Emily Blanton Phylogeny Lab Report May 2009
|
|
- Miles Miles
- 5 years ago
- Views:
Transcription
1 Introduction It is suggested through scientific research that all living organisms are connected- that we all share a common ancestor and that, through time, we have all evolved from the same starting point. Through evolution, different species have emerged, each different from the next. But although they are different, they still share much of the same genetic information. This evolution and connectedness is most clearly described as a tree- a Tree of Life (1) that branches off into many kingdoms and species, but all commencing from the same place. Phylogeny is the study of this tree and the interconnectedness of all species through the molecular sequencing of DNA and proteins. There are two main ways that genes are inherited among living things. (2) There is vertical gene transfer, directly from the parent to the offspring, and there is horizontal gene transfer, in which genes jump between two unrelated organisms. The latter can sometimes explain inconsistencies within phylogenic trees and why your hypothesis may not always match the results. Experiment / Hypothesis For this project, I chose to look at the Rh blood group gene. This gene can specify for the making of a number of different antigens, but mainly C, c, D, E and e. (3) For example, humans either have or do not have the RhD factor, which only refers to that specific antigen. Other species can have different
2 variations of this gene. However, the nucleotide sequences among these different species remains largely the same, which shows that the Rh genes have been greatly conserved through millions of years of evolution. The definite physiological function of these genes is not entirely clear, but it is thought that the RhD gene in humans has stayed so prominent because of its protection of infected humans against latent toxoplasmosis. It is also believed that the reason the RhD negative allele has stayed so prevalent in the population as well is that the protection against toxoplasmosis seems to be greater for RhD positive heterozygotes (3). I was interested in finding out the frequency of the Rh gene and its many variations, up to about 43 (3), across different species. I would expect that of course humans, and any of several species most closely related to humans such as monkeys and gorillas, would share this gene. I really wasn t sure what other species would also share it, although after discovering the gene s ability to protect against toxoplasmosis, I would not expect any animal in the cat family to carry it since cats are known to be the most prominent carriers of the infection. Material and Methods I began this inquiry with the NCBI website. From their homepage, I did a nucleotide search for the Rh gene. The first entry that came up was for the house mouse, accession number NM
3 After clicking on the entry, I formatted the information into FASTA. Then I did a BLAST by copying the nucleotide sequence, returning to the home page and selecting the BLAST heading, and specifying nucleotide BLAST under the Basic BLAST heading. Then, I pasted the FASTA sequence into the accession box and selected Others under the Database option. Once you click BLAST, the next page that appears will show you a list of species which share the gene and how similar their sequencing is to that of the species you started with. I then selected the ten different species with the highest similarity to the original species, and repeated the beginning steps of putting each one into FASTA format and copying and pasting their nucleotide sequences into a separate document. Once I got to this point, I was ready to begin using Clustal to align my sequences. After downloading the program, I made sure to delete any spaces and extra information from my document. All that remained were the common names of the species, without spaces, and the nucleotide sequences. In Clustal, I went into File, Load sequences, Alignment, Do complete alignment and then Align. At this time, all the sequences were aligned and upon scrolling right to left, I was able to find the point where all species began their alignment and where they ended aligning. I wrote down these numbers and went into Save sequences as, under File, and entered those numbers in the save from residue to. At this point, I was ready to exit Clustal.
4 Now I downloaded MEGA from the megasoftware.net website and saved it to the desktop. I then went under File and then Text editor and I opened my Clustal.aln document from the desktop. I had to delete all the extra stuff at the bottom of the page, such as astericks, etc. and then under Utilities, I converted it to MEGA format. I then saved this file to the desktop with an.meg extension on the file name. After then opening MEGA and the link to activate a data file, I opened my.meg file from the desktop and chose nucleotide sequence, yes to protein coding gene, and Standard genetic code. At this point, I was able to create different phylogeny trees in the new MEGA window that opened. I created a Minimum Evolution, a Maximum Parsimony and a Bootstrap test / Minimum Evolution tree. Results Each tree had the same groupings (in different orders), as follows: human / gibbon, orangutan / chimpanzee / gorilla, marmoset / capuchin, pig, and mouse / rat. The Bootstrap tree ranged from on all nodes, which suggests high accuracy of the groupings. The trees are heavy on the monkey and ape families, so most of the species are relatively closely related. Trees: Minimum Evolution tree- Here I have shown the branching of the different species using a tree. Each branch represents each
5 branch of the phylogenic trees and splits accordingly. The leaves represent each different type of Rh gene present in that particular species. Maximum Parsimony- This tree explains the classifications of the species, along with their scientific names, common names, and images of each. Bootstrap Tree- This tree shows the accuracy numbers for each node. Discussion As I hypothesized, my results were heavy on the ape / monkey species, and of course, humans. It seemed a little surprising that mice and rats would carry it, although mouse DNA and humans is not far apart. It was surprising to me that the humans were grouped with the gibbon since chimpanzees, gorillas, humans and orangutans make up the great apes. After doing more research, I discovered a few other species that carry some version of this gene: zebrafish, marine sponge, African clawed frog, slime mold, earthworm, fruit fly, and green alga. Clearly this gene has stayed very prominent throughout evolution, even though there have been changes to it.
