Phylogenetic Trees. How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species?
|
|
- Ronald McGee
- 3 years ago
- Views:
Transcription
1 Why? Phylogenetic Trees How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species? The saying Don t judge a book by its cover. could be applied to the topic of evolution. For example, humans share 75% of their DNA with chickens. Biologists point to this as evidence that humans and chickens once shared a common ancestor. The advent of DNA technology has given scientists the tools with which to examine how closely related certain species are. DNA analysis allows scientists to construct phylogenetic trees whose branches link together the relatedness of different organisms. Model 1 Phylogenetic Trees Millions of Years Ago Raccoon Red Panda Common ancestor of all modern Raccoons, Pandas, and Bears. Giant Panda Spectacled Bear * Sloth Bear Sun Bear Black Bear Polar Bear 1. Refer to Model 1. Brown Bear a. How long ago did the common ancestor of all the organisms on this phylogenetic tree exist? b. Which two lines diverged 30 million years ago? c. List all modern descendants of the organism that was alive at the point indicated by the asterisk. Phylogenetic Trees 1
2 2. According to Model 1, when did the Giant Panda line diverge from the line that led to modern bears? 3. According to Model 1, what animal shares the most recent common ancestor with the Brown Bear? 4. In a complete sentence, describe what the branch points and lines in a phylogenetic tree represent. 5. Which of the two branches from the common ancestor in Model 1 has the most living descendants? 6. According to the phylogenetic tree in Model 1, the Red Panda is most closely related to which animal? 7. Which are more closely related, the Giant Panda and the Red Panda or the Giant Panda and the Polar Bear? Justify your answer using grammatically correct sentences. 2 POGIL Activities for AP* Biology
3 Model 2 DNA Sample Comparison Sample 4 Sample 3 G T T T C A G A A C T T G G T G C T A T C C A C T T T G G A A G T A G C A G G T T C Sample 2 Sample 1 G A T T C G G A A C T T C G T G G T T A C C A G T T T G G A C C T A A C A G C T T C G T G A A A C C T T C A T C G T C C A A G DNA from organism A attached to a nitrocellulose membrane. 8. How many bases are found in each of the DNA samples 1 4 as well as in the DNA from organism A in Model 2? 9. Using your knowledge of base-pairing, which DNA sample in Model 2 will be 100% complementary to organism A? 10. Which other DNA sample in Model 2 is likely to pair with one of the strands from organism A? 11. How many of the total number of base pairs in the sample you chose in Question 10 are noncomplementary between the strands? Phylogenetic Trees 3
4 12. From your answer to Question 11, convert the number of noncomplementary pairs into a percentage of the total base-pairs. This is called the sequence divergence. 13. Calculate the sequence divergence for the remaining two samples. Check your calculations within your group. 14. Use the calculations from the previous questions to fill in the table below. Most Homologous Sample Sequence Divergence 3 0% Least Homologous 15. Based on your previous knowledge of DNA, which sample from Model 2 is from an organism that is most closely related to Organism A? 16. With your group, describe how DNA sequence divergence can give scientists information about relatedness. 17. Fill in the phylogenetic tree below with Samples 1 through 4 to summarize the relatedness of the organisms that supplied the samples. Common Ancestor Sample 3 4 POGIL Activities for AP* Biology
