FUNDAMENTALS OF MOLECULAR EVOLUTION

Size: px
Start display at page:

Download "FUNDAMENTALS OF MOLECULAR EVOLUTION"

Transcription

1 FUNDAMENTALS OF MOLECULAR EVOLUTION Second Edition Dan Graur TELAVIV UNIVERSITY Wen-Hsiung Li UNIVERSITY OF CHICAGO SINAUER ASSOCIATES, INC., Publishers Sunderland, Massachusetts

2 Contents Preface xiii Introduction 1 CHAPTER 1 Genes, Genetic Codes, and Mutation 5 NUCLEOTIDE SEQUENCES 5 GENOMES AND DNAREPLICATION 8 GENES AND GENE STRUCTURE 9 Protein-coding genes 9 RNA-specifying genes 12 Posttranscriptional modifications of RNA 13 Untranscribed genes 13 Pseudogenes 14 AMINO ACIDS 15 PROTEINS 20 TRANSLATION AND GENETIC CODES 22 MUTATION 25 Substitution mutations 26 Recombination 29 Deletions and insertions 32 Inversions 35 Mutation rates 35 Spatial distribution of mutations 37 Patterns of mutation 38 Are mutations random? 38 FURTHER READINGS 38 CHAPTER 2 Dynamics of Genes in Populations 39 CHANGES IN ALLELE FREQUENCIES 40 NATURAL SELECTION 41 Codominance 43 Dominance 44 Overdominance and underdominance 45 RANDOM GENETIC DRIFT 47 EFFECTIVE POPULATION SIZE 52 GENE SUBSTITUTION 53 Fixation probability 54 Fixation time 55 Rate of gene substitution 57 vi

3 Contents vii GENETIC POLYMORPHISM 57 Gene diversity 57 Nucleotide diversity 58 THE DRIVING FORCES IN EVOLUTION 59 The neo-darwinian theory and the neutral mutation hypothesis 61 Testing the neutral mutation hypothesis 63 FURTHER READINGS 65 CHAPTER 3 Evolutionary Change in Nucleotide Sequences 67 NUCLEOTIDE SUBSTITUTION IN A DNA SEQUENCE 67 Jukes and Cantor s one-parameter model 68 Kimura s two-parameter model 71 NUMBER OF NUCLEOTIDE SUBSTITUTIONS BETWEEN TWO DNA SEQUENCES 74 Number of substitutions between two noncoding sequences 75 Substitution schemes with more than two parameters 77 Violation of assumptions 79 Number of substitutions between two protein-coding genes 79 Indirect estimations of the number of nucleotide substitutions 85 AMINO ACID REPLACEMENTS BETWEEN TWO PROTEINS 86 ALIGNMENT OF NUCLEOTIDE AND AMINO ACID SEQUENCES 86 Manual alignment by visual inspection 87 The dot matrix method 87 Distance and similarity methods 90 Alignment algorithms 94 Multiple alignments 97 FURTHER READINGS 98 CHAPTER 4 Rates and Patterns of Nucleotide Substitution 99 RATES OF NUCLEOTIDE SUBSTITUTION 100 Coding regions 101 Noncoding regions 105 Similarity profiles 107 CAUSES OF VARIATION IN SUBSTITUTION RATES 108 Functional constraints 108 Synonymous versus nonsynonymous rates 110 Variation among different gene regions 111 Variation among genes 113 Acceleration of nucleotide substitution rates following partial loss of function 115 Estimating the intensity of purifying selection 116 Mutational input: Male-driven evolution 117 POSITIVE SELECTION 119 Detecting positive selection 119 Parallelism and convergence 121 Prevalence of positive selection 123 PATTERNS OF SUBSTITUTION AND REPLACEMENT 123 Pattern of spontaneous mutation 124 Pattern of substitution in human mitochondrial DNA 127 Patterns of amino acid replacement 128 What protein properties are conserved in evolution? 130

