Martin Bader June 25, On Reversal and Transposition Medians
|
|
- Eleanor Anderson
- 5 years ago
- Views:
Transcription
1 Martin Bader June 25, 2009 On Reversal and Transposition Medians
2 Page 2 On Reversal and Transposition Medians Martin Bader June 25, 2009 Genome Rearrangements During evolution, the gene order in a chromosome can change Gene order of two land snail mitochondrial DNAs Cepaea nemoralis cox1 V rrnl L1 A nad6 P nad5 nad1 nad4 L cob D C F cox2 Y W G H Q L2 atp8 N atp6 R E rrns M nad3 S2 T cox3 S1 nad4 I nad2 K Albinaria coerulea cox1 V rrnl L1 P A nad6 nad5 nad1 nad4 L cob D C F cox2 Y W G H Q L2 atp8 N atp6 R E rrns M nad3 S2 S1 nad4 T cox3 I nad2 K
3 Page 2 On Reversal and Transposition Medians Martin Bader June 25, 2009 Genome Rearrangements During evolution, the gene order in a chromosome can change Gene order of two land snail mitochondrial DNAs Cepaea nemoralis cox1 V rrnl L1 A nad6 P nad5 nad1 nad4 L cob D C F cox2 Y W G H Q L2 atp8 N atp6 R E rrns M nad3 S2 T cox3 S1 nad4 I nad2 K Albinaria coerulea cox1 V rrnl L1 P A nad6 nad5 nad1 nad4 L cob D C F cox2 Y W G H Q L2 atp8 N atp6 R E rrns M nad3 S2 S1 nad4 T cox3 I nad2 K Reconstruct evolutionary events Use as distance measure Use for phylogenetic reconstruction
4 Page 3 On Reversal and Transposition Medians Martin Bader June 25, 2009 The Median Problem Given gene orders π 1,π 2,π 3 Find M where 3 i=1 d(πi,m) is minimized π 1 d(π 1,M) M d(π 2,M) π 2 d(π 3,M) π 3
5 Page 3 On Reversal and Transposition Medians Martin Bader June 25, 2009 The Median Problem Given gene orders π 1,π 2,π 3 Find M where 3 i=1 d(πi,m) is minimized π 1 d(π 1,M) M d(π 2,M) π 2 d(π 3,M) π 3 NP-hard even for the most simple distance measures
6 Page 4 On Reversal and Transposition Medians Martin Bader June 25, 2009 Our contribution Exact algorithms for the Transposition Median Problem Exact algorithm for the weighted Reversal and Transposition Median Problem (Extension of Reversal Median solver, Caprara 2003) Improved exact algorithm for pairwise distances (Improvement of Christie 1998)
7 Page 5 On Reversal and Transposition Medians Martin Bader June 25, 2009 The Multiple Breakpoint Graph Edge-colored graph Contains neighborhood relations for each gene order
8 Page 5 On Reversal and Transposition Medians Martin Bader June 25, 2009 The Multiple Breakpoint Graph Edge-colored graph Contains neighborhood relations for each gene order Example: 1 h 5 t 1 5 π 1 = ( ) π 2 = ( ) π 3 = ( ) M = ( ) 1 t 2 h 2 2 t 5 h 4 t 4 h 4 3 h 3 3 t
9 Page 5 On Reversal and Transposition Medians Martin Bader June 25, 2009 The Multiple Breakpoint Graph Edge-colored graph Contains neighborhood relations for each gene order Example: 1 h 5 t 1 5 π 1 = ( ) π 2 = ( ) π 3 = ( ) M = ( ) 1 t 2 h 2 2 t 5 h 4 t 4 h 4 3 h 3 3 t
10 Page 5 On Reversal and Transposition Medians Martin Bader June 25, 2009 The Multiple Breakpoint Graph Edge-colored graph Contains neighborhood relations for each gene order Example: 1 h 5 t 1 5 π 1 = ( ) π 2 = ( ) π 3 = ( ) M = ( ) 1 t 2 h 2 2 t 5 h 4 t 4 h 4 3 h 3 3 t
11 Page 5 On Reversal and Transposition Medians Martin Bader June 25, 2009 The Multiple Breakpoint Graph Edge-colored graph Contains neighborhood relations for each gene order Example: 1 h 5 t 1 5 π 1 = ( ) π 2 = ( ) π 3 = ( ) M = ( ) 1 t 2 h 2 2 t 5 h 4 t 4 h 4 3 h 3 3 t
12 Page 5 On Reversal and Transposition Medians Martin Bader June 25, 2009 The Multiple Breakpoint Graph Edge-colored graph Contains neighborhood relations for each gene order Example: 1 h 5 t 1 5 π 1 = ( ) π 2 = ( ) π 3 = ( ) M = ( ) 1 t 2 h 2 2 t 5 h 4 t 4 h 4 3 h 3 3 t
