Lecture 1, 31/10/2001: Introduction to sequence alignment. The Needleman-Wunsch algorithm for global sequence alignment: description and properties
|
|
- Prudence Edwards
- 6 years ago
- Views:
Transcription
1 Lecture 1, 31/10/2001: Introduction to sequence alignment The Needleman-Wunsch algorithm for global sequence alignment: description and properties 1
2 Computational sequence-analysis The major goal of computational sequence analysis is to predict the function and structure of genes and proteins from their sequence. This is made possible since organisms evolve by mutation, duplication and selection of their genes. Thus, sequence similarity often indicates functional and structural similarity. 2
3 5 ATCAGAGTC 3 5 TTCAGTC 3 ATC CTA AG GA etc. 3
4 ATCAGAGTC TTCA--GTC +++^^+++ We wish to identify what regions are most similar to each other in the two sequences. Sequences are shifted one by the other and gaps introduced, to cover all possible alignments. The shifts and gaps provide the steps by which one sequence can be converted into the other. 4
5 dot-plot T T C A G T C A T C A G A G T C T T C A G T C A T TCAGAGTC TCA--GTC 5
6 scoring Substitution matrix - the similarity value between each pair of residues A C G T A C G T Gap penalty - the cost of introducing gaps Gap penalty -2 ATCAGAGTC TTCA--GTC +++^^+++ : = 8 6
7 A C G T A C G T Gap penalty -2 A T C A G A G T C T T C A G T C Initialization Position 3,2 : [ a b ] [ a - ] [T 2 T 1 ] ATC -TT [C 3 T 1 ] ATC- --TT [T 2 T 2 ] ATC TT- [ - b ] 7
8 A C G T A C G T Gap penalty -2 A T C A G A G T C T T C A G T C Initialization Directionality of score calculation [ a b ] [ a - ] [ - b ] 8
9 A C G T A C G T Gap penalty -2 A T C A G A G T C T T C A G T C
10 A C G T A C G T Gap penalty -2 A T C A G A G T C T T C A G T C
11 Needleman-Wunsch algorithm σ[ a ] b : score of aligning a pair of residues a and b σ[ a ] - : score of aligning residue a with a gap (gap penalty: -q) S : score matrix S(i,j) : optimal score of aligning residues positions 1 to i on one sequence with residues positions 1 to j on another sequence 11
12 Needleman-Wunsch algorithm S(0,0) 0 for j 1 to N do S(0,j) S(0,j-1) + σ[ - bj ] for i 1 to M do { S(i,0) S(i-1,0) + σ[ a i - ] for j 1 to N do S(i,j) max (S(i-1, j-1) + σ[ a i b j ], S(i-1, j) + σ[ a i - ], S(i, j-1) + σ[ - bj ]) } Pearson & Miller Meth Enz 210:575, 92 12
13 Optimal score/s is found - more steps needed to find the corresponding alignment/s. This is a time-saving property in database searches and other applications. Only a single pass through the alignment matrix is needed. 13
14 A C G T A C G T Gap penalty -2 A T C A G A G T C T T C A G T C
15 the traceback A C G T A C G T Gap penalty -2 A T C A G A G T C T T C A G T C
16 the traceback A C G T A C G T Gap penalty -2 A T C A G A G T C T T C A G T C ATCAGAGTC TTCAG--TC ^^++ : =8
17 the traceback A C G T A C G T Gap penalty -2 A T C A G A G T C T T C A G T C ATCAGAGTC TTC--AGTC 17 ++^^++++ : =8
18 the traceback A C G T A C G T Gap penalty -2 A T C A G A G T C T T C A G T C ATCAGAGTC : 8 TTCAG--TC ATCAGAGTC : 8 TTC--AGTC ATCAGAGTC : 8 TTCA--GTC 18
19 Algorithm calculates score/s of optimal global sequence alignments, penalizes end gaps and penalizes each residue in a gap is equally. ATCAGAGTC has lower score then CAGAGTC --TTCAGTC TTCAGTC ATCACAGTC has same score as ATCACAGTC T-C--AGTC T---CAGTC ATCACAGTC has lower score then ACACAGTC T---CAGTC T--CAGTC 19
20 In order to score a gap penalty q independent of the gap length, i.e ACACAGTC ATCACAGTC AGCTTTCACAGTC all have the T--CAGTC T---CAGTC T CAGTC same score the algorithm we presented is modified to extend alignments in more then the three ways we considered. 20
21 A T C A G A G T C T T [ - b ] C A G T C [ a - ] [ a b ] [ a - ] [ - b ] 21
22 Needleman-Wunsch algorithm S(0,0) 0 for j 1 to N do S(0,j) -q for i 1 to M do { S(i,0) -q for j 1 to N do S(i,j) max (S(i-1, j-1) + σ[ a i b j ], max {S(0, j)...s(i-1, j)} -q, max {S(i, 0)...S(i, j-1)} -q) } 22 Pearson & Miller Meth Enz 210:575, 92
23 caveats Every algorithm is limited by the model it is built upon. For example, the NW dynamic programming algorithm guarantees us optimal global alignments with the parameters we supply (substitution matrix, gap penalty and gap scoring). However - Different parameters can give different alignments, The correct alignment might not be the optimal one. The correct alignment might correspond only to part of the global alignments, 23