5 Model 3 Comparing the Cytochrome c Gene Amino Acid Position Human * * * * * * * * G D V E K G K K I F I M K C S Q C H T V E K G G K H K T G P N L Tuna * * * * * * * * G D V A K G K K T F V Q K C A Q C H T V E N G G K H K V G P N L Whale * * * * * * * * G D V E K G K K I F V Q K C A Q C H T V E K G G K H K T G P N L R. Monkey * * * * * * * * G D V E K G K K I F I M K C S Q C H T V E K G G K H K T G P N L Chicken * * * * * * * * G D I E K G K K I F V Q K C S Q C H T V E K G G K H K T G P N L Pig * * * * * * * * G D V E K G K K I F V Q K C A Q C H T V E K G G K H K T G P N L Yeast * * * T E F K A G S A K K G A T L F K T R C E L C H T V E K G G P H K V G P N L Fly * * * * G V P A G D V E K G K K I F V Q R C A Q C H T V E A G G K H K V G P N L Amino Acid Position Human H G L F G R K T G Q A P G Y S Y T A A N K N K G I I W G E D T L M E Y L E Tuna W G L F G R K T G Q A E G Y S Y T D A N K S K G I V W N N D T L M E Y L E Whale H G L F G R K T G Q A V G F S Y T D A N K N K G I T W G E E T L M E Y L E R. Monkey H G L F G R K T G Q A P G Y S Y T A A N K N K G I T W G E D T L M E Y L E Chicken H G L F G R K T G Q A E G F S Y T D A N K N K G I T W G E D T L M E Y L E Pig H G L F G R K T G Q A P G F S Y T D A N K N K G I T W G E E T L M E Y L E Yeast H G I F G R H S G Q A Q G Y S Y T D A N I K K N V L W D E N N M S E Y L T Fly H G L F G R K T G Q A A G F A Y T N A N K A K G I T W Q D D T L F E Y L E Amino Acid Position Human N P K K Y I P G T K M I F V G I K K K E E R A D L I A Y L K K A T N E Tuna N P K K Y I P G T K M I F A G I K K K G E R Q D L V A Y L K S A T S * Whale N P K K Y I P G T K M I F A G I K K K G E R A D L I A Y L K K A T N E R. Monkey N P K K Y I P G T K M I F V G I K K K E E R A D L I A Y L K K A T N E Chicken N P K K Y I P G T K M I F A G I K K K S E R V D L I A Y L K D A T S K Pig N P K K Y I P G T K M I F A G I K K K G E R E D L I A Y L K K A T N E Yeast N P K K Y I P G T K M A F G G L K K E K D R N D L I T Y L K K A C E * Fly N P K K Y I P G T K M I F A G L K K P N E R G D L I A Y L K S A T K * *No amino acid at this position 18. Cytochrome c is a protein used in cellular respiration in many species. Refer to Model 3 to answer the following questions about cytochrome c. a. How many different species are represented in the cytochrome c amino acid sequences? b. What do the individual letters represent? c. What do the asterisks represent? Phylogenetic Trees 5
6 19. Circle the pairing of organisms from Model 3 that you predict would have the most divergence in their DNA. Support your choices with a group discussion about morphology (observable characteristics and structure), ecology, and lifestyles of the animals. a. whale and human or whale and tuna b. pig and rhesus monkey or pig and chicken c. tuna and fly or tuna and chicken Read This! Cytochrome c is a protein that is shared by many organisms due to its vital role in cellular respiration. Over time (billions of years) mutations have occurred in the cytochrome c gene that do not affect the function of the cytochrome c protein. These mutations are called neutral mutations. By looking at these mutations scientists can predict when the organisms diverged from a common ancestor and from each other. 20. Refer to Model 3. Write down the number of differences between the amino acid sequence of cytochrome c in a human and each of the following organisms. a. Tuna e. Pig b. Whale f. Yeast c. Rhesus monkey g. Fly d. Chicken 21. Based on the differences in amino acid sequences, to which organism from the list are humans a. Most closely related to? b. Most distantly related to? 6 POGIL Activities for AP* Biology
7 22. Enter the names of the seven organisms in Model 3 into the tree below, to illustrate a phylogenetic relationship between these organisms and humans, as suggested by the cytochrome c data. 23. How do your predictions about relatedness based on morphology, ecology, and lifestyle in Question 19 compare to the relatedness information in the phylogenetic tree developed from DNA data in Question 22? 24. Circle all of the mammals in the phylogenetic tree in Question 22. How does the tree illustrate the fact that those animals are all members of the same class? 25. Compare the differences in amino acid sequences among the mammals with differences in other animal classes. Is there a pattern? 26. Should scientists infer evolutionary relationships based on data from a single protein? Justify your answer in complete sentences. Phylogenetic Trees 7