4 viii Contents NONRANDOM USAGE OF SYNONYMOUS CODONS 132 Measures of codon-usage bias 132 Universal and species-specific patterns of codon usage 133 Codon usage in unicellular organisms 134 Codon usage in multicellular organisms 137 Codon usage and population size 139 MOLECULAR CLOCKS 139 RELATIVE RATE TESTS 142 Margoliash, Sarich, and Wilson s test 142 Tajima s 1D method 144 Tests involving comparisons of duplicate genes 145 LOCAL CLOCKS 146 Nearly equal rates in mice and rats 146 Lower rates in humans than in African apes and monkeys 147 Higher rates in rodents than in primates 148 EVALUATION OF THE MOLECULAR CLOCK HYPOTHESIS 150 Causes of variation in substitution rates among evolutionary lineages 151 Are living fossils molecular fossils too? 153 Primitive versus advanced : A question of rates 153 Phyletic gradualism versus punctuated equilibria at the molecular level 154 RATES OF SUBSTITUTION IN ORGANELLE DNA 155 Mammalian mitochondrial genes 157 Plant nuclear, mitochondrial, and chloroplast DNAs 157 Substitution and rearrangement rates 160 RATES OF SUBSTITUTION IN RNA VIRUSES 160 Estimation models 161 Human immunodeficiency viruses 162 FURTHER READINGS 163 CHAPTER 5 Molecular Phylogenetics 165 IMPACTS OF MOLECULAR DATA ON PHYLOGENETIC STUDIES 165 ADVANTAGES OF MOLECULAR DATA IN PHYLOGENETIC STUDIES 167 TERMINOLOGY OF PHYLOGENETIC TREES 167 Rooted and unrooted trees 169 Scaled and unscaled trees 169 The Newick format 170 Number of possible phylogenetic trees 170 True and inferred trees 173 Gene trees and species trees 174 Taxa and clades 176 TYPES OF DATA 177 Character data 177 Assumptions about character evolution 178 Polarity and taxonomic distribution of character states 180 Distance data 180 METHODS OF TREE RECONSTRUCTION 181 DISTANCE MATRIX METHODS 182 Unweighted pair-group method with arithmetic means (UPGMA) 183 Transformed distance method 185

5 Contents ix Sattath and Tversky s neighborsrelations method 186 Saitou and Nei s neighbor-joining method 189 MAXIMUM PARSIMONY METHODS 189 Weighted and unweighted parsimony 193 Searching for the maximum parsimony tree 194 MAXIMUM LIKELIHOOD METHODS 198 ROOTING UNROOTED TREES 200 ESTIMATING BRANCH LENGTHS 202 ESTIMATING SPECIES DIVERGENCE TIMES 204 TOPOLOGICAL COMPARISONS 206 Penny and Hendy s topological distance 206 Consensus trees 206 ASSESSING TREE RELIABILITY 208 The bootstrap 209 Tests for two competing trees 211 PROBLEMS ASSOCIATED WITH PHYLO- GENETIC RECONSTRUCTION 212 Strengths and weaknesses of different methods 214 Minimizing error in phylogenetic analysis 216 MOLECULAR PHYLOGENETIC EXAMPLES 217 Phylogeny of humans and apes 217 Cetartiodactyla and SINE phylogeny 225 The origin of angiosperms 228 MOLECULAR PHYLOGENETIC ARCHEOLOGY 230 Phylogeny of the marsupial wolf 232 Is the quagga extinct? 232 The dusky seaside sparrow 234 THE UNIVERSAL PHYLOGENY 237 The first divergence events 238 The cenancestor 243 Endosymbiotic origin of mitochondria and chloroplasts 245 FURTHER READINGS 247 CHAPTER 6 Gene Duplication, Exon Shuffling, and Concerted Evolution 249 TYPES OF GENE DUPLICATION 250 DOMAINS AND EXONS 250 DOMAIN DUPLICATION AND GENE ELONGATION 255 The ovomucoid gene 258 Enhancement of function in the 2 allele of haptoglobin 258 Origin of an antifreeze glycoprotein gene 260 Prevalence of domain duplication 262 FORMATION OF GENE FAMILIES AND THE ACQUISITION OF NEW FUNCTIONS 262 RNA-specifying genes 265 Isozymes 268 Opsins 269 DATING GENE DUPLICATIONS 271 GENE LOSS 273 Unprocessed pseudogenes 274 Unitary pseudogenes 275 Nonfunctionalization time 276 THE GLOBIN SUPERFAMILY 278 PREVALENCE OF GENE DUPLICATION, GENE LOSS, AND FUNCTIONAL DIVERGENCE 281