13 Page 5 On Reversal and Transposition Medians Martin Bader June 25, 2009 The Multiple Breakpoint Graph Edge-colored graph Contains neighborhood relations for each gene order Example: 1 h 5 t 1 5 π 1 = ( ) π 2 = ( ) π 3 = ( ) M = ( ) 1 t 2 h 2 2 t 5 h 4 t 4 h 4 3 h 3 3 t
14 Page 6 On Reversal and Transposition Medians Martin Bader June 25, 2009 Cycles and distances Edges of two colors form cycles 1 h 5t 1 5 π 1 = ( ) M = ( ) 1t 2 h 2 2t 5 h 4t 4 h 4 3 h 3 3t
15 Page 6 On Reversal and Transposition Medians Martin Bader June 25, 2009 Cycles and distances Edges of two colors form cycles 1 h 5t 1 5 π 2 = ( ) M = ( ) 1t 2 h 2 2t 5 h 4t 4 h 4 3 h 3 3t
16 Page 6 On Reversal and Transposition Medians Martin Bader June 25, 2009 Cycles and distances Edges of two colors form cycles 1 h 5t 1 5 π 3 = ( ) M = ( ) 1t 2 h 2 2t 5 h 4t 4 h 4 3 h 3 3t
17 Page 6 On Reversal and Transposition Medians Martin Bader June 25, 2009 Cycles and distances Edges of two colors form cycles 1 h 5t 1 5 π 3 = ( ) M = ( ) 1t 2 h 2 2t 5 h 4t 4 h 4 3t 3 Distances closely related to number of cycles 3 h d r = n c + h + f d t n c odd 2 d w w t 2 (n c odd (2 2w r w t )c even )
18 Page 7 On Reversal and Transposition Medians Martin Bader June 25, 2009 Sketch of the algorithm Solve Cycle Median Problem Verify solution
19 Page 7 On Reversal and Transposition Medians Martin Bader June 25, 2009 Sketch of the algorithm Solve Cycle Median Problem Start with empty M Subsequently add edges Estimate lower bound for partial solution Continue with partial solution with least lower bound (branch and bound) NEW: Consider cycle lengths Verify solution
20 Page 7 On Reversal and Transposition Medians Martin Bader June 25, 2009 Sketch of the algorithm Solve Cycle Median Problem Start with empty M Subsequently add edges Estimate lower bound for partial solution Continue with partial solution with least lower bound (branch and bound) NEW: Consider cycle lengths Verify solution Calculate edge weights... either by an exact algorithm for pairwise distances... or by an approximation algorithm (faster)
21 Page 8 On Reversal and Transposition Medians Martin Bader June 25, 2009 Experiments Create random input Start with id of size n (n = 37 and n = 100) Create 3 sequences of operations of length r (2 r 15) Use these sequences to obtain π 1, π 2, and π 3
22 Page 8 On Reversal and Transposition Medians Martin Bader June 25, 2009 Experiments Create random input Start with id of size n (n = 37 and n = 100) Create 3 sequences of operations of length r (2 r 15) Use these sequences to obtain π 1, π 2, and π 3 Testing Most inputs could be solved within a few seconds Verifying solutions with approximation algorithm is very accurate Much faster than previous algorithm for the Transposition Median Problem (Yue et al. 2008)
23 Page 9 On Reversal and Transposition Medians Martin Bader June 25, 2009 Conclusion We presented an algorithm that... can solve the TMP and wrtmp exactly is fast enough for practical use is FREE SOFTWARE (GPL v3.0) download it from inst.190/mitarbeiter/bader/phylo tar.gz
24 Page 9 On Reversal and Transposition Medians Martin Bader June 25, 2009 Conclusion We presented an algorithm that... can solve the TMP and wrtmp exactly is fast enough for practical use is FREE SOFTWARE (GPL v3.0) download it from inst.190/mitarbeiter/bader/phylo tar.gz Thanks for your attention!