6
Using Bioinformatics to Study Evolutionary Relationships Instructions
3 Using Bioinformatics to Study Evolutionary Relationships Instructions Student Researcher Background: Making and Using Multiple Sequence Alignments One of the primary tasks of genetic researchers is comparing
More informationInvestigation 3: Comparing DNA Sequences to Understand Evolutionary Relationships with BLAST
Investigation 3: Comparing DNA Sequences to Understand Evolutionary Relationships with BLAST Introduction Bioinformatics is a powerful tool which can be used to determine evolutionary relationships and
More informationOpen a Word document to record answers to any italicized questions. You will the final document to me at
Molecular Evidence for Evolution Open a Word document to record answers to any italicized questions. You will email the final document to me at tchnsci@yahoo.com Pre Lab Activity: Genes code for amino
More informationCOMPARING DNA SEQUENCES TO UNDERSTAND EVOLUTIONARY RELATIONSHIPS WITH BLAST
Big Idea 1 Evolution INVESTIGATION 3 COMPARING DNA SEQUENCES TO UNDERSTAND EVOLUTIONARY RELATIONSHIPS WITH BLAST How can bioinformatics be used as a tool to determine evolutionary relationships and to
More information08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega
BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments
More informationBioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
More informationMETHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
More informationUSING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES
USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES HOW CAN BIOINFORMATICS BE USED AS A TOOL TO DETERMINE EVOLUTIONARY RELATIONSHPS AND TO BETTER UNDERSTAND PROTEIN HERITAGE?
More informationHands-On Nine The PAX6 Gene and Protein
Hands-On Nine The PAX6 Gene and Protein Main Purpose of Hands-On Activity: Using bioinformatics tools to examine the sequences, homology, and disease relevance of the Pax6: a master gene of eye formation.
More informationChapter 16: Reconstructing and Using Phylogenies
Chapter Review 1. Use the phylogenetic tree shown at the right to complete the following. a. Explain how many clades are indicated: Three: (1) chimpanzee/human, (2) chimpanzee/ human/gorilla, and (3)chimpanzee/human/
More informationThe Theory of Evolution
The Theory of Evolution Matthew Ferry Evolution The process by which different kinds of living organisms are thought to have developed and diversified from earlier forms during the history of the Earth.
More informationCladistics and Bioinformatics Questions 2013
AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species
More informationGENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.
!! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory
More informationCREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
More informationOrganizing Life s Diversity
17 Organizing Life s Diversity section 2 Modern Classification Classification systems have changed over time as information has increased. What You ll Learn species concepts methods to reveal phylogeny
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationChange Over Time Concept Map
Change Over Time Concept Map Darwin reasoned that plants or animals that arrived on the Galapagos Islands faced conditions that were different from those on the mainland. Perhaps, Darwin hypothesized,
More informationC3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
More informationBIOINFORMATICS LAB AP BIOLOGY
BIOINFORMATICS LAB AP BIOLOGY Bioinformatics is the science of collecting and analyzing complex biological data. Bioinformatics combines computer science, statistics and biology to allow scientists to
More informationPhylogenetic Trees. How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species?