6 x Contents EXON SHUFFLING 283 Mosaic proteins 283 Phase limitations on exon shuffling 286 Exonization and pseudoexonization 289 Different strategies of multidomain gene assembly 290 THE INTRONS-EARLY VERSUS INTRONS-LATE HYPOTHESES 291 Intron sliding 292 The relative fraction of early and late introns 294 ALTERNATIVE PATHWAYS FOR PRODUCING NEW FUNCTIONS 294 Overlapping genes 294 Alternative splicing 296 Intron-encoded proteins and nested genes 299 Functional convergence 299 RNA editing 301 Gene sharing 302 MOLECULAR TINKERING 303 CONCERTED EVOLUTION 304 MECHANISMS OF CONCERTED EVOLUTION 308 Gene conversion 308 Unequal crossing over 309 Relative roles of gene conversion and unequal crossing over 312 DETECTION AND EXAMPLES OF CONCERTED EVOLUTION 313 The A and G -globin genes in the great apes 314 The concerted evolution of genes and pseudogenes 315 FACTORS AFFECTING THE RATE OF CONCERTED EVOLUTION 317 Number of repeats 318 Arrangement of repeats 318 Structure of the repeat unit 318 Functional requirement 319 Populational processes 320 EVOLUTIONARY IMPLICATIONS OF CONCERTED EVOLUTION 320 Spread of advantageous mutations 320 Retardation of paralogous gene divergence 321 Generation of genic variation 321 METHODOLOGICAL PITFALLS DUE TO CONCERTED EVOLUTION 322 FURTHER READINGS 322 CHAPTER 7 Evolution by Transposition 323 TRANSPOSITION AND RETROPOSITION 323 TRANSPOSABLE ELEMENTS 325 Insertion sequences 326 Transposons 327 Taxonomic, developmental, and target specificity of transposition 328 Autonomy of transposition 329 RETROELEMENTS 329 Retroviruses 330 Retroposons and retrotransposons 330 Retrons 333 Pararetroviruses 333 Evolutionary origin of retroelements 334 RETROSEQUENCES 336 Retrogenes 336 Semiprocessed retrogenes 338 Retropseudogenes 338 Sequence evolution of retropseudogenes 341

7 Contents xi LINES AND SINES 343 SINEs derived from 7SL RNA 344 SINEs derived from trnas 346 Where there s a SINE, there s a LINE 347 DNA-mediated transposable elements and transposable fossils 349 Rate of SINE evolution 349 GENETIC AND EVOLUTIONARY EFFECTS OF TRANSPOSITION 349 Hybrid dysgenesis 354 Transposition and speciation 357 Evolutionary dynamics of transposable element copy number 358 HORIZONTAL GENE TRANSFER 359 Horizontal transfer of virogenes from baboons to cats 361 Horizontal transfer of P elements between Drosophila species 363 Promiscuous DNA 365 FURTHER READINGS 366 CHAPTER 8 Genome Evolution 367 C VALUES 368 THE EVOLUTION OF GENOME SIZE IN PROKARYOTES 368 THE MINIMAL GENOME 371 The analytical approach 371 The experimental approach 373 GENOME MINIATURIZATION 374 Genome size reduction following endosymbiosis 374 Genome size reduction in parasites 375 GENOME SIZE IN EUKARYOTES AND THE C VALUE PARADOX 375 MECHANISMS FOR GLOBAL INCREASES IN GENOME SIZE 380 Polyploidization 380 Polysomy 382 The yeast genome 382 Polyploidy of the vertebrate genome 384 MAINTENANCE OF NONGENIC DNA 384 The hypotheses 386 The evidence 387 Why do similar species have different genome sizes? 388 THE REPETITIVE STRUCTURE OF THE EUKARYOTIC GENOME 389 Localized repeated sequences 390 Dispersed repeated sequences 392 Repetitive sequences as a cause of variation in genome size 394 MECHANISMS FOR REGIONAL INCREASES IN GENOME SIZE 395 GENE DISTRIBUTION 397 How many genes are there, where are they, and do we need them? 397 Gene number evolution 400 CHROMOSOMAL EVOLUTION 402 Chromosomes, plasmids, and episomes 402 Evolution of chromosome number in prokaryotes 402 Chromosome number variation in eukaryotes 403 MECHANISMS FOR CHANGES IN GENE ORDER AND GENE DISTRIBUTION AMONG CHROMOSOMES 404 Counting gene order rearrangement events 406

8 xii Contents Gene order rearrangements in bacteria 408 Gene order rearrangements in eukaryotes 410 Gene order as a phylogenetic character 411 GC CONTENT IN BACTERIA 412 CHIROCHORES 415 COMPOSITIONAL ORGANIZATION OF THE VERTEBRATE GENOME 417 The distribution of genes and other genetic elements among isochores 420 Origin of isochores 422 EMERGENCE OF NONUNIVERSAL GENETIC CODES 425 FURTHER READINGS 427 APPENDIX I Spatial and Temporal Frameworks of the Evolutionary Process 429 APPENDIX II Basics of Probability 437 LITERATURE CITED 441 INDEX 467 TAXONOMIC INDEX 479

Bio 1B Lecture Outline (please print and bring along) Fall, 2007

Bio 1B Lecture Outline (please print and bring along) Fall, 2007 Bio 1B Lecture Outline (please print and bring along) Fall, 2007 B.D. Mishler, Dept. of Integrative Biology 2-6810, bmishler@berkeley.edu Evolution lecture #5 -- Molecular genetics and molecular evolution

More information

CHAPTERS 24-25: Evidence for Evolution and Phylogeny

CHAPTERS 24-25: Evidence for Evolution and Phylogeny CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology

More information

Outline. Genome Evolution. Genome. Genome Architecture. Constraints on Genome Evolution. New Evolutionary Synthesis 11/8/16