8 Extension Questions Read This! Scientists have found that neutral mutations like those found in cytochrome c occur at a fairly steady rate throughout evolutionary history. For this reason, neutral mutations are used to measure the time that has passed since two species have diverged through evolution. The rate of mutation must be calibrated with samples where the actual time of species divergence is known from fossil records. In other words, scientists have developed a molecular clock that can be used to estimate the divergence time between organisms. 27. Plot the percentage sequence divergence on the x-axis and the known age of common ancestor on the y-axis for the following species pairs. Species-Pair Percentage Sequence Divergence Known Age of Common Ancestor (millions of years) Human-Chimpanzee Human-Gorilla Chimpanzee-Gorilla Human- Orangutan Known age of common ancestor (millions of years) Sequence Divergence of Hominids % Sequence Divergence 28. Draw the trend line for the points you have plotted. Using the trend line, calculate the slope of the line that describes the relationship between sequence divergence and known age. Give a value as % divergence/million years. This is the calibration value for this molecular clock. 29. At the same gene the sequence divergence between chimpanzees and bonobos is 4.2%. Using the calibrated molecular clock estimate the time at which these species diverged. 30. The sequence divergence between humans and Neanderthals at the same gene is 1.2%. Using the calibrated molecular clock, estimate the time these species diverged. 8 POGIL Activities for AP* Biology
Cladistics and Bioinformatics Questions 2013
AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species
Skulls & Evolution. Procedure In this lab, groups at the same table will work together.
Skulls & Evolution Objectives To illustrate trends in the evolution of humans. To demonstrate what you can learn from bones & fossils. To show the adaptations of various mammals to different habitats and
DO NOT WRITE ON THIS. Evidence from Evolution Activity. The Fossilization Process. Types of Fossils
Evidence from Evolution Activity Part 1 - Fossils Use the diagrams on the next page to answer the following questions IN YOUR NOTEBOOK. 1. Describe how fossils form. 2. Describe the different types of
METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
Piecing It Together. 1) The envelope contains puzzle pieces for 5 vertebrate embryos in 3 different stages of
Piecing It Together 1) The envelope contains puzzle pieces for 5 vertebrate embryos in 3 different stages of development. Lay out the pieces so that you have matched up each animal name card with its 3
CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
Evolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between
Outline. Evolution: Speciation and More Evidence. Key Concepts: Evolution is a FACT. 1. Key concepts 2. Speciation 3. More evidence 4.
Evolution: Speciation and More Evidence Evolution is a FACT 1. Key concepts 2. Speciation 3. More evidence 4. Conclusions Outline Key Concepts: A species consist of one or more populations of individuals
The Environment and Change Over Time
The Environment and Change Over Time Biological Evidence of Evolution What do you think? Read the two statements below and decide whether you agree or disagree with them. Place an A in the Before column
FOSSIL EVIDENCE FOR EVOLUTION
Biology FOSSIL EVIDENCE FOR EVOLUTION You are responsible for knowing all the information contained below. Read the passage before completing the assignment. Scientists have good evidence that the earth
Bio 1B Lecture Outline (please print and bring along) Fall, 2007
Bio 1B Lecture Outline (please print and bring along) Fall, 2007 B.D. Mishler, Dept. of Integrative Biology 2-6810, bmishler@berkeley.edu Evolution lecture #5 -- Molecular genetics and molecular evolution
Evolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies Anatomical features were the dominant
The History of Life on Earth
CHAPTER 9 VOCABULARY & NOTES WORKSHEET The History of Life on Earth By studying the Vocabulary and Notes listed for each section below, you can gain a better understanding of this chapter. SECTION 1 Vocabulary
For Classroom Trial Testing
For Classroom Trial Testing Video Description Secrets of the Sequence, Show 141, Episode 2 From Slime to Sublime approximately 10 minutes viewing time While we are similar to our fellow man in size, shape,
