide Chapter 11
Honors Biology Reading Guide Chapter 11 v Promoter a specific nucleotide sequence in DNA located near the start of a gene that is the binding site for RNA polymerase and the place where transcription begins
More informationBasic structures of proteins
Basic structures of proteins Structural Hierarchy of Protein Primary structure Functional elements : α-helix, strands, β-sheet, loops.. - Structure, affinity, activity, specificity, stability etc. Secondary
More informationMotif Prediction in Amino Acid Interaction Networks
Motif Prediction in Amino Acid Interaction Networks Omar GACI and Stefan BALEV Abstract In this paper we represent a protein as a graph where the vertices are amino acids and the edges are interactions
More informationGenomics and bioinformatics summary. Finding genes -- computer searches
Genomics and bioinformatics summary 1. Gene finding: computer searches, cdnas, ESTs, 2. Microarrays 3. Use BLAST to find homologous sequences 4. Multiple sequence alignments (MSAs) 5. Trees quantify sequence
More informationAdvanced Certificate in Principles in Protein Structure. You will be given a start time with your exam instructions
BIRKBECK COLLEGE (University of London) Advanced Certificate in Principles in Protein Structure MSc Structural Molecular Biology Date: Thursday, 1st September 2011 Time: 3 hours You will be given a start
More informationOverview of Kinetics
Overview of Kinetics [P] t = ν = k[s] Velocity of reaction Conc. of reactant(s) Rate of reaction M/sec Rate constant sec -1, M -1 sec -1 1 st order reaction-rate depends on concentration of one reactant
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr
More informationIntroduction to Bioinformatics Integrated Science, 11/9/05
1 Introduction to Bioinformatics Integrated Science, 11/9/05 Morris Levy Biological Sciences Research: Evolutionary Ecology, Plant- Fungal Pathogen Interactions Coordinator: BIOL 495S/CS490B/STAT490B Introduction
More informationGene regulation I Biochemistry 302. Bob Kelm February 25, 2005
Gene regulation I Biochemistry 302 Bob Kelm February 25, 2005 Principles of gene regulation (cellular versus molecular level) Extracellular signals Chemical (e.g. hormones, growth factors) Environmental
More informationComparative Bioinformatics Midterm II Fall 2004
Comparative Bioinformatics Midterm II Fall 2004 Objective Answer, part I: For each of the following, select the single best answer or completion of the phrase. (3 points each) 1. Deinococcus radiodurans
More informationSequence analysis and comparison
The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species
More informationPredicting Protein Functions and Domain Interactions from Protein Interactions
Predicting Protein Functions and Domain Interactions from Protein Interactions Fengzhu Sun, PhD Center for Computational and Experimental Genomics University of Southern California Outline High-throughput
More informationTypes of biological networks. I. Intra-cellurar networks
Types of biological networks I. Intra-cellurar networks 1 Some intra-cellular networks: 1. Metabolic networks 2. Transcriptional regulation networks 3. Cell signalling networks 4. Protein-protein interaction
More informationGenomes and Their Evolution
Chapter 21 Genomes and Their Evolution PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison
CMPS 6630: Introduction to Computational Biology and Bioinformatics Structure Comparison Protein Structure Comparison Motivation Understand sequence and structure variability Understand Domain architecture
More informationReading Assignments. A. Genes and the Synthesis of Polypeptides. Lecture Series 7 From DNA to Protein: Genotype to Phenotype
Lecture Series 7 From DNA to Protein: Genotype to Phenotype Reading Assignments Read Chapter 7 From DNA to Protein A. Genes and the Synthesis of Polypeptides Genes are made up of DNA and are expressed
More informationChapter 15 Active Reading Guide Regulation of Gene Expression
Name: AP Biology Mr. Croft Chapter 15 Active Reading Guide Regulation of Gene Expression The overview for Chapter 15 introduces the idea that while all cells of an organism have all genes in the genome,
More informationComputational Biology 1
Computational Biology 1 Protein Function & nzyme inetics Guna Rajagopal, Bioinformatics Institute, guna@bii.a-star.edu.sg References : Molecular Biology of the Cell, 4 th d. Alberts et. al. Pg. 129 190
More informationIntroduction. Gene expression is the combined process of :
1 To know and explain: Regulation of Bacterial Gene Expression Constitutive ( house keeping) vs. Controllable genes OPERON structure and its role in gene regulation Regulation of Eukaryotic Gene Expression
More informationTypes of RNA. 1. Messenger RNA(mRNA): 1. Represents only 5% of the total RNA in the cell.