On Reversal and Transposition Medians
On Reversal and Transposition Medians Martin Bader International Science Index, Computer and Information Engineering waset.org/publication/7246 Abstract During the last years, the genomes of more and more
More informationAN EXACT SOLVER FOR THE DCJ MEDIAN PROBLEM
AN EXACT SOLVER FOR THE DCJ MEDIAN PROBLEM MENG ZHANG College of Computer Science and Technology, Jilin University, China Email: zhangmeng@jlueducn WILLIAM ARNDT AND JIJUN TANG Dept of Computer Science
More informationGenomes Comparision via de Bruijn graphs
Genomes Comparision via de Bruijn graphs Student: Ilya Minkin Advisor: Son Pham St. Petersburg Academic University June 4, 2012 1 / 19 Synteny Blocks: Algorithmic challenge Suppose that we are given two
More informationMultiple genome rearrangement: a general approach via the evolutionary genome graph
BIOINFORMATICS Vol. 18 Suppl. 1 2002 Pages S303 S311 Multiple genome rearrangement: a general approach via the evolutionary genome graph Dmitry Korkin and Lev Goldfarb Faculty of Computer Science, University
More informationOn the complexity of unsigned translocation distance
Theoretical Computer Science 352 (2006) 322 328 Note On the complexity of unsigned translocation distance Daming Zhu a, Lusheng Wang b, a School of Computer Science and Technology, Shandong University,
More informationGraphs, permutations and sets in genome rearrangement
ntroduction Graphs, permutations and sets in genome rearrangement 1 alabarre@ulb.ac.be Universite Libre de Bruxelles February 6, 2006 Computers in Scientic Discovery 1 Funded by the \Fonds pour la Formation
More informationBayesian phylogenetic inference from animal mitochondrial genome arrangements
J. R. Statist. Soc. B (2002) 64, Part 4, pp. 681 693 Bayesian phylogenetic inference from animal mitochondrial genome arrangements Bret Larget and Donald L. Simon Duquesne University, Pittsburgh, USA and
More informationRecent Advances in Phylogeny Reconstruction
Recent Advances in Phylogeny Reconstruction from Gene-Order Data Bernard M.E. Moret Department of Computer Science University of New Mexico Albuquerque, NM 87131 Department Colloqium p.1/41 Collaborators
More informationBIOINFORMATICS. New approaches for reconstructing phylogenies from gene order data. Bernard M.E. Moret, Li-San Wang, Tandy Warnow and Stacia K.
BIOINFORMATICS Vol. 17 Suppl. 1 21 Pages S165 S173 New approaches for reconstructing phylogenies from gene order data Bernard M.E. Moret, Li-San Wang, Tandy Warnow and Stacia K. Wyman Department of Computer
More informationGenome Rearrangements In Man and Mouse. Abhinav Tiwari Department of Bioengineering
Genome Rearrangements In Man and Mouse Abhinav Tiwari Department of Bioengineering Genome Rearrangement Scrambling of the order of the genome during evolution Operations on chromosomes Reversal Translocation
More informationAn Improved Algorithm for Ancestral Gene Order Reconstruction
V. Kůrková et al. (Eds.): ITAT 2014 with selected papers from Znalosti 2014, CEUR Workshop Proceedings Vol. 1214, pp. 46 53 http://ceur-ws.org/vol-1214, Series ISSN 1613-0073, c 2014 A. Herencsár B. Brejová
More informationBIOINFORMATICS. Scaling Up Accurate Phylogenetic Reconstruction from Gene-Order Data. Jijun Tang 1 and Bernard M.E. Moret 1
BIOINFORMATICS Vol. 1 no. 1 2003 Pages 1 8 Scaling Up Accurate Phylogenetic Reconstruction from Gene-Order Data Jijun Tang 1 and Bernard M.E. Moret 1 1 Department of Computer Science, University of New
More informationAlgorithms for Bioinformatics
Adapted from slides by Alexandru Tomescu, Leena Salmela, Veli Mäkinen, Esa Pitkänen 582670 Algorithms for Bioinformatics Lecture 5: Combinatorial Algorithms and Genomic Rearrangements 1.10.2015 Background
More informationFast Phylogenetic Methods for the Analysis of Genome Rearrangement Data: An Empirical Study
Fast Phylogenetic Methods for the Analysis of Genome Rearrangement Data: An Empirical Study Li-San Wang Robert K. Jansen Dept. of Computer Sciences Section of Integrative Biology University of Texas, Austin,
More informationNew Approaches for Reconstructing Phylogenies from Gene Order Data
New Approaches for Reconstructing Phylogenies from Gene Order Data Bernard M.E. Moret Li-San Wang Tandy Warnow Stacia K. Wyman Abstract We report on new techniques we have developed for reconstructing
More informationSteps Toward Accurate Reconstructions of Phylogenies from Gene-Order Data 1