Outline. Genome Evolution. Genome. Genome Architecture. Constraints on Genome Evolution. New Evolutionary Synthesis 11/8/16 Genome Evolution Outline 1. What: Patterns of Genome Evolution Carol Eunmi Lee Evolution 410 University of Wisconsin 2. Why? Evolution of Genome Complexity and the interaction between Natural Selection

More information

"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky

Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally

More information

C3020 Molecular Evolution. Exercises #3: Phylogenetics

C3020 Molecular Evolution. Exercises #3: Phylogenetics C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from

More information

Lecture 7 Mutation and genetic variation

Lecture 7 Mutation and genetic variation Lecture 7 Mutation and genetic variation Thymidine dimer Natural selection at a single locus 2. Purifying selection a form of selection acting to eliminate harmful (deleterious) alleles from natural populations.

More information

Lecture Notes: BIOL2007 Molecular Evolution

Lecture Notes: BIOL2007 Molecular Evolution Lecture Notes: BIOL2007 Molecular Evolution Kanchon Dasmahapatra (k.dasmahapatra@ucl.ac.uk) Introduction By now we all are familiar and understand, or think we understand, how evolution works on traits

More information

Outline. Genome Evolution. Genome. Genome Architecture. Constraints on Genome Evolution. New Evolutionary Synthesis 11/1/18

Outline. Genome Evolution. Genome. Genome Architecture. Constraints on Genome Evolution. New Evolutionary Synthesis 11/1/18 Genome Evolution Outline 1. What: Patterns of Genome Evolution Carol Eunmi Lee Evolution 410 University of Wisconsin 2. Why? Evolution of Genome Complexity and the interaction between Natural Selection

More information

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological

More information

Molecular Evolution & the Origin of Variation

Molecular Evolution & the Origin of Variation Molecular Evolution & the Origin of Variation What Is Molecular Evolution? Molecular evolution differs from phenotypic evolution in that mutations and genetic drift are much more important determinants

More information

Molecular Evolution & the Origin of Variation

Molecular Evolution & the Origin of Variation Molecular Evolution & the Origin of Variation What Is Molecular Evolution? Molecular evolution differs from phenotypic evolution in that mutations and genetic drift are much more important determinants

More information

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

More information

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

More information

Principles of Genetics

Principles of Genetics Principles of Genetics Snustad, D ISBN-13: 9780470903599 Table of Contents C H A P T E R 1 The Science of Genetics 1 An Invitation 2 Three Great Milestones in Genetics 2 DNA as the Genetic Material 6 Genetics

More information

Dr. Amira A. AL-Hosary

Dr. Amira A. AL-Hosary Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

More information

Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics

Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods

More information

Understanding relationship between homologous sequences

Understanding relationship between homologous sequences Molecular Evolution Molecular Evolution How and when were genes and proteins created? How old is a gene? How can we calculate the age of a gene? How did the gene evolve to the present form? What selective

More information

Genomes and Their Evolution

Genomes and Their Evolution Chapter 21 Genomes and Their Evolution PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from

More information

C.DARWIN ( )

C.DARWIN ( ) C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships

More information

Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships

Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic

More information

8/23/2014. Phylogeny and the Tree of Life

8/23/2014. Phylogeny and the Tree of Life Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major

More information

SEQUENCE DIVERGENCE,FUNCTIONAL CONSTRAINT, AND SELECTION IN PROTEIN EVOLUTION

SEQUENCE DIVERGENCE,FUNCTIONAL CONSTRAINT, AND SELECTION IN PROTEIN EVOLUTION Annu. Rev. Genomics Hum. Genet. 2003. 4:213 35 doi: 10.1146/annurev.genom.4.020303.162528 Copyright c 2003 by Annual Reviews. All rights reserved First published online as a Review in Advance on June 4,

More information

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species

More information

7. Tests for selection

7. Tests for selection Sequence analysis and genomics 7. Tests for selection Dr. Katja Nowick Group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute for Brain Research www. nowicklab.info

More information

Constructing Evolutionary/Phylogenetic Trees

Constructing Evolutionary/Phylogenetic Trees Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood

More information

Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016

Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016 Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,

More information

Lecture 20 DNA Repair and Genetic Recombination (Chapter 16 and Chapter 15 Genes X)

Lecture 20 DNA Repair and Genetic Recombination (Chapter 16 and Chapter 15 Genes X) Lecture 20 DNA Repair and Genetic Recombination (Chapter 16 and Chapter 15 Genes X) Retrotransposons of the viral superfamily are transposons that mobilize via an RNA that does not form an infectious particle.

More information

POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics

POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the

More information

Phylogenetics: Building Phylogenetic Trees

Phylogenetics: Building Phylogenetic Trees 1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should

More information

Phylogenetic Tree Reconstruction

Phylogenetic Tree Reconstruction I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven

More information

METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.

METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern

More information

Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University

Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary

More information

Unit 7: Evolution Guided Reading Questions (80 pts total)

Unit 7: Evolution Guided Reading Questions (80 pts total) AP Biology Biology, Campbell and Reece, 10th Edition Adapted from chapter reading guides originally created by Lynn Miriello Name: Unit 7: Evolution Guided Reading Questions (80 pts total) Chapter 22 Descent

More information

EVOLUTIONARY DISTANCES

EVOLUTIONARY DISTANCES EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:

More information

Gene Families part 2. Review: Gene Families /727 Lecture 8. Protein family. (Multi)gene family

Gene Families part 2. Review: Gene Families /727 Lecture 8. Protein family. (Multi)gene family Review: Gene Families Gene Families part 2 03 327/727 Lecture 8 What is a Case study: ian globin genes Gene trees and how they differ from species trees Homology, orthology, and paralogy Last tuesday 1

More information

Unit 9: Evolution Guided Reading Questions (80 pts total)

Unit 9: Evolution Guided Reading Questions (80 pts total) Name: AP Biology Biology, Campbell and Reece, 7th Edition Adapted from chapter reading guides originally created by Lynn Miriello Unit 9: Evolution Guided Reading Questions (80 pts total) Chapter 22 Descent

More information

UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)

UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the

More information

Lecture 20 DNA Repair and Genetic Recombination (Chapter 16 and Chapter 15 Genes X)

Lecture 20 DNA Repair and Genetic Recombination (Chapter 16 and Chapter 15 Genes X) Lecture 20 DNA Repair and Genetic Recombination (Chapter 16 and Chapter 15 Genes X) The minimum gene number required for any type of organism increases with its complexity.. Courtesy of Eishi Noguchi,

More information

Microbial Taxonomy and the Evolution of Diversity

Microbial Taxonomy and the Evolution of Diversity 19 Microbial Taxonomy and the Evolution of Diversity Copyright McGraw-Hill Global Education Holdings, LLC. Permission required for reproduction or display. 1 Taxonomy Introduction to Microbial Taxonomy

More information

Molecular evolution - Part 1. Pawan Dhar BII

Molecular evolution - Part 1. Pawan Dhar BII Molecular evolution - Part 1 Pawan Dhar BII Theodosius Dobzhansky Nothing in biology makes sense except in the light of evolution Age of life on earth: 3.85 billion years Formation of planet: 4.5 billion

More information

Natural selection on the molecular level

Natural selection on the molecular level Natural selection on the molecular level Fundamentals of molecular evolution How DNA and protein sequences evolve? Genetic variability in evolution } Mutations } forming novel alleles } Inversions } change

More information

Evolutionary Genomics and Proteomics

Evolutionary Genomics and Proteomics Evolutionary Genomics and Proteomics Mark Pagel Andrew Pomiankowski Editors Sinauer Associates, Inc. Publishers Sunderland, Massachusetts 01375 Table of Contents Preface xiii Contributors xv CHAPTER 1

More information

Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center

Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods

More information

GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.

GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS. !! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory

More information

Theory of Evolution Charles Darwin

Theory of Evolution Charles Darwin Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties

More information

Phylogenetic inference

Phylogenetic inference Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types

More information

Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.

Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5. Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony

More information

Multiple Sequence Alignment. Sequences

Multiple Sequence Alignment. Sequences Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe

More information

Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz

Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels

More information

Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline

Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying

More information

- mutations can occur at different levels from single nucleotide positions in DNA to entire genomes.

- mutations can occur at different levels from single nucleotide positions in DNA to entire genomes. February 8, 2005 Bio 107/207 Winter 2005 Lecture 11 Mutation and transposable elements - the term mutation has an interesting history. - as far back as the 17th century, it was used to describe any drastic

More information

The Eukaryotic Genome and Its Expression. The Eukaryotic Genome and Its Expression. A. The Eukaryotic Genome. Lecture Series 11

The Eukaryotic Genome and Its Expression. The Eukaryotic Genome and Its Expression. A. The Eukaryotic Genome. Lecture Series 11 The Eukaryotic Genome and Its Expression Lecture Series 11 The Eukaryotic Genome and Its Expression A. The Eukaryotic Genome B. Repetitive Sequences (rem: teleomeres) C. The Structures of Protein-Coding

More information

Molecular Markers, Natural History, and Evolution

Molecular Markers, Natural History, and Evolution Molecular Markers, Natural History, and Evolution Second Edition JOHN C. AVISE University of Georgia Sinauer Associates, Inc. Publishers Sunderland, Massachusetts Contents PART I Background CHAPTER 1:

More information

Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço

Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço Molecular Phylogenetics (part 1 of 2) Computational Biology Course João André Carriço jcarrico@fm.ul.pt Charles Darwin (1809-1882) Charles Darwin s tree of life in Notebook B, 1837-1838 Ernst Haeckel (1934-1919)

More information

Inferring phylogeny. Today s topics. Milestones of molecular evolution studies Contributions to molecular evolution

Inferring phylogeny. Today s topics. Milestones of molecular evolution studies Contributions to molecular evolution Today s topics Inferring phylogeny Introduction! Distance methods! Parsimony method!"#$%&'(!)* +,-.'/01!23454(6!7!2845*0&4'9#6!:&454(6 ;?@AB=C?DEF Overview of phylogenetic inferences Methodology Methods

More information

Introduction to Molecular and Cell Biology

Introduction to Molecular and Cell Biology Introduction to Molecular and Cell Biology Molecular biology seeks to understand the physical and chemical basis of life. and helps us answer the following? What is the molecular basis of disease? What

More information

2012 Univ Aguilera Lecture. Introduction to Molecular and Cell Biology

2012 Univ Aguilera Lecture. Introduction to Molecular and Cell Biology 2012 Univ. 1301 Aguilera Lecture Introduction to Molecular and Cell Biology Molecular biology seeks to understand the physical and chemical basis of life. and helps us answer the following? What is the

More information

Genetic Variation: The genetic substrate for natural selection. Horizontal Gene Transfer. General Principles 10/2/17.

Genetic Variation: The genetic substrate for natural selection. Horizontal Gene Transfer. General Principles 10/2/17. Genetic Variation: The genetic substrate for natural selection What about organisms that do not have sexual reproduction? Horizontal Gene Transfer Dr. Carol E. Lee, University of Wisconsin In prokaryotes:

More information

Evolutionary Theory and Principles of Phylogenetics. Lucy Skrabanek ICB, WMC March 19, 2008

Evolutionary Theory and Principles of Phylogenetics. Lucy Skrabanek ICB, WMC March 19, 2008 Evolutionary Theory and Principles of Phylogenetics Lucy Skrabanek ICB, WMC March 19, 2008 Theory of evolution Evolution: process of change over time 2 competing models Phyletic gradualism Punctuated equilibrium

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods

More information

Chapter 22: Descent with Modification 1. BRIEFLY summarize the main points that Darwin made in The Origin of Species.

Chapter 22: Descent with Modification 1. BRIEFLY summarize the main points that Darwin made in The Origin of Species. AP Biology Chapter Packet 7- Evolution Name Chapter 22: Descent with Modification 1. BRIEFLY summarize the main points that Darwin made in The Origin of Species. 2. Define the following terms: a. Natural

More information

Chapter 18 Active Reading Guide Genomes and Their Evolution

Chapter 18 Active Reading Guide Genomes and Their Evolution Name: AP Biology Mr. Croft Chapter 18 Active Reading Guide Genomes and Their Evolution Most AP Biology teachers think this chapter involves an advanced topic. The questions posed here will help you understand

More information

Cladistics and Bioinformatics Questions 2013

Cladistics and Bioinformatics Questions 2013 AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species

More information

Chapter 27: Evolutionary Genetics

Chapter 27: Evolutionary Genetics Chapter 27: Evolutionary Genetics Student Learning Objectives Upon completion of this chapter you should be able to: 1. Understand what the term species means to biology. 2. Recognize the various patterns

More information

Organization of Genes Differs in Prokaryotic and Eukaryotic DNA Chapter 10 p

Organization of Genes Differs in Prokaryotic and Eukaryotic DNA Chapter 10 p Organization of Genes Differs in Prokaryotic and Eukaryotic DNA Chapter 10 p.110-114 Arrangement of information in DNA----- requirements for RNA Common arrangement of protein-coding genes in prokaryotes=

More information

November 13, 2009 Bioe 109 Fall 2009 Lecture 20 Evolutionary Genomics

November 13, 2009 Bioe 109 Fall 2009 Lecture 20 Evolutionary Genomics November 13, 2009 Bioe 109 Fall 2009 Lecture 20 Evolutionary Genomics - we have now entered the genomics age - the number of complete genomes continues to rise rapidly each year, now numbering about 200.