RNAs L.Os. Know the different types of RNA & their relative concentration Know the structure of each RNA Understand their functions Know their locations in the cell Understand the differences between prokaryotic
More informationHomology and Information Gathering and Domain Annotation for Proteins
Homology and Information Gathering and Domain Annotation for Proteins Outline Homology Information Gathering for Proteins Domain Annotation for Proteins Examples and exercises The concept of homology The
More informationMETHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
More informationChemogenomic: Approaches to Rational Drug Design. Jonas Skjødt Møller
Chemogenomic: Approaches to Rational Drug Design Jonas Skjødt Møller Chemogenomic Chemistry Biology Chemical biology Medical chemistry Chemical genetics Chemoinformatics Bioinformatics Chemoproteomics
More informationBiological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor
Biological Networks:,, and via Relative Description Length By: Tamir Tuller & Benny Chor Presented by: Noga Grebla Content of the presentation Presenting the goals of the research Reviewing basic terms
More informationLecture 15: Enzymes & Kinetics. Mechanisms ROLE OF THE TRANSITION STATE. H-O-H + Cl - H-O δ- H Cl δ- HO - + H-Cl. Margaret A. Daugherty.
Lecture 15: Enzymes & Kinetics Mechanisms Margaret A. Daugherty Fall 2004 ROLE OF THE TRANSITION STATE Consider the reaction: H-O-H + Cl - H-O δ- H Cl δ- HO - + H-Cl Reactants Transition state Products
More informationLecture 26: Polymers: DNA Packing and Protein folding 26.1 Problem Set 4 due today. Reading for Lectures 22 24: PKT Chapter 8 [ ].
Lecture 26: Polymers: DA Packing and Protein folding 26.1 Problem Set 4 due today. eading for Lectures 22 24: PKT hapter 8 DA Packing for Eukaryotes: The packing problem for the larger eukaryotic genomes
More informationINTERACTIVE CLUSTERING FOR EXPLORATION OF GENOMIC DATA
INTERACTIVE CLUSTERING FOR EXPLORATION OF GENOMIC DATA XIUFENG WAN xw6@cs.msstate.edu Department of Computer Science Box 9637 JOHN A. BOYLE jab@ra.msstate.edu Department of Biochemistry and Molecular Biology
More informationLecture 11: Enzymes: Kinetics [PDF] Reading: Berg, Tymoczko & Stryer, Chapter 8, pp
Lecture 11: Enzymes: Kinetics [PDF] Reading: Berg, Tymoczko & Stryer, Chapter 8, pp. 216-225 Updated on: 2/4/07 at 9:00 pm Key Concepts Kinetics is the study of reaction rates. Study of enzyme kinetics
More informationUNIT 6 PART 3 *REGULATION USING OPERONS* Hillis Textbook, CH 11
UNIT 6 PART 3 *REGULATION USING OPERONS* Hillis Textbook, CH 11 REVIEW: Signals that Start and Stop Transcription and Translation BUT, HOW DO CELLS CONTROL WHICH GENES ARE EXPRESSED AND WHEN? First of
More informationBasic Local Alignment Search Tool
Basic Local Alignment Search Tool Alignments used to uncover homologies between sequences combined with phylogenetic studies o can determine orthologous and paralogous relationships Local Alignment uses
More informationIntroduction to" Protein Structure
Introduction to" Protein Structure Function, evolution & experimental methods Thomas Blicher, Center for Biological Sequence Analysis Learning Objectives Outline the basic levels of protein structure.
More informationCAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools. Giri Narasimhan
CAP 5510: Introduction to Bioinformatics CGS 5166: Bioinformatics Tools Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinff18.html Proteins and Protein Structure
More informationBiomolecules: lecture 10
Biomolecules: lecture 10 - understanding in detail how protein 3D structures form - realize that protein molecules are not static wire models but instead dynamic, where in principle every atom moves (yet
More informationExploring Evolution & Bioinformatics
Chapter 6 Exploring Evolution & Bioinformatics Jane Goodall The human sequence (red) differs from the chimpanzee sequence (blue) in only one amino acid in a protein chain of 153 residues for myoglobin
More informationBME 5742 Biosystems Modeling and Control
BME 5742 Biosystems Modeling and Control Lecture 24 Unregulated Gene Expression Model Dr. Zvi Roth (FAU) 1 The genetic material inside a cell, encoded in its DNA, governs the response of a cell to various
More informationMotivating the need for optimal sequence alignments...
1 Motivating the need for optimal sequence alignments... 2 3 Note that this actually combines two objectives of optimal sequence alignments: (i) use the score of the alignment o infer homology; (ii) use
More informationIntroduction to Evolutionary Concepts
Introduction to Evolutionary Concepts and VMD/MultiSeq - Part I Zaida (Zan) Luthey-Schulten Dept. Chemistry, Beckman Institute, Biophysics, Institute of Genomics Biology, & Physics NIH Workshop 2009 VMD/MultiSeq
More informationCHEM 3653 Exam # 1 (03/07/13)
1. Using phylogeny all living organisms can be divided into the following domains: A. Bacteria, Eukarya, and Vertebrate B. Archaea and Eukarya C. Bacteria, Eukarya, and Archaea D. Eukarya and Bacteria
More informationComparative genomics: Overview & Tools + MUMmer algorithm
Comparative genomics: Overview & Tools + MUMmer algorithm Urmila Kulkarni-Kale Bioinformatics Centre University of Pune, Pune 411 007. urmila@bioinfo.ernet.in Genome sequence: Fact file 1995: The first
More informationUnderstanding Sequence, Structure and Function Relationships and the Resulting Redundancy
Understanding Sequence, Structure and Function Relationships and the Resulting Redundancy many slides by Philip E. Bourne Department of Pharmacology, UCSD Agenda Understand the relationship between sequence,
More information10-810: Advanced Algorithms and Models for Computational Biology. microrna and Whole Genome Comparison
10-810: Advanced Algorithms and Models for Computational Biology microrna and Whole Genome Comparison Central Dogma: 90s Transcription factors DNA transcription mrna translation Proteins Central Dogma:
More informationNetworks & pathways. Hedi Peterson MTAT Bioinformatics
Networks & pathways Hedi Peterson (peterson@quretec.com) MTAT.03.239 Bioinformatics 03.11.2010 Networks are graphs Nodes Edges Edges Directed, undirected, weighted Nodes Genes Proteins Metabolites Enzymes
More informationC a h p a t p e t r e r 6 E z n y z m y e m s
Chapter 6 Enzymes 4. Examples of enzymatic reactions acid-base catalysis: give and take protons covalent catalysis: a transient covalent bond is formed between the enzyme and the substrate metal ion catalysis:
More information# shared OGs (spa, spb) Size of the smallest genome. dist (spa, spb) = 1. Neighbor joining. OG1 OG2 OG3 OG4 sp sp sp
Bioinformatics and Evolutionary Genomics: Genome Evolution in terms of Gene Content 3/10/2014 1 Gene Content Evolution What about HGT / genome sizes? Genome trees based on gene content: shared genes Haemophilus
More information3.B.1 Gene Regulation. Gene regulation results in differential gene expression, leading to cell specialization.
3.B.1 Gene Regulation Gene regulation results in differential gene expression, leading to cell specialization. We will focus on gene regulation in prokaryotes first. Gene regulation accounts for some of
More informationGraph Alignment and Biological Networks
Graph Alignment and Biological Networks Johannes Berg http://www.uni-koeln.de/ berg Institute for Theoretical Physics University of Cologne Germany p.1/12 Networks in molecular biology New large-scale
More informationIntro Secondary structure Transmembrane proteins Function End. Last time. Domains Hidden Markov Models
Last time Domains Hidden Markov Models Today Secondary structure Transmembrane proteins Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL
More informationToday. Last time. Secondary structure Transmembrane proteins. Domains Hidden Markov Models. Structure prediction. Secondary structure
Last time Today Domains Hidden Markov Models Structure prediction NAD-specific glutamate dehydrogenase Hard Easy >P24295 DHE2_CLOSY MSKYVDRVIAEVEKKYADEPEFVQTVEEVL SSLGPVVDAHPEYEEVALLERMVIPERVIE FRVPWEDDNGKVHVNTGYRVQFNGAIGPYK
More informationC a h p a t p e t r e r 6 E z n y z m y e m s
Chapter 6 Enzymes 1. An Introduction to Enzymes Enzymes are catalytically active biological macromolecules Enzymes are catalysts of biological systems Almost every biochemical reaction is catalyzed by
More informationMolecular Biology, Genetic Engineering & Biotechnology Operons ???