Steps Toward Accurate Reconstructions of Phylogenies from Gene-Order Data Bernard M.E. Moret, Jijun Tang, Li-San Wang, and Tandy Warnow Department of Computer Science, University of New Mexico Albuquerque,
More informationPhylogenetic Reconstruction from Arbitrary Gene-Order Data
Phylogenetic Reconstruction from Arbitrary Gene-Order Data Jijun Tang and Bernard M.E. Moret University of New Mexico Department of Computer Science Albuquerque, NM 87131, USA jtang,moret@cs.unm.edu Liying
More informationA Practical Algorithm for Ancestral Rearrangement Reconstruction
A Practical Algorithm for Ancestral Rearrangement Reconstruction Jakub Kováč, Broňa Brejová, and Tomáš Vinař 2 Department of Computer Science, Faculty of Mathematics, Physics, and Informatics, Comenius
More informationCREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
More informationThe Saguaro Genome. Toward the Ecological Genomics of a Sonoran Desert Icon. Dr. Dario Copetti June 30, 2015 STEMAZing workshop TCSS
The Saguaro Genome Toward the Ecological Genomics of a Sonoran Desert Icon Dr. Dario Copetti June 30, 2015 STEMAZing workshop TCSS Why study a genome? - the genome contains the genetic information of an
More informationA New Fast Heuristic for Computing the Breakpoint Phylogeny and Experimental Phylogenetic Analyses of Real and Synthetic Data
A New Fast Heuristic for Computing the Breakpoint Phylogeny and Experimental Phylogenetic Analyses of Real and Synthetic Data Mary E. Cosner Dept. of Plant Biology Ohio State University Li-San Wang Dept.
More informationI519 Introduction to Bioinformatics, Genome Comparison. Yuzhen Ye School of Informatics & Computing, IUB
I519 Introduction to Bioinformatics, 2015 Genome Comparison Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Whole genome comparison/alignment Build better phylogenies Identify polymorphism
More informationAn experimental investigation on the pancake problem
An experimental investigation on the pancake problem Bruno Bouzy Paris Descartes University IJCAI Computer Game Workshop Buenos-Aires July, 0 Outline The pancake problem The genome rearrangement problem
More informationGreedy Algorithms. CS 498 SS Saurabh Sinha
Greedy Algorithms CS 498 SS Saurabh Sinha Chapter 5.5 A greedy approach to the motif finding problem Given t sequences of length n each, to find a profile matrix of length l. Enumerative approach O(l n
More informationMultiple Whole Genome Alignment
Multiple Whole Genome Alignment BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 206 Anthony Gitter gitter@biostat.wisc.edu These slides, excluding third-party material, are licensed under CC BY-NC 4.0 by
More informationIsolating - A New Resampling Method for Gene Order Data
Isolating - A New Resampling Method for Gene Order Data Jian Shi, William Arndt, Fei Hu and Jijun Tang Abstract The purpose of using resampling methods on phylogenetic data is to estimate the confidence
More informationBioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
More informationAnalysis of Gene Order Evolution beyond Single-Copy Genes
Analysis of Gene Order Evolution beyond Single-Copy Genes Nadia El-Mabrouk Département d Informatique et de Recherche Opérationnelle Université de Montréal mabrouk@iro.umontreal.ca David Sankoff Department
More information10-810: Advanced Algorithms and Models for Computational Biology. microrna and Whole Genome Comparison
10-810: Advanced Algorithms and Models for Computational Biology microrna and Whole Genome Comparison Central Dogma: 90s Transcription factors DNA transcription mrna translation Proteins Central Dogma:
More informationChapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
More informationThe combinatorics and algorithmics of genomic rearrangements have been the subject of much
JOURNAL OF COMPUTATIONAL BIOLOGY Volume 22, Number 5, 2015 # Mary Ann Liebert, Inc. Pp. 425 435 DOI: 10.1089/cmb.2014.0096 An Exact Algorithm to Compute the Double-Cutand-Join Distance for Genomes with
More informationComputational Genetics Winter 2013 Lecture 10. Eleazar Eskin University of California, Los Angeles
Computational Genetics Winter 2013 Lecture 10 Eleazar Eskin University of California, Los ngeles Pair End Sequencing Lecture 10. February 20th, 2013 (Slides from Ben Raphael) Chromosome Painting: Normal
More informationJijun Tang and Bernard M.E. Moret. Department of Computer Science, University of New Mexico, Albuquerque, NM 87131, USA