More information

Molecular Clocks. The Holy Grail. Rate Constancy? Protein Variability. Evidence for Rate Constancy in Hemoglobin. Given

Molecular Clocks. The Holy Grail. Rate Constancy? Protein Variability. Evidence for Rate Constancy in Hemoglobin. Given Molecular Clocks Rose Hoberman The Holy Grail Fossil evidence is sparse and imprecise (or nonexistent) Predict divergence times by comparing molecular data Given a phylogenetic tree branch lengths (rt)

More information

Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis

Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis 10 December 2012 - Corrections - Exercise 1 Non-vertebrate chordates generally possess 2 homologs, vertebrates 3 or more gene copies; a Drosophila

More information

Constructing Evolutionary/Phylogenetic Trees

Constructing Evolutionary/Phylogenetic Trees Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood

More information

GACE Biology Assessment Test I (026) Curriculum Crosswalk

GACE Biology Assessment Test I (026) Curriculum Crosswalk Subarea I. Cell Biology: Cell Structure and Function (50%) Objective 1: Understands the basic biochemistry and metabolism of living organisms A. Understands the chemical structures and properties of biologically

More information

TE content correlates positively with genome size

TE content correlates positively with genome size TE content correlates positively with genome size Mb 3000 Genomic DNA 2500 2000 1500 1000 TE DNA Protein-coding DNA 500 0 Feschotte & Pritham 2006 Transposable elements. Variation in gene numbers cannot

More information

Likelihood Ratio Tests for Detecting Positive Selection and Application to Primate Lysozyme Evolution

Likelihood Ratio Tests for Detecting Positive Selection and Application to Primate Lysozyme Evolution Likelihood Ratio Tests for Detecting Positive Selection and Application to Primate Lysozyme Evolution Ziheng Yang Department of Biology, University College, London An excess of nonsynonymous substitutions

More information

Multiple Choice Review- Eukaryotic Gene Expression

Multiple Choice Review- Eukaryotic Gene Expression Multiple Choice Review- Eukaryotic Gene Expression 1. Which of the following is the Central Dogma of cell biology? a. DNA Nucleic Acid Protein Amino Acid b. Prokaryote Bacteria - Eukaryote c. Atom Molecule

More information

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments

More information

Frequently Asked Questions (FAQs)

Frequently Asked Questions (FAQs) Frequently Asked Questions (FAQs) Q1. What is meant by Satellite and Repetitive DNA? Ans: Satellite and repetitive DNA generally refers to DNA whose base sequence is repeated many times throughout the

More information

How to read and make phylogenetic trees Zuzana Starostová

How to read and make phylogenetic trees Zuzana Starostová How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation

More information

Chapters Objectives

Chapters Objectives Chapter 22 Darwinian View of Life Objectives Chapters 22-26 Objectives The Historical Context for Evolutionary Theory 1 Explain the mechanism for evolutionary change proposed by Charles Darwin in On the

More information

HORIZONTAL TRANSFER IN EUKARYOTES KIMBERLEY MC GRAIL FERNÁNDEZ GENOMICS

HORIZONTAL TRANSFER IN EUKARYOTES KIMBERLEY MC GRAIL FERNÁNDEZ GENOMICS HORIZONTAL TRANSFER IN EUKARYOTES KIMBERLEY MC GRAIL FERNÁNDEZ GENOMICS OVERVIEW INTRODUCTION MECHANISMS OF HGT IDENTIFICATION TECHNIQUES EXAMPLES - Wolbachia pipientis - Fungus - Plants - Drosophila ananassae

More information

Genome Evolution: Overview

Genome Evolution: Overview Genome Evolution: Overview J Bruce Walsh, University of Arizona, Tucson, Arizona, USA The genome is the total genetic constitution of an organism. Understanding of the structure and evolution of genomes

More information

Processes of Evolution

Processes of Evolution 15 Processes of Evolution Chapter 15 Processes of Evolution Key Concepts 15.1 Evolution Is Both Factual and the Basis of Broader Theory 15.2 Mutation, Selection, Gene Flow, Genetic Drift, and Nonrandom

More information

Major questions of evolutionary genetics. Experimental tools of evolutionary genetics. Theoretical population genetics.

Major questions of evolutionary genetics. Experimental tools of evolutionary genetics. Theoretical population genetics. Evolutionary Genetics (for Encyclopedia of Biodiversity) Sergey Gavrilets Departments of Ecology and Evolutionary Biology and Mathematics, University of Tennessee, Knoxville, TN 37996-6 USA Evolutionary

More information

Inferring phylogeny. Constructing phylogenetic trees. Tõnu Margus. Bioinformatics MTAT

Inferring phylogeny. Constructing phylogenetic trees. Tõnu Margus. Bioinformatics MTAT Inferring phylogeny Constructing phylogenetic trees Tõnu Margus Contents What is phylogeny? How/why it is possible to infer it? Representing evolutionary relationships on trees What type questions questions

More information

Chapter 26: Phylogeny and the Tree of Life

Chapter 26: Phylogeny and the Tree of Life Chapter 26: Phylogeny and the Tree of Life 1. Key Concepts Pertaining to Phylogeny 2. Determining Phylogenies 3. Evolutionary History Revealed in Genomes 1. Key Concepts Pertaining to Phylogeny PHYLOGENY

More information

What is Phylogenetics

What is Phylogenetics What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)