1 Description of Module Subject Name?? Paper Name Module Name/Title XV- 04: 2 OPERONS OBJECTIVES To understand how gene is expressed and regulated in prokaryotic cell To understand the regulation of Lactose
More informationBiol478/ August
Biol478/595 29 August # Day Inst. Topic Hwk Reading August 1 M 25 MG Introduction 2 W 27 MG Sequences and Evolution Handouts 3 F 29 MG Sequences and Evolution September M 1 Labor Day 4 W 3 MG Database
More informationQuiz answers. Allele. BIO 5099: Molecular Biology for Computer Scientists (et al) Lecture 17: The Quiz (and back to Eukaryotic DNA)
BIO 5099: Molecular Biology for Computer Scientists (et al) Lecture 17: The Quiz (and back to Eukaryotic DNA) http://compbio.uchsc.edu/hunter/bio5099 Larry.Hunter@uchsc.edu Quiz answers Kinase: An enzyme
More informationUE Praktikum Bioinformatik
UE Praktikum Bioinformatik WS 08/09 University of Vienna 7SK snrna 7SK was discovered as an abundant small nuclear RNA in the mid 70s but a possible function has only recently been suggested. Two independent
More informationFlow of Genetic Information
presents Flow of Genetic Information A Montagud E Navarro P Fernández de Córdoba JF Urchueguía Elements Nucleic acid DNA RNA building block structure & organization genome building block types Amino acid
More informationSequence Alignment Techniques and Their Uses
Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this
More informationGenome Annotation Project Presentation
Halogeometricum borinquense Genome Annotation Project Presentation Loci Hbor_05620 & Hbor_05470 Presented by: Mohammad Reza Najaf Tomaraei Hbor_05620 Basic Information DNA Coordinates: 527,512 528,261
More informationComputational methods for the analysis of bacterial gene regulation Brouwer, Rutger Wubbe Willem
University of Groningen Computational methods for the analysis of bacterial gene regulation Brouwer, Rutger Wubbe Willem IMPORTANT NOTE: You are advised to consult the publisher's version (publisher's
More informationProtein Architecture V: Evolution, Function & Classification. Lecture 9: Amino acid use units. Caveat: collagen is a. Margaret A. Daugherty.
Lecture 9: Protein Architecture V: Evolution, Function & Classification Margaret A. Daugherty Fall 2004 Amino acid use *Proteins don t use aa s equally; eg, most proteins not repeating units. Caveat: collagen
More informationLecture Notes for Fall Network Modeling. Ernest Fraenkel
Lecture Notes for 20.320 Fall 2012 Network Modeling Ernest Fraenkel In this lecture we will explore ways in which network models can help us to understand better biological data. We will explore how networks
More informationSyllabus BINF Computational Biology Core Course
Course Description Syllabus BINF 701-702 Computational Biology Core Course BINF 701/702 is the Computational Biology core course developed at the KU Center for Computational Biology. The course is designed
More informationWelcome to HST.508/Biophysics 170
Harvard-MIT Division of Health Sciences and Technology HST.58: Quantitative Genomics, Fall 5 Instructors: Leonid Mirny, Robert Berwick, Alvin Kho, Isaac Kohane Welcome to HST.58/Biophysics Our emphasis
More informationMolecular Biology - Translation of RNA to make Protein *
OpenStax-CNX module: m49485 1 Molecular Biology - Translation of RNA to make Protein * Jerey Mahr Based on Translation by OpenStax This work is produced by OpenStax-CNX and licensed under the Creative
More informationV14 extreme pathways
V14 extreme pathways A torch is directed at an open door and shines into a dark room... What area is lighted? Instead of marking all lighted points individually, it would be sufficient to characterize
More informationV19 Metabolic Networks - Overview
V19 Metabolic Networks - Overview There exist different levels of computational methods for describing metabolic networks: - stoichiometry/kinetics of classical biochemical pathways (glycolysis, TCA cycle,...