Why? Phylogenetic Trees How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species? The saying Don t judge a book by its cover. could be applied
More informationPhylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction. Lesser Tenrec (Echinops telfairi)
Phylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction Lesser Tenrec (Echinops telfairi) Goals: 1. Use phylogenetic experimental design theory to select optimal taxa to
More informationLecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
More informationSession 5: Phylogenomics
Session 5: Phylogenomics B.- Phylogeny based orthology assignment REMINDER: Gene tree reconstruction is divided in three steps: homology search, multiple sequence alignment and model selection plus tree
More informationEvolution & Natural Selection
Evolution & Natural Selection Human Origins & Adaptations Charles Darwin Darwin did not discover evolution Darwin explain how natural selection decided which genes would be selected and passed on to the
More informationRELATIONSHIPS BETWEEN GENES/PROTEINS HOMOLOGUES
Molecular Biology-2018 1 Definitions: RELATIONSHIPS BETWEEN GENES/PROTEINS HOMOLOGUES Heterologues: Genes or proteins that possess different sequences and activities. Homologues: Genes or proteins that
More informationProcesses of Evolution
15 Processes of Evolution Forces of Evolution Concept 15.4 Selection Can Be Stabilizing, Directional, or Disruptive Natural selection can act on quantitative traits in three ways: Stabilizing selection
More informationPhylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
More informationTree Building Activity
Tree Building Activity Introduction In this activity, you will construct phylogenetic trees using a phenotypic similarity (cartoon microbe pictures) and genotypic similarity (real microbe sequences). For
More informationHomework Assignment, Evolutionary Systems Biology, Spring Homework Part I: Phylogenetics:
Homework Assignment, Evolutionary Systems Biology, Spring 2009. Homework Part I: Phylogenetics: Introduction. The objective of this assignment is to understand the basics of phylogenetic relationships
More informationQ1. What does the word biology mean? Q4. If you stacked 4.6 billion pieces of paper on top of each other, how high would the pile be?
This website is designed to help you gain a better understanding of biology. You need to complete the series of activities outlined below and answer any questions on this sheet. Have fun! Go to the website:
More informationIntroduction to Bioinformatics Online Course: IBT
Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple
More informationPrimate Diversity & Human Evolution (Outline)
Primate Diversity & Human Evolution (Outline) 1. Source of evidence for evolutionary relatedness of organisms 2. Primates features and function 3. Classification of primates and representative species
More informationAfter you read this section, you should be able to answer these questions:
CHAPTER 10 1 Change Over Time SECTION The Evolution of Living Things 7.3.c, 7.3.d California Science Standards BEFORE YOU READ After you read this section, you should be able to answer these questions:
More informationReview sheet for the material covered by exam III
Review sheet for the material covered by exam III WARNING: Like last time, I have tried to be complete, but I may have missed something. You are responsible for all the material discussed in class. This
More informationPhylogenetic analyses. Kirsi Kostamo
Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,
More informationGenomes and Their Evolution
Chapter 21 Genomes and Their Evolution PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
More informationInvestigating Evolutionary Questions Using Online Molecular Databases *
Investigating Evolutionary Questions Using Online Molecular Databases * Adapted from Puterbaugh and Burleigh, and The American Biology Teacher Lesson Background and Overview [Student Information Handout]
More informationWTHS Biology Keystone Exams
WTHS Biology Keystone Exams Biology Keystone Review Packet 10 th / 11 th Grade Keystone Test Prep This packet contains helpful information for you to prepare for the upcoming Biology Keystone Test on May
More informationSkulls & Evolution. Procedure In this lab, groups at the same table will work together.
Skulls & Evolution Objectives To illustrate trends in the evolution of humans. To demonstrate what you can learn from bones & fossils. To show the adaptations of various mammals to different habitats and
More informationBioinformatics Exercises
Bioinformatics Exercises AP Biology Teachers Workshop Susan Cates, Ph.D. Evolution of Species Phylogenetic Trees show the relatedness of organisms Common Ancestor (Root of the tree) 1 Rooted vs. Unrooted
More informationthebiotutor.com AS Biology Unit 2 Classification, Adaptation & Biodiversity
thebiotutor.com AS Biology Unit 2 Classification, Adaptation & Biodiversity 1 Classification and taxonomy Classification Phylogeny Taxonomy The process of sorting living things into groups. The study of
More informationBiology Keystone (PA Core) Quiz Theory of Evolution - (BIO.B ) Theory Of Evolution, (BIO.B ) Scientific Terms
Biology Keystone (PA Core) Quiz Theory of Evolution - (BIO.B.3.2.1 ) Theory Of Evolution, (BIO.B.3.3.1 ) Scientific Terms Student Name: Teacher Name: Jared George Date: Score: 1) Evidence for evolution
More informationReview sheet for Mendelian genetics through human evolution. What organism did Mendel study? What characteristics of this organism did he examine?