BIOINFORMATICS Vol. 19 Suppl. 1 2003, pages i30 i312 DOI:.93/bioinformatics/btg42 Scaling up accurate phylogenetic reconstruction from gene-order data Jijun Tang and Bernard M.E. Moret Department of Computer
More informationMultiple genome rearrangement
Multiple genome rearrangement David Sankoff Mathieu Blanchette 1 Introduction Multiple alignment of macromolecular sequences, an important topic of algorithmic research for at least 25 years [13, 10],
More informationPhylogenetic Reconstruction: Handling Large Scale
p. Phylogenetic Reconstruction: Handling Large Scale and Complex Data Bernard M.E. Moret Department of Computer Science University of New Mexico p. Acknowledgments Main collaborators: Tandy Warnow (UT
More informationBurnt Pancake Problem : New Results (New Lower Bounds on the Diameter and New Experimental Optimality Ratios)
Burnt Pancake Problem : New Results (New Lower Bounds on the Diameter and New Experimental Optimality Ratios) Bruno Bouzy Paris Descartes University SoCS 06 Tarrytown July 6-8, 06 Outline The Burnt Pancake
More informationOn the tandem duplication-random loss model of genome rearrangement
On the tandem duplication-random loss model of genome rearrangement Kamalika Chaudhuri Kevin Chen Radu Mihaescu Satish Rao November 1, 2005 Abstract We initiate the algorithmic study of a new model of
More informationEric Tannier* - Chunfang Zheng - David Sankoff - *Corresponding author
BMC Bioinformatics BioMed Central Methodology article Multichromosomal median and halving problems under different genomic distances Eric Tannier* 1,, Chunfang Zheng 3 and David Sankoff 3 Open Access Address:
More informationGASTS: Parsimony Scoring under Rearrangements
GASTS: Parsimony Scoring under Rearrangements Andrew Wei Xu and Bernard M.E. Moret Laboratory for Computational Biology and Bioinformatics, EPFL, EPFL-IC-LCBB INJ230, Station 14, CH-1015 Lausanne, Switzerland
More informationAdvances in Phylogeny Reconstruction from Gene Order and Content Data
Advances in Phylogeny Reconstruction from Gene Order and Content Data Bernard M.E. Moret Department of Computer Science, University of New Mexico, Albuquerque NM 87131 Tandy Warnow Department of Computer
More informationBMI/CS 776 Lecture #20 Alignment of whole genomes. Colin Dewey (with slides adapted from those by Mark Craven)
BMI/CS 776 Lecture #20 Alignment of whole genomes Colin Dewey (with slides adapted from those by Mark Craven) 2007.03.29 1 Multiple whole genome alignment Input set of whole genome sequences genomes diverged
More informationDiscrete Applied Mathematics
Discrete Applied Mathematics 159 (2011) 1641 1645 Contents lists available at ScienceDirect Discrete Applied Mathematics journal homepage: www.elsevier.com/locate/dam Note Girth of pancake graphs Phillip
More information17 Non-collinear alignment Motivation A B C A B C A B C A B C D A C. This exposition is based on:
17 Non-collinear alignment This exposition is based on: 1. Darling, A.E., Mau, B., Perna, N.T. (2010) progressivemauve: multiple genome alignment with gene gain, loss and rearrangement. PLoS One 5(6):e11147.
More informationSUPPLEMENTARY INFORMATION
Supplementary information S1 (box). Supplementary Methods description. Prokaryotic Genome Database Archaeal and bacterial genome sequences were downloaded from the NCBI FTP site (ftp://ftp.ncbi.nlm.nih.gov/genomes/all/)
More informationHigh-Performance Algorithm Engineering for Large-Scale Graph Problems and Computational Biology
High-Performance Algorithm Engineering for Large-Scale Graph Problems and Computational Biology David A. Bader Electrical and Computer Engineering Department, University of New Mexico, Albuquerque, NM
More informationA Framework for Orthology Assignment from Gene Rearrangement Data
A Framework for Orthology Assignment from Gene Rearrangement Data Krister M. Swenson, Nicholas D. Pattengale, and B.M.E. Moret Department of Computer Science University of New Mexico Albuquerque, NM 87131,
More informationComparing whole genomes
BioNumerics Tutorial: Comparing whole genomes 1 Aim The Chromosome Comparison window in BioNumerics has been designed for large-scale comparison of sequences of unlimited length. In this tutorial you will
More informationTree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
More informationI. Molecules and Cells: Cells are the structural and functional units of life; cellular processes are based on physical and chemical changes.