Pogil Phylogenetic Trees Answer Key Ap Biology
POGIL PHYLOGENETIC TREES ANSWER KEY AP BIOLOGY PDF - Are you looking for pogil phylogenetic trees answer key ap biology Books? Now, you will be happy that at this time pogil phylogenetic trees answer key
Station 1: Evidence from Current Examples
Station 1: Evidence from Current Examples Go to the website below: http://www.pbs.org/wgbh/evolution/educators/lessons/lesson6/act1.html Watch the video segment called Why does evolution matter now? After
FOSSIL EVIDENCE FOR EVOLUTION
FOSSIL EVIDENCE FOR EVOLUTION You are responsible for knowing all the information contained below. Read the passage before completing the assignment. Scientists have good evidence that the earth is very
Welcome to Evolution 101 Reading Guide
Name: Welcome to Evolution 101 Reading Guide http://evolution.berkeley.edu/evolibrary/article/evo_01 Read the information on the website. Click on the next arrow at the bottom of each page to move to the
Biology Keystone (PA Core) Quiz Theory of Evolution - (BIO.B ) Theory Of Evolution, (BIO.B ) Scientific Terms
Biology Keystone (PA Core) Quiz Theory of Evolution - (BIO.B.3.2.1 ) Theory Of Evolution, (BIO.B.3.3.1 ) Scientific Terms Student Name: Teacher Name: Jared George Date: Score: 1) Evidence for evolution
Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
Evidence of Common Ancestry Stations
Stations Scientists have long wondered where organisms came from and how they evolved. One of the main sources of evidence for the evolution of organisms comes from the fossil record. Thousands of layers
Organizing Life s Diversity
17 Organizing Life s Diversity section 2 Modern Classification Classification systems have changed over time as information has increased. What You ll Learn species concepts methods to reveal phylogeny
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of
The Theory of Evolution
The Theory of Evolution Matthew Ferry Evolution The process by which different kinds of living organisms are thought to have developed and diversified from earlier forms during the history of the Earth.
31/10/2012. Human Evolution. Cytochrome c DNA tree
Human Evolution Cytochrome c DNA tree 1 Human Evolution! Primate phylogeny! Primates branched off other mammalian lineages ~65 mya (mya = million years ago) Two types of monkeys within lineage 1. New World
Darwin's Theory. Use Target Reading Skills. Darwin's Observations. Changes Over Time Guided Reading and Study
Darwin's Theory This section discusses Charles Darwin and his theories ofevolution, which are based on what he saw during his trip around the world. Use Target Reading Skills In the graphic organizer,
Chapter 16: Reconstructing and Using Phylogenies
Chapter Review 1. Use the phylogenetic tree shown at the right to complete the following. a. Explain how many clades are indicated: Three: (1) chimpanzee/human, (2) chimpanzee/ human/gorilla, and (3)chimpanzee/human/
Evidence of EVOLUTION
Evidence of EVOLUTION Evolution: Genetic change in a population through time Charles Darwin On his journey around the world, Darwin found evidence of GRADUAL CHANGE (evolution) He cited evidences he found
Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26
Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,
EVIDENCE OF EVOLUTION
NAME Block EVIDENCE OF EVOLUTION Background Much evidence has been found to indicate that living things have evolved or changed gradually during their natural history. Scientists have studied fossils,
Biodiversity. The Road to the Six Kingdoms of Life
Biodiversity The Road to the Six Kingdoms of Life How the 6 kingdoms came about At first, only two kingdoms were recognized Then Haeckel proposed a third kingdom Protista (where protists had both plant
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
After you read this section, you should be able to answer these questions:
CHAPTER 10 1 Change Over Time SECTION The Evolution of Living Things 7.3.c, 7.3.d California Science Standards BEFORE YOU READ After you read this section, you should be able to answer these questions:
b. In Table 1 (question #2 on the Answer Sheet describe the function of each set of bones and answer the question.)