More information

Lecture 6 Phylogenetic Inference

Lecture 6 Phylogenetic Inference Lecture 6 Phylogenetic Inference From Darwin s notebook in 1837 Charles Darwin Willi Hennig From The Origin in 1859 Cladistics Phylogenetic inference Willi Hennig, Cladistics 1. Clade, Monophyletic group,

More information

Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26

Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26 Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,

More information

Variances of the Average Numbers of Nucleotide Substitutions Within and Between Populations

Variances of the Average Numbers of Nucleotide Substitutions Within and Between Populations Variances of the Average Numbers of Nucleotide Substitutions Within and Between Populations Masatoshi Nei and Li Jin Center for Demographic and Population Genetics, Graduate School of Biomedical Sciences,

More information

BIOLOGY FINAL EXAM REVIEW SHEET Chapters 10-15, 17-30

BIOLOGY FINAL EXAM REVIEW SHEET Chapters 10-15, 17-30 Name Hour Due Date: BIOLOGY FINAL EXAM REVIEW SHEET Chapters 10-15, 17-30 The exam was prepared by the Biology teachers in the science departments of CVHS and DHS. 1. What is a Punnett Square? 2. Cross

More information

Drosophila melanogaster and D. simulans, two fruit fly species that are nearly

Drosophila melanogaster and D. simulans, two fruit fly species that are nearly Comparative Genomics: Human versus chimpanzee 1. Introduction The chimpanzee is the closest living relative to humans. The two species are nearly identical in DNA sequence (>98% identity), yet vastly different

More information

Mole_Oce Lecture # 24: Introduction to genomics

Mole_Oce Lecture # 24: Introduction to genomics Mole_Oce Lecture # 24: Introduction to genomics DEFINITION: Genomics: the study of genomes or he study of genes and their function. Genomics (1980s):The systematic generation of information about genes

More information

A Statistical Test of Phylogenies Estimated from Sequence Data

A Statistical Test of Phylogenies Estimated from Sequence Data A Statistical Test of Phylogenies Estimated from Sequence Data Wen-Hsiung Li Center for Demographic and Population Genetics, University of Texas A simple approach to testing the significance of the branching

More information

Eukaryotic vs. Prokaryotic genes

Eukaryotic vs. Prokaryotic genes BIO 5099: Molecular Biology for Computer Scientists (et al) Lecture 18: Eukaryotic genes http://compbio.uchsc.edu/hunter/bio5099 Larry.Hunter@uchsc.edu Eukaryotic vs. Prokaryotic genes Like in prokaryotes,

More information

Phylogenetic analyses. Kirsi Kostamo

Phylogenetic analyses. Kirsi Kostamo Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,

More information

Bioinformatics tools for phylogeny and visualization. Yanbin Yin

Bioinformatics tools for phylogeny and visualization. Yanbin Yin Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and

More information

BIOLOGY 432 Midterm I - 30 April PART I. Multiple choice questions (3 points each, 42 points total). Single best answer.

BIOLOGY 432 Midterm I - 30 April PART I. Multiple choice questions (3 points each, 42 points total). Single best answer. BIOLOGY 432 Midterm I - 30 April 2012 Name PART I. Multiple choice questions (3 points each, 42 points total). Single best answer. 1. Over time even the most highly conserved gene sequence will fix mutations.

More information

MACROEVOLUTION Student Packet SUMMARY EVOLUTION IS A CHANGE IN THE GENETIC MAKEUP OF A POPULATION OVER TIME Macroevolution refers to large-scale

MACROEVOLUTION Student Packet SUMMARY EVOLUTION IS A CHANGE IN THE GENETIC MAKEUP OF A POPULATION OVER TIME Macroevolution refers to large-scale MACROEVOLUTION Student Packet SUMMARY EVOLUTION IS A CHANGE IN THE GENETIC MAKEUP OF A POPULATION OVER TIME Macroevolution refers to large-scale evolutionary changes such as speciation events, origin of

More information

Phylogeny and Systematics

Phylogeny and Systematics Chapter 25 Phylogeny and Systematics PowerPoint Lectures for Biology, Seventh Edition Neil Campbell and Jane Reece Lectures by Chris Romero Modified by Maria Morlin racing phylogeny Phylogeny: he evolutionary

More information

The Phylogenetic Handbook

The Phylogenetic Handbook The Phylogenetic Handbook A Practical Approach to DNA and Protein Phylogeny Edited by Marco Salemi University of California, Irvine and Katholieke Universiteit Leuven, Belgium and Anne-Mieke Vandamme Rega

More information

Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny

More information

Name: Class: Date: ID: A

Name: Class: Date: ID: A Class: _ Date: _ Ch 17 Practice test 1. A segment of DNA that stores genetic information is called a(n) a. amino acid. b. gene. c. protein. d. intron. 2. In which of the following processes does change

More information