I. Molecules and Cells: Cells are the structural and functional units of life; cellular processes are based on physical and chemical changes. A. Chemistry of Life B. Cells 1. Water How do the unique chemical
More informationPhenotypic Evolution. and phylogenetic comparative methods. G562 Geometric Morphometrics. Department of Geological Sciences Indiana University
Phenotypic Evolution and phylogenetic comparative methods Phenotypic Evolution Change in the mean phenotype from generation to generation... Evolution = Mean(genetic variation * selection) + Mean(genetic
More informationPresentation by Julie Hudson MAT5313
Proc. Natl. Acad. Sci. USA Vol. 89, pp. 6575-6579, July 1992 Evolution Gene order comparisons for phylogenetic inference: Evolution of the mitochondrial genome (genomics/algorithm/inversions/edit distance/conserved
More informationTime to learn about NP-completeness!
Time to learn about NP-completeness! Harvey Mudd College March 19, 2007 Languages A language is a set of strings Examples The language of strings of all zeros with odd length The language of strings with
More informationMichael Yaffe Lecture #5 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D
7.91 Lecture #5 Database Searching & Molecular Phylogenetics Michael Yaffe B C D B C D (((,B)C)D) Outline Distance Matrix Methods Neighbor-Joining Method and Related Neighbor Methods Maximum Likelihood
More informationHaploid & diploid recombination and their evolutionary impact
Haploid & diploid recombination and their evolutionary impact W. Garrett Mitchener College of Charleston Mathematics Department MitchenerG@cofc.edu http://mitchenerg.people.cofc.edu Introduction The basis
More informationBINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
More informationThe Hamiltonian Strictly Alternating Cycle Problem
Advanced Studies in Biology, Vol. 4, 2012, no. 10, 491-495 The Hamiltonian Strictly Alternating Cycle Problem Anna Gorbenko Department of Intelligent Systems and Robotics Ural Federal University 620083
More informationEvolution of sex-dependent mtdna transmission in freshwater mussels (Bivalvia: Unionida)
Evolution of sex-dependent mtdna transmission in freshwater mussels (Bivalvia: Unionida) Davide Guerra 1, Federico Plazzi 2, Donald T. Stewart 3, Arthur E. Bogan 4, Walter R. Hoeh 5 & Sophie Breton 1 1
More informationI519 Introduction to Bioinformatics, Genome Comparison. Yuzhen Ye School of Informatics & Computing, IUB
I519 Introduction to Bioinformatics, 2011 Genome Comparison Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Whole genome comparison/alignment Build better phylogenies Identify polymorphism
More informationSynteny Portal Documentation
Synteny Portal Documentation Synteny Portal is a web application portal for visualizing, browsing, searching and building synteny blocks. Synteny Portal provides four main web applications: SynCircos,
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationChromosomal rearrangements in mammalian genomes : characterising the breakpoints. Claire Lemaitre
PhD defense Chromosomal rearrangements in mammalian genomes : characterising the breakpoints Claire Lemaitre Laboratoire de Biométrie et Biologie Évolutive Université Claude Bernard Lyon 1 6 novembre 2008
More informationGENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.
!! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory
More informationImproving Tree Search in Phylogenetic Reconstruction from Genome Rearrangement Data
Improving Tree Search in Phylogenetic Reconstruction from Genome Rearrangement Data Fei Ye 1,YanGuo, Andrew Lawson 1, and Jijun Tang, 1 Department of Epidemiology and Biostatistics University of South
More informationA greedy, graph-based algorithm for the alignment of multiple homologous gene lists
A greedy, graph-based algorithm for the alignment of multiple homologous gene lists Jan Fostier, Sebastian Proost, Bart Dhoedt, Yvan Saeys, Piet Demeester, Yves Van de Peer, and Klaas Vandepoele Bioinformatics
More informationCase Study. Who s the daddy? TEACHER S GUIDE. James Clarkson. Dean Madden [Ed.] Polyploidy in plant evolution. Version 1.1. Royal Botanic Gardens, Kew
TEACHER S GUIDE Case Study Who s the daddy? Polyploidy in plant evolution James Clarkson Royal Botanic Gardens, Kew Dean Madden [Ed.] NCBE, University of Reading Version 1.1 Polypoidy in plant evolution
More informationPhylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
More informationDraft document version 0.6; ClustalX version 2.1(PC), (Mac); NJplot version 2.3; 3/26/2012
Comparing DNA Sequences to Determine Evolutionary Relationships of Molluscs This activity serves as a supplement to the online activity Biodiversity and Evolutionary Trees: An Activity on Biological Classification
More informationReconstructing genome mixtures from partial adjacencies
PROCEEDINGS Open Access Reconstructing genome mixtures from partial adjacencies Ahmad Mahmoody *, Crystal L Kahn, Benjamin J Raphael * From Tenth Annual Research in Computational Molecular Biology (RECOMB)
More informationProcesses of Evolution
15 Processes of Evolution Forces of Evolution Concept 15.4 Selection Can Be Stabilizing, Directional, or Disruptive Natural selection can act on quantitative traits in three ways: Stabilizing selection
More informationAn Efficient Probabilistic Population-Based Descent for the Median Genome Problem
An Efficient Probabilistic Population-Based Descent for the Median Genome Problem Adrien Goëffon INRIA Bordeaux Sud-Ouest 351 cours de la Libération 33400 Talence, France goeffon@labri.fr Macha Nikolski
More informationSection 1.4. Meaning of Slope for Equations, Graphs, and Tables
Section 1.4 Meaning of Slope for Equations, Graphs, and Tables Finding Slope from a Linear Equation Finding Slope from a Linear Equation Example Find the slope of the line Solution Create a table using
More informationGenome Rearrangement. 1 Inversions. Rick Durrett 1
Genome Rearrangement Rick Durrett 1 Dept. of Math., Cornell U., Ithaca NY, 14853 rtd1@cornell.edu Genomes evolve by chromosomal fissions and fusions, reciprocal translocations between chromosomes, and
More informationthat of Phylotree.org, mtdna tree Build 1756 (Supplementary TableS2). is resulted in 78 individuals allocated to the hg B4a1a1 and three individuals to hg Q. e control region (nps 57372 and nps 1602416526)
More informationSome Algorithmic Challenges in Genome-Wide Ortholog Assignment
Jiang T. Some algorithmic challenges in genome-wide ortholog assignment. JOURNAL OF COMPUTER SCIENCE AND TECHNOLOGY 25(1): 1 Jan. 2010 Some Algorithmic Challenges in Genome-Wide Ortholog Assignment Tao
More informationThis is a survey designed for mathematical programming people who do not know molecular biology and
INFORMS Journal on Computing Vol. 16, No. 3, Summer 2004, pp. 211 231 issn 0899-1499 eissn 1526-5528 04 1603 0211 informs doi 10.1287/ijoc.1040.0073 2004 INFORMS Opportunities for Combinatorial Optimization
More informationPhylogenetic Reconstruction
Phylogenetic Reconstruction from Gene-Order Data Bernard M.E. Moret compbio.unm.edu Department of Computer Science University of New Mexico p. 1/71 Acknowledgments Close Collaborators: at UNM: David Bader
More informationHexapoda Origins: Monophyletic, Paraphyletic or Polyphyletic? Rob King and Matt Kretz
Hexapoda Origins: Monophyletic, Paraphyletic or Polyphyletic? Rob King and Matt Kretz Outline Review Hexapod Origins Response to Hexapod Origins How the same data = different trees Arthropod Origins The
More informationPhylogenetic Reconstruction from Gene-Order Data
p.1/7 Phylogenetic Reconstruction from Gene-Order Data Bernard M.E. Moret compbio.unm.edu Department of Computer Science University of New Mexico p.2/7 Acknowledgments Close Collaborators: at UNM: David
More informationChapter 3: Phylogenetics
Chapter 3: Phylogenetics 3. Computing Phylogeny Prof. Yechiam Yemini (YY) Computer Science epartment Columbia niversity Overview Computing trees istance-based techniques Maximal Parsimony (MP) techniques
More informationEVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