Biology EVIDENCE OF EVOLUTION INTRODUCTION: Evidence has been found to indicate that living things have changed gradually during their natural history. The study of fossils as well as embryology, biochemistry,
Evidence of Evolution by Natural Selection. Dodo bird
Evidence of Evolution by Natural Selection Dodo bird 2007-2008 Evidence supporting evolution Fossil record transition species Anatomical record homologous & vestigial structures embryology & development
Lecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
SECTION 17-1 REVIEW BIODIVERSITY. VOCABULARY REVIEW Distinguish between the terms in each of the following pairs of terms.
SECTION 17-1 REVIEW BIODIVERSITY VOCABULARY REVIEW Distinguish between the terms in each of the following pairs of terms. 1. taxonomy, taxon 2. kingdom, species 3. phylum, division 4. species name, species
Primate Diversity & Human Evolution (Outline)
Primate Diversity & Human Evolution (Outline) 1. Source of evidence for evolutionary relatedness of organisms 2. Primates features and function 3. Classification of primates and representative species
Evolution. Darwin s Voyage
Evolution Darwin s Voyage Charles Darwin Explorer on an observation trip to the Galapagos Islands. He set sail on the HMS Beagle in 1858 from England on a 5 year trip. He was a naturalist (a person who
Since Darwin s work, every scientific test has supported Darwin s basic ideas about evolution
Guided Reading Answers Since Darwin s work, every scientific test has supported Darwin s basic ideas about evolution Biogeography Biogeography is the study of where organisms live now, and where they and
Stnd: 8 e C-Notes: Evidence of Evolution
Stnd: 8 e C-Notes: Evidence of Evolution 3/10/2014 Objective: SWBAT analyze different types of evidence of evolution with regard to diversity of different organisms. What evidence supports evolution? 1.
Biodiversity. The Road to the Six Kingdoms of Life
Biodiversity The Road to the Six Kingdoms of Life How the 6 kingdoms came about At first, only two kingdoms were recognized Then Haeckel proposed a third kingdom Protista (where protists had both plant
Evidence of Evolution by Natural Selection. Evidence supporting evolution. Fossil record. Fossil record. Anatomical record.
Evidence of Evolution by Natural Selection Dodo bird Evidence supporting evolution Fossil record transition species Anatomical record homologous & vestigial structures embryology & development Molecular
AP Biology. Evolution is "so overwhelmingly established that it has become irrational to call it a theory." Evidence of Evolution by Natural Selection
Evidence of Evolution by Natural Selection Evolution is "so overwhelmingly established that it has become irrational to call it a theory." -- Ernst Mayr What Evolution Is 2001 Professor Emeritus, Evolutionary
16.4 Evidence of Evolution
16.4 Evidence of Evolution Lesson Objectives Explain how geologic distribution of species relates to their evolutionary history. Explain how fossils and the fossil record document the descent of modern
Evidence of Species Change
Evidence of Species Change Evidence of Evolution What is evolution? Evolution is change over time Scientific theory of evolution explains how living things descended from earlier organisms Evidence of
Mechanisms of Evolution Darwinian Evolution
Mechanisms of Evolution Darwinian Evolution Descent with modification by means of natural selection All life has descended from a common ancestor The mechanism of modification is natural selection Concept
Life at Its Many Levels
Slide 1 THE SCOPE OF BIOLOGY Biology is the scientific study of life Slide 2 Life at Its Many Levels Biologists explore life at levels ranging from the biosphere to the molecules that make up cells Slide
8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
Common Descent with Modification Evolution and Its Core Principles. Common Descent with Modification. Natural Selection
16.1 Evolution and Its Core Principles Common Descent with Modification Descent with modification A key theory of evolution Describes the process by which species of living things can undergo modification
I. HOMOLOGOUS STRUCTURES
Name Bio- Date Evidence of Evolution Analysis Background Much evidence has been found to indicate that living things have evolved or changed gradually during their natural history. The study of fossils
Investigation 3: Comparing DNA Sequences to Understand Evolutionary Relationships with BLAST
Investigation 3: Comparing DNA Sequences to Understand Evolutionary Relationships with BLAST Introduction Bioinformatics is a powerful tool which can be used to determine evolutionary relationships and
NAME DATE PER preap Biology Evidence for Evolution
NAME DATE PER preap Biology Evidence for Evolution Evidence for evolution comes from the following areas the fossil record, homologous structures, embryology, and DNA. You will examine examples from each
Evidence for Evolution
Evidence for Evolution 1. 2. 3. 4. 5. Paleontology Comparative Anatomy Embryology Comparative Biochemistry Geographical Distribution How old is everything? The History of Earth as a Clock Station 1: Paleontology
Name Class Date. 1. What group of mammals do apes, monkeys, lemurs, and humans belong to? a. primates b. cold-blooded c. hominid d.