Review sheet for Mendelian genetics through human evolution WARNING: I have tried to be complete, but I may have missed something. You are responsible for all the material discussed in class. This is only
More informationBio 1B Lecture Outline (please print and bring along) Fall, 2007
Bio 1B Lecture Outline (please print and bring along) Fall, 2007 B.D. Mishler, Dept. of Integrative Biology 2-6810, bmishler@berkeley.edu Evolution lecture #5 -- Molecular genetics and molecular evolution
More informationBioinformatics: Investigating Molecular/Biochemical Evidence for Evolution
Bioinformatics: Investigating Molecular/Biochemical Evidence for Evolution Background How does an evolutionary biologist decide how closely related two different species are? The simplest way is to compare
More information9.1- Earth Forms and Life Begins
9.1- Earth Forms and Life Begins About Earth: Earth was formed about 4.6 billion years ago! The first life on earth appeared about 4 billion years ago Life started out as small, single-celled organisms
More informationChapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Biologists estimate that there are about 5 to 100 million species of organisms living on Earth today. Evidence from morphological, biochemical, and gene sequence
More informationSmall RNA in rice genome
Vol. 45 No. 5 SCIENCE IN CHINA (Series C) October 2002 Small RNA in rice genome WANG Kai ( 1, ZHU Xiaopeng ( 2, ZHONG Lan ( 1,3 & CHEN Runsheng ( 1,2 1. Beijing Genomics Institute/Center of Genomics and
More informationBiodiversity. The Road to the Six Kingdoms of Life
Biodiversity The Road to the Six Kingdoms of Life How the 6 kingdoms came about At first, only two kingdoms were recognized Then Haeckel proposed a third kingdom Protista (where protists had both plant
More informationConcept Modern Taxonomy reflects evolutionary history.
Concept 15.4 Modern Taxonomy reflects evolutionary history. What is Taxonomy: identification, naming, and classification of species. Common Names: can cause confusion - May refer to several species (ex.
More informationDraft document version 0.6; ClustalX version 2.1(PC), (Mac); NJplot version 2.3; 3/26/2012
Comparing DNA Sequences to Determine Evolutionary Relationships of Molluscs This activity serves as a supplement to the online activity Biodiversity and Evolutionary Trees: An Activity on Biological Classification
More information"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
More information8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
More informationJournal of Proteomics & Bioinformatics - Open Access
Abstract Methodology for Phylogenetic Tree Construction Kudipudi Srinivas 2, Allam Appa Rao 1, GR Sridhar 3, Srinubabu Gedela 1* 1 International Center for Bioinformatics & Center for Biotechnology, Andhra
More informationTHEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
More informationDarwin's Theory. Use Target Reading Skills. Darwin's Observations. Changes Over Time Guided Reading and Study
Darwin's Theory This section discusses Charles Darwin and his theories ofevolution, which are based on what he saw during his trip around the world. Use Target Reading Skills In the graphic organizer,
More informationBioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics
Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods
More informationBiodiversity. The Road to the Six Kingdoms of Life
Biodiversity The Road to the Six Kingdoms of Life How the 6 kingdoms came about At first, only two kingdoms were recognized Then Haeckel proposed a third kingdom Protista (where protists had both plant
More informationChapter 8: Evolution and Natural Selection
Darwin s dangerous idea: evolution by natural selection Lectures by Mark Manteuffel, St. Louis Community College Chapter 8: Evolution and Natural Selection Use new chapter opening photo here Do Now: Scientific
More informationChapter 1. How Do Biologists Study Life?