More informationA Phylogenetic Network Construction due to Constrained Recombination
A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer
More informationMolecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
More informationSorting by Transpositions is Difficult
Sorting by Transpositions is Difficult Laurent Bulteau, Guillaume Fertin, Irena Rusu Laboratoire d Informatique de Nantes-Atlantique (LINA), UMR CNRS 6241 Université de Nantes, 2 rue de la Houssinière,
More informationEssentiality in B. subtilis
Essentiality in B. subtilis 100% 75% Essential genes Non-essential genes Lagging 50% 25% Leading 0% non-highly expressed highly expressed non-highly expressed highly expressed 1 http://www.pasteur.fr/recherche/unites/reg/
More informationOGtree: a tool for creating genome trees of prokaryotes based on overlapping genes
Published online 2 May 2008 Nucleic Acids Research, 2008, Vol. 36, Web Server issue W475 W480 doi:10.1093/nar/gkn240 OGtree: a tool for creating genome trees of prokaryotes based on overlapping genes Li-Wei
More informationBreakpoint Graphs and Ancestral Genome Reconstructions
Breakpoint Graphs and Ancestral Genome Reconstructions Max A. Alekseyev and Pavel A. Pevzner Department of Computer Science and Engineering University of California at San Diego, U.S.A. {maxal,ppevzner}@cs.ucsd.edu
More informationMolecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
More informationa-dB. Code assigned:
This form should be used for all taxonomic proposals. Please complete all those modules that are applicable (and then delete the unwanted sections). For guidance, see the notes written in blue and the
More informationA Genetic Algorithm with Expansion and Exploration Operators for the Maximum Satisfiability Problem
Applied Mathematical Sciences, Vol. 7, 2013, no. 24, 1183-1190 HIKARI Ltd, www.m-hikari.com A Genetic Algorithm with Expansion and Exploration Operators for the Maximum Satisfiability Problem Anna Gorbenko
More informationSolution Choose several values for x, and find the corresponding values of (x), or y.
Example 1 GRAPHING FUNCTIONS OF THE FORM (x) = ax n Graph the function. 3 a. f ( x) x Solution Choose several values for x, and find the corresponding values of (x), or y. f ( x) x 3 x (x) 2 8 1 1 0 0
More informationAllen Holder - Trinity University
Haplotyping - Trinity University Population Problems - joint with Courtney Davis, University of Utah Single Individuals - joint with John Louie, Carrol College, and Lena Sherbakov, Williams University
More informationA Minimum Spanning Tree Framework for Inferring Phylogenies
A Minimum Spanning Tree Framework for Inferring Phylogenies Daniel Giannico Adkins Electrical Engineering and Computer Sciences University of California at Berkeley Technical Report No. UCB/EECS-010-157
More informationF1 Parent Cell R R. Name Period. Concept 15.1 Mendelian inheritance has its physical basis in the behavior of chromosomes
Name Period Concept 15.1 Mendelian inheritance has its physical basis in the behavior of chromosomes 1. What is the chromosome theory of inheritance? 2. Explain the law of segregation. Use two different
More informationAlgorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot
More information1 Introduction. Abstract
CBS 530 Assignment No 2 SHUBHRA GUPTA shubhg@asu.edu 993755974 Review of the papers: Construction and Analysis of a Human-Chimpanzee Comparative Clone Map and Intra- and Interspecific Variation in Primate
More informationOMICS Journals are welcoming Submissions
OMICS Journals are welcoming Submissions OMICS International welcomes submissions that are original and technically so as to serve both the developing world and developed countries in the best possible
More informationAssembly improvement: based on Ragout approach. student: Anna Lioznova scientific advisor: Son Pham
Assembly improvement: based on Ragout approach student: Anna Lioznova scientific advisor: Son Pham Plan Ragout overview Datasets Assembly improvements Quality overlap graph paired-end reads Coverage Plan
More informationPhylogenetic Networks with Recombination
Phylogenetic Networks with Recombination October 17 2012 Recombination All DNA is recombinant DNA... [The] natural process of recombination and mutation have acted throughout evolution... Genetic exchange
More informationATLAS of Biochemistry
ATLAS of Biochemistry USER GUIDE http://lcsb-databases.epfl.ch/atlas/ CONTENT 1 2 3 GET STARTED Create your user account NAVIGATE Curated KEGG reactions ATLAS reactions Pathways Maps USE IT! Fill a gap
More informationOn the rank-distance median of 3 permutations
Chindelevitch et al. BMC Bioinformatics 018, 19(Suppl 6):14 https://doi.org/10.1186/s1859-018-131-4 RESEARCH On the rank-distance median of 3 permutations Leonid Chindelevitch 1*, João Paulo Pereira Zanetti
More information