Skills Worksheet Directed Reading B Section: Humans and Other Primates PRIMATES 1. What group of mammals do apes, monkeys, lemurs, and humans belong to? a. primates b. cold-blooded c. hominid d. primitive
Evidence of Evolution
Lesson 3 Evidence of Evolution ESSENTIAL QUESTION What evidence supports the theory of evolution? By the end of this lesson, you should be able to describe the evidence that supports the theory of evolution
Phylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
16.4 The Evidence of Evolution. Adapted from following Materials; Biology,Miller & Levine (2010) Understanding Evolution (evolution.berkely.
16.4 The Evidence of Evolution Adapted from following Materials; Biology,Miller & Levine (2010) Understanding Evolution (evolution.berkely.edu) Guiding Question: What are the main lines of scientific evidence
Theory a well supported testable explanation of phenomenon occurring in the natural world.
Evolution Theory of Evolution Theory a well supported testable explanation of phenomenon occurring in the natural world. Evolution the process by which modern organisms changed over time from ancient common
Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
Chapter 19: Taxonomy, Systematics, and Phylogeny
Chapter 19: Taxonomy, Systematics, and Phylogeny AP Curriculum Alignment Chapter 19 expands on the topics of phylogenies and cladograms, which are important to Big Idea 1. In order for students to understand
I Can Statement Conversation/Assignment
I Can Statement Conversation/Assignment B- 5.5 Exemplify scientific evidence in the fields of anatomy, embryology, biochemistry, and paleontology that underlies the theory of biological evolution B- 5.6
Evidence of Evolution
Evidence of Evolution Biology Name Date Block Background Much evidence has been found to indicate that living things have evolved or changed gradually during their natural history. The study of fossils
Objectives. Evolution. Darwin 5/30/2012. Pre-Darwin. Genetic change in a population over time.
Objectives Evolution What is evolution? What lead Darwin to his thoughts 4 Premises of Evolution by Natural Selection Evidence supporting Evolution Genetic change in a population over time. Unifying concept
USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES
USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES HOW CAN BIOINFORMATICS BE USED AS A TOOL TO DETERMINE EVOLUTIONARY RELATIONSHPS AND TO BETTER UNDERSTAND PROTEIN HERITAGE?
Evidences of Evolution
Evidences of Evolution Darwin stated that all organisms descend from a common ancestor Darwin based his theory of Natural Selection on observations of: Traits, geographical distribution, selective breeding,
Microbial Diversity and Assessment (II) Spring, 2007 Guangyi Wang, Ph.D. POST103B
Microbial Diversity and Assessment (II) Spring, 007 Guangyi Wang, Ph.D. POST03B guangyi@hawaii.edu http://www.soest.hawaii.edu/marinefungi/ocn403webpage.htm General introduction and overview Taxonomy [Greek
6 HOW DID OUR ANCESTORS EVOLVE?
6 HOW DID OUR ANCESTORS EVOLVE? David Christian introduces the science of taxonomy and explains some of the important methods used to identify and classify different species and several key human ancestors.
GENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.
!! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory
BIOINFORMATICS LAB AP BIOLOGY
BIOINFORMATICS LAB AP BIOLOGY Bioinformatics is the science of collecting and analyzing complex biological data. Bioinformatics combines computer science, statistics and biology to allow scientists to
Modern Evolutionary Classification. Section 18-2 pgs
Modern Evolutionary Classification Section 18-2 pgs 451-455 Modern Evolutionary Classification In a sense, organisms determine who belongs to their species by choosing with whom they will mate. Taxonomic
CLASSIFICATION OF LIVING THINGS. Chapter 18
CLASSIFICATION OF LIVING THINGS Chapter 18 How many species are there? About 1.8 million species have been given scientific names Nearly 2/3 of which are insects 99% of all known animal species are smaller
EVOLUTION: BIOLOGY S UNIFYING THEME
EVOLUTION: BIOLOGY S UNIFYING THEME The history of life is a saga of a constantly changing Earth billions of years old. Fossils document this history. CONCEPT 3-7 2013 Pearson Education, Inc. Figure 1.9
PHYLOGENY AND SYSTEMATICS
AP BIOLOGY EVOLUTION/HEREDITY UNIT Unit 1 Part 11 Chapter 26 Activity #15 NAME DATE PERIOD PHYLOGENY AND SYSTEMATICS PHYLOGENY Evolutionary history of species or group of related species SYSTEMATICS Study
Fact or Theory? Evolution is unity. Evolution is diversity. Which statement do you agree with and why???? Name Date Period
(Any change in the characteristics of a population over many generations.) Fact or Theory? Evolution is unity. Evolution is diversity. Which statement do you agree with and why???? Name Date Period *Fit
Evidence of Evolution. Lesson Overview. Lesson Overview Evidence of Evolution
Lesson Overview Lesson Overview 16.4 THINK ABOUT IT Scientists in some fields, including geology, physics, paleontology, chemistry, and embryology, did not have the technology or understanding to test
Final Revision G8 Biology ( ) Multiple Choice Identify the choice that best completes the statement or answers the question.
Final Revision G8 Biology ( 2017-2018 ) Multiple Choice Identify the choice that best completes the statement or answers the question. 1 A species is a group of similar organisms that A can mate with each
Section 18-1 Finding Order in Diversity
Name Class Date Section 18-1 Finding Order in Diversity (pages 447-450) Key Concepts How are living things organized for study? What is binomial nomenclature? What is Linnaeus s system of classification?
At the present time, scientists generally accept the theory of (1) ( 進化 ), which suggests that life on earth started from a (2) ( 共同祖先 ).
Class: Name: ( ) Date: 29 Evolution I 29.1 The origin of life (Book 4, p. 29-3) Scientists generally believe that the first organisms were formed by joining (1) molecules together. The organic molecules
Name Class Date. Complete each of the following sentences by choosing the correct term from the word bank.
Skills Worksheet Chapter Review USING KEY TERMS Complete each of the following sentences by choosing the correct term from the word bank. Precambrian time Paleozoic era Mesozoic era Cenozoic era 1. During,
Name: Class: Date: ID: A
Class: _ Date: _ Ch 17 Practice test 1. A segment of DNA that stores genetic information is called a(n) a. amino acid. b. gene. c. protein. d. intron. 2. In which of the following processes does change
Name. Ecology & Evolutionary Biology 2245/2245W Exam 2 1 March 2014
Name 1 Ecology & Evolutionary Biology 2245/2245W Exam 2 1 March 2014 1. Use the following matrix of nucleotide sequence data and the corresponding tree to answer questions a. through h. below. (16 points)
Name: Period: Evidence for Evolution Part I. Introduction
Name: Evidence for Evolution Period: Part I. Introduction Two of the most important ideas in evolution are as follows: 1) Every species is a modified (changed) descendant of a species that existed before.