Chapter 1 How Do Biologists Study Life? Biology is the study of life Biologists ask questions about all aspects of living organisms Bios logos means a discourse on life in Greek Biology has many sub-disciplines
More informationMolecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
More information9/19/2012. Chapter 17 Organizing Life s Diversity. Early Systems of Classification
Section 1: The History of Classification Section 2: Modern Classification Section 3: Domains and Kingdoms Click on a lesson name to select. Early Systems of Classification Biologists use a system of classification
More informationA.P. Biology Lecture Notes Unit 1A - Themes of Life
A.P. Biology Lecture Notes Unit 1A - Themes of Life I. Why study biology? A. Life is attractive, diverse, and interesting. B. The study of biology is enormous in scope C. Organisms span size scales from
More informationCLADOGRAMS & GENETIC PHYLOGENIES
CLADOGRAMS & GENETIC PHYLOGENIES INTRODUCTION Taxonomists since Linnaeus have used relative similarities and differences to group species into a taxonomic hierarchy of genera, families, orders, etc. Darwin
More informationSequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University
Sequence Alignment: A General Overview COMP 571 - Fall 2010 Luay Nakhleh, Rice University Life through Evolution All living organisms are related to each other through evolution This means: any pair of
More informationName: SAMPLE EOC PROBLEMS
Name: SAMPLE EOC PROBLEMS 1.Bromothymol blue (BTB) is a ph indicator that is also used to detect carbon dioxide (CO2). BTB is blue when ph is basic and CO2 is low. BTB is yellow when ph is acidic and CO2
More informationWhat is the purpose of the Classifying System? To allow the accurate identification of a particular organism
What is the purpose of the Classifying System? To allow the accurate identification of a particular organism Taxonomy The practice of classifying organisms -Taxonomy was founded nearly 300 years ago by
More informationMolecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
More informationCLASSIFICATION OF LIVING THINGS. Chapter 18
CLASSIFICATION OF LIVING THINGS Chapter 18 How many species are there? About 1.8 million species have been given scientific names Nearly 2/3 of which are insects 99% of all known animal species are smaller
More informationPhylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
More informationPhylogeny and the Tree of Life
LECTURE PRESENTATIONS For CAMPBELL BIOLOGY, NINTH EDITION Jane B. Reece, Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Robert B. Jackson Chapter 26 Phylogeny and the Tree of Life
More informationName: Class: Date: ID: A
Class: _ Date: _ Ch 17 Practice test 1. A segment of DNA that stores genetic information is called a(n) a. amino acid. b. gene. c. protein. d. intron. 2. In which of the following processes does change
More informationEvolution. Changes over Time
Evolution Changes over Time TEKS Students will analyze and evaluate B. 7 C how natural selection produces change in populations, not individuals B. 7 E/F effects of genetic mechanisms and their relationship
More informationHomology and Information Gathering and Domain Annotation for Proteins
Homology and Information Gathering and Domain Annotation for Proteins Outline Homology Information Gathering for Proteins Domain Annotation for Proteins Examples and exercises The concept of homology The
More informationWhat is Evolution? Evolution Unit Vocabulary. Answer: Evidence of Evolution. What is a Gene Pool? Change over time.
What is Evolution? Evolution Unit Vocabulary Practice Quiz Change over time. Evidence of Evolution The gradual development of something, especially from simple to more complex. Can be big or very small
More informationUnit 6 Test: Evolution
Page 617 Name: Class: Date: Unit 6 Test: Evolution.. Section I: Understanding 1. What is the role of DNA? a. It is an indicator of an animal s health. b. It is a cell s power plant. c. It decides how many
More information1 ATGGGTCTC 2 ATGAGTCTC
We need an optimality criterion to choose a best estimate (tree) Other optimality criteria used to choose a best estimate (tree) Parsimony: begins with the assumption that the simplest hypothesis that
More informationMechanisms of Evolution Darwinian Evolution
Mechanisms of Evolution Darwinian Evolution Descent with modification by means of natural selection All life has descended from a common ancestor The mechanism of modification is natural selection Concept
More informationEvidence: Table 1: Group Forkbird Population Data 1-Tined Forkbirds 2-Tined Forkbirds 4-Tined Forkbirds Initial
Activity #96 Battling Beaks Challenge Question: Initial Thoughts: Prediction: Evidence: Table 1: Group Forkbird Population Data 1-Tined Forkbirds 2-Tined Forkbirds 4-Tined Forkbirds Initial 1 2 3 4 5 6
More informationWelcome to Evolution 101 Reading Guide
Name: Welcome to Evolution 101 Reading Guide http://evolution.berkeley.edu/evolibrary/article/evo_01 Read the information on the website. Click on the next arrow at the bottom of each page to move to the
More informationChapter 19: Taxonomy, Systematics, and Phylogeny
Chapter 19: Taxonomy, Systematics, and Phylogeny AP Curriculum Alignment Chapter 19 expands on the topics of phylogenies and cladograms, which are important to Big Idea 1. In order for students to understand
More informationChapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Chapter focus Shifting from the process of how evolution works to the pattern evolution produces over time. Phylogeny Phylon = tribe, geny = genesis or origin
More informationGroup activities: Making animal model of human behaviors e.g. Wine preference model in mice
Lecture schedule 3/30 Natural selection of genes and behaviors 4/01 Mouse genetic approaches to behavior 4/06 Gene-knockout and Transgenic technology 4/08 Experimental methods for measuring behaviors 4/13
More information#Evolution. Nothing in Biology makes sense except in the light of evolution.