More informationChapter 16 Lecture. Concepts Of Genetics. Tenth Edition. Regulation of Gene Expression in Prokaryotes
Chapter 16 Lecture Concepts Of Genetics Tenth Edition Regulation of Gene Expression in Prokaryotes Chapter Contents 16.1 Prokaryotes Regulate Gene Expression in Response to Environmental Conditions 16.2
More informationInteraction Network Analysis
CSI/BIF 5330 Interaction etwork Analsis Young-Rae Cho Associate Professor Department of Computer Science Balor Universit Biological etworks Definition Maps of biochemical reactions, interactions, regulations
More information09/06/25. Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Non-uniform distribution of folds. Scheme of protein structure predicition
Sequence identity Structural similarity Computergestützte Strukturbiologie (Strukturelle Bioinformatik) Fold recognition Sommersemester 2009 Peter Güntert Structural similarity X Sequence identity Non-uniform
More informationProtein function prediction based on sequence analysis
Performing sequence searches Post-Blast analysis, Using profiles and pattern-matching Protein function prediction based on sequence analysis Slides from a lecture on MOL204 - Applied Bioinformatics 18-Oct-2005
More informationName Period The Control of Gene Expression in Prokaryotes Notes
Bacterial DNA contains genes that encode for many different proteins (enzymes) so that many processes have the ability to occur -not all processes are carried out at any one time -what allows expression
More informationEnzymes Enzyme Mechanism
Mechanisms of Enzymes BCMB 3100 Chapters 6, 7, 8 Enzymes Enzyme Mechanism 1 Energy diagrams Binding modes of enzyme catalysis Chemical modes of enzyme catalysis Acid-Base catalysis Covalent catalysis Binding
More informationLecture 10 (10/4/17) Lecture 10 (10/4/17)
Lecture 10 (10/4/17) Reading: Ch4; 125, 138-141, 141-142 Problems: Ch4 (text); 7, 9, 11 Ch4 (study guide); 1, 2 NEXT Reading: Ch4; 125, 132-136 (structure determination) Ch4; 12-130 (Collagen) Problems:
More informationFrom Friday s material
5.111 Lecture 35 35.1 Kinetics Topic: Catalysis Chapter 13 (Section 13.14-13.15) From Friday s material Le Chatelier's Principle - when a stress is applied to a system in equilibrium, the equilibrium tends
More informationRegulation of gene expression. Premedical - Biology
Regulation of gene expression Premedical - Biology Regulation of gene expression in prokaryotic cell Operon units system of negative feedback positive and negative regulation in eukaryotic cell - at any
More information15.2 Prokaryotic Transcription *
OpenStax-CNX module: m52697 1 15.2 Prokaryotic Transcription * Shannon McDermott Based on Prokaryotic Transcription by OpenStax This work is produced by OpenStax-CNX and licensed under the Creative Commons
More informationEnzymes Enzyme Mechanism
BCMB 3100 Chapters 6, 7, 8 Enzymes Enzyme Mechanism 1 Mechanisms of Enzymes Energy diagrams Binding modes of enzyme catalysis Chemical modes of enzyme catalysis Acid-Base catalysis Covalent catalysis Binding
More informationComparing Genomes in terms of Protein Structure: Surveys of a Finite Parts List
Comparing Genomes in terms of Protein Structure: Surveys of a Finite Parts List Mark Gerstein * & Hedi Hegyi Department of Molecular Biophysics & Biochemistry 266 Whitney Avenue, Yale University PO Box
More informationBSc and MSc Degree Examinations
Examination Candidate Number: Desk Number: BSc and MSc Degree Examinations 2018-9 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes Marking
More informationOutline. Sequence-comparison methods. Buzzzzzzzz. Why compare sequences? Gerard Kleywegt Uppsala University
MB330 - January, 2006 Sequence-comparison methods erard Kleywegt Uppsala University Outline! Why compare sequences?! Dotplots! airwise sequence alignments &! Multiple sequence alignments! rofile methods!
More information