Evidences of Evolution (Clues)
Evidences of Evolution (Clues) Darwin stated that all organisms descended from a common ancestor Darwin based his theory of Natural Selection on observations of: Traits, geographical distribution, selective
Evolutionary Patterns, Rates, and Trends
Evolutionary Patterns, Rates, and Trends Macroevolution Major patterns and trends among lineages Rates of change in geologic time Comparative Morphology Comparing body forms and structures of major lineages
Evolution & Natural Selection
Evolution & Natural Selection Human Origins & Adaptations Charles Darwin Darwin did not discover evolution Darwin explain how natural selection decided which genes would be selected and passed on to the
How should we organize the diversity of animal life?
How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)
Phylogeny and Molecular Evolution. Introduction
Phylogeny and Molecular Evolution Introduction 1 Credit Serafim Batzoglou (UPGMA slides) http://www.stanford.edu/class/cs262/slides Notes by Nir Friedman, Dan Geiger, Shlomo Moran, Ron Shamir, Sagi Snir,
Evidence of Evolution
Evidence of Evolution Biogeography The Age of Earth and Fossils Ancient artiodactyl Modern whale Ancestors of Whales Ambulocetus could both swim in shallow water and walk on land. Rodhocetus probably spent
Phylogeny and Molecular Evolution. Introduction
Phylogeny and Molecular Evolution Introduction 1 2/62 3/62 Credit Serafim Batzoglou (UPGMA slides) http://www.stanford.edu/class/cs262/slides Notes by Nir Friedman, Dan Geiger, Shlomo Moran, Ron Shamir,
Biology 211 (2) Week 1 KEY!
Biology 211 (2) Week 1 KEY Chapter 1 KEY FIGURES: 1.2, 1.3, 1.4, 1.5, 1.6, 1.7 VOCABULARY: Adaptation: a trait that increases the fitness Cells: a developed, system bound with a thin outer layer made of
9/19/2012. Chapter 17 Organizing Life s Diversity. Early Systems of Classification
Section 1: The History of Classification Section 2: Modern Classification Section 3: Domains and Kingdoms Click on a lesson name to select. Early Systems of Classification Biologists use a system of classification
Evidence from Evolution Activity 75 Points. Fossils Use your textbook and the diagrams on the next page to answer the following questions.
Name(s): Biology Evidence from Evolution Activity 75 Points Fossils Use your textbook and the diagrams on the next page to answer the following questions. 1. What are fossils? How are most fossils formed?
Concept Modern Taxonomy reflects evolutionary history.
Concept 15.4 Modern Taxonomy reflects evolutionary history. What is Taxonomy: identification, naming, and classification of species. Common Names: can cause confusion - May refer to several species (ex.
Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab
Date: Agenda Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab Ask questions based on 5.1 and 5.2 Quiz on 5.1 and 5.2 How
UoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)
- Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the
Fig. 6.1 shows how the territory size of great tits affects the risk of nest predation by weasels. nests predated by weasels (%)
1 (a) Great tits, Parus major, are birds that form male-female pairs. The male of each pair then establishes an area of territory, which he defends against other great tits by singing and threat displays.
What is the purpose of the Classifying System? To allow the accurate identification of a particular organism
What is the purpose of the Classifying System? To allow the accurate identification of a particular organism Taxonomy The practice of classifying organisms -Taxonomy was founded nearly 300 years ago by
Homeotic Genes and Body Patterns
Homeotic Genes and Body Patterns Every organism has a unique body pattern. Although specialized body structures, such as arms and legs, may be similar in makeup (both are made of muscle and bone), their
Copyright 2014 Edmentum - All rights reserved.
Copyright 2014 Edmentum - All rights reserved. AP Biology Unity and Diversity Blizzard Bag 2014-20151. The sawfish, also known as the carpenter shark, lives in estuaries off the coast of Australia. A scientist