#Evolution Nothing in Biology makes sense except in the light of evolution. The Theory of Evolution Change over time. People used to think that species did not change. DARWIN WAS NOT THE PERSON TO COME
More informationB2: NATURAL SELECTION (PART 1)
B2: NATURAL SELECTION (PART 1) Learning Objectives Understand Darwin s theory of evolution (everyone) Understand Lamarck s theory of evolution and evaluate the differences between this theory and Darwin
More informationOrganizing Life on Earth
Organizing Life on Earth Inquire: Organizing Life on Earth Overview Scientists continually obtain new information that helps to understand the evolutionary history of life on Earth. Each group of organisms
More informationUnit B1 Influence on Life. (EdExcel)
Unit B1 Influence on Life (EdExcel) Topic 1 - Classification Classification The world is populated by millions of different species of animals and plants Classification How would you construct a key to
More informationANTHROPOLOGY 150: EVOLUTION AND HUMAN EMERGENCE NM HED Area III: Laboratory Science Competencies UNM Core Area 3: Physical and Natural Sciences
ANTHROPOLOGY 150: EVOLUTION AND HUMAN EMERGENCE NM HED Area III: Laboratory Science Competencies UNM Core Area 3: Physical and Natural Sciences Student Learning Objectives: At the end of the course, the
More informationLesson Topic Learning Goals
Unit 2: Evolution Part B Lesson Topic Learning Goals 1 Lab Mechanisms of Evolution Cumulative Selection - Be able to describe evolutionary mechanisms such as genetic variations and key factors that lead
More informationCell Division and Genetics
Name Date Cell Division and Genetics 1. Black fur is dominant over brown fur in a particular population of guinea pig. The genetic information that gives a guinea pig brown fur is described as having A.
More informationComparing whole genomes
BioNumerics Tutorial: Comparing whole genomes 1 Aim The Chromosome Comparison window in BioNumerics has been designed for large-scale comparison of sequences of unlimited length. In this tutorial you will
More informationSection Review. Change Over Time UNDERSTANDING CONCEPTS. of evolution? share ancestors? CRITICAL THINKING
Skills Worksheet Section Review Change Over Time UNDERSTANDING CONCEPTS 1. Describing What are three lines of evidence that support the theory of evolution? 2. Summarizing What evidence about the ancestors
More informationIntroduction to characters and parsimony analysis
Introduction to characters and parsimony analysis Genetic Relationships Genetic relationships exist between individuals within populations These include ancestordescendent relationships and more indirect
More informationIntroduction to Genetics
Introduction to Genetics We ve all heard of it, but What is genetics? Genetics: the study of gene structure and action and the patterns of inheritance of traits from parent to offspring. Ancient ideas
More informationLinear Regression (1/1/17)
STA613/CBB540: Statistical methods in computational biology Linear Regression (1/1/17) Lecturer: Barbara Engelhardt Scribe: Ethan Hada 1. Linear regression 1.1. Linear regression basics. Linear regression
More informationBiology 1B Evolution Lecture 2 (February 26, 2010) Natural Selection, Phylogenies
1 Natural Selection (Darwin-Wallace): There are three conditions for natural selection: 1. Variation: Individuals within a population have different characteristics/traits (or phenotypes). 2. Inheritance:
More informationStation 1: Evidence from Current Examples
Station 1: Evidence from Current Examples Go to the website below: http://www.pbs.org/wgbh/evolution/educators/lessons/lesson6/act1.html Watch the video segment called Why does evolution matter now? After
More informationPiecing It Together. 1) The envelope contains puzzle pieces for 5 vertebrate embryos in 3 different stages of
Piecing It Together 1) The envelope contains puzzle pieces for 5 vertebrate embryos in 3 different stages of development. Lay out the pieces so that you have matched up each animal name card with its 3
More informationEvolution Test Review
Name Evolution Test Review Period 1) A group of interbreeding organisms (a species) living in a given area is called population 2) Give an example of a species. Ex. One wolf Give an example of a population.
More informationThe neutral theory of molecular evolution
The neutral theory of molecular evolution Introduction I didn t make a big deal of it in what we just went over, but in deriving the Jukes-Cantor equation I used the phrase substitution rate instead of
More information