24 More details, sources and things to do for next class Source: Pearson WR & Miller W "Dynamic programming algorithms for biological sequence comparison." Methods in Enzymology, 210: (1992). Assignment: Calculate NW alignments with constant gap penalty seeing the effect of different gap penalties and match/mismatch scores. In all cases use substitution matrices that have two types of scores only a value for an exact match and a lower value for mismatches. Try the nucleotide sequences used in class and the following amino acid sequences: ACDGSMF & AMDFR. 24
Introduction to sequence alignment. Local alignment the Smith-Waterman algorithm
Lecture 2, 12/3/2003: Introduction to sequence alignment The Needleman-Wunsch algorithm for global sequence alignment: description and properties Local alignment the Smith-Waterman algorithm 1 Computational
More informationLecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm. Alignment scoring schemes and theory: substitution matrices and gap models
Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm Alignment scoring schemes and theory: substitution matrices and gap models 1 Local sequence alignments Local sequence alignments are necessary
More informationAdvanced topics in bioinformatics
Feinberg Graduate School of the Weizmann Institute of Science Advanced topics in bioinformatics Shmuel Pietrokovski & Eitan Rubin Spring 2003 Course WWW site: http://bioinformatics.weizmann.ac.il/courses/atib
More informationCollected Works of Charles Dickens
Collected Works of Charles Dickens A Random Dickens Quote If there were no bad people, there would be no good lawyers. Original Sentence It was a dark and stormy night; the night was dark except at sunny
More informationBiochemistry 324 Bioinformatics. Pairwise sequence alignment
Biochemistry 324 Bioinformatics Pairwise sequence alignment How do we compare genes/proteins? When we have sequenced a genome, we try and identify the function of unknown genes by finding a similar gene
More information3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT
3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode
More informationModule: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment
Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Introduction to Bioinformatics online course : IBT Jonathan Kayondo Learning Objectives Understand
More informationSequence analysis and Genomics
Sequence analysis and Genomics October 12 th November 23 rd 2 PM 5 PM Prof. Peter Stadler Dr. Katja Nowick Katja: group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute
More informationPairwise sequence alignment
Department of Evolutionary Biology Example Alignment between very similar human alpha- and beta globins: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL G+ +VK+HGKKV A+++++AH+D++ +++++LS+LH KL GNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKL
More informationFirst generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences
First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences 140.638 where do sequences come from? DNA is not hard to extract (getting DNA from a
More informationSingle alignment: Substitution Matrix. 16 march 2017
Single alignment: Substitution Matrix 16 march 2017 BLOSUM Matrix BLOSUM Matrix [2] (Blocks Amino Acid Substitution Matrices ) It is based on the amino acids substitutions observed in ~2000 conserved block
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of omputer Science San José State University San José, alifornia, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Pairwise Sequence Alignment Homology
More informationPractical Bioinformatics
5/2/2017 Dictionaries d i c t i o n a r y = { A : T, T : A, G : C, C : G } d i c t i o n a r y [ G ] d i c t i o n a r y [ N ] = N d i c t i o n a r y. h a s k e y ( C ) Dictionaries g e n e t i c C o
More informationSara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)
Bioinformática Sequence Alignment Pairwise Sequence Alignment Universidade da Beira Interior (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) 1 16/3/29 & 23/3/29 27/4/29 Outline
More informationExample questions. Z:\summer_10_teaching\bioinfo\Beispiel_frage_bioinformatik.doc [1 / 5]
Example questions for Bioinformatics, first semester half Sommersemester 00 ote The schriftliche Klausur wurde auf deutsch geschrieben The questions will be based on material from the Übungen and the Lectures.
More informationBIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University
BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University Measures of Sequence Similarity Alignment with dot
More informationPairwise Alignment. Guan-Shieng Huang. Dept. of CSIE, NCNU. Pairwise Alignment p.1/55
Pairwise Alignment Guan-Shieng Huang shieng@ncnu.edu.tw Dept. of CSIE, NCNU Pairwise Alignment p.1/55 Approach 1. Problem definition 2. Computational method (algorithms) 3. Complexity and performance Pairwise
More informationLarge-Scale Genomic Surveys
Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction
More informationTHEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
More informationPairwise sequence alignments. Vassilios Ioannidis (From Volker Flegel )
Pairwise sequence alignments Vassilios Ioannidis (From Volker Flegel ) Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs Importance
More informationAlgorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment
Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot
More informationSequence Alignment (chapter 6)
Sequence lignment (chapter 6) he biological problem lobal alignment Local alignment Multiple alignment Introduction to bioinformatics, utumn 6 Background: comparative genomics Basic question in biology:
More informationBioinformatics for Computer Scientists (Part 2 Sequence Alignment) Sepp Hochreiter
Bioinformatics for Computer Scientists (Part 2 Sequence Alignment) Institute of Bioinformatics Johannes Kepler University, Linz, Austria Sequence Alignment 2. Sequence Alignment Sequence Alignment 2.1
More informationPractical considerations of working with sequencing data
Practical considerations of working with sequencing data File Types Fastq ->aligner -> reference(genome) coordinates Coordinate files SAM/BAM most complete, contains all of the info in fastq and more!
More informationPairwise & Multiple sequence alignments
Pairwise & Multiple sequence alignments Urmila Kulkarni-Kale Bioinformatics Centre 411 007 urmila@bioinfo.ernet.in Basis for Sequence comparison Theory of evolution: gene sequences have evolved/derived
More informationLecture 5,6 Local sequence alignment
Lecture 5,6 Local sequence alignment Chapter 6 in Jones and Pevzner Fall 2018 September 4,6, 2018 Evolution as a tool for biological insight Nothing in biology makes sense except in the light of evolution
More informationBio nformatics. Lecture 3. Saad Mneimneh
Bio nformatics Lecture 3 Sequencing As before, DNA is cut into small ( 0.4KB) fragments and a clone library is formed. Biological experiments allow to read a certain number of these short fragments per
More informationMotivating the need for optimal sequence alignments...
1 Motivating the need for optimal sequence alignments... 2 3 Note that this actually combines two objectives of optimal sequence alignments: (i) use the score of the alignment o infer homology; (ii) use
More informationCISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I)
CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) Contents Alignment algorithms Needleman-Wunsch (global alignment) Smith-Waterman (local alignment) Heuristic algorithms FASTA BLAST
More informationSequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University
Sequence Alignment: A General Overview COMP 571 - Fall 2010 Luay Nakhleh, Rice University Life through Evolution All living organisms are related to each other through evolution This means: any pair of
More informationPairwise sequence alignments
Pairwise sequence alignments Volker Flegel VI, October 2003 Page 1 Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs VI, October
More information5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT
5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT.03.239 03.10.2012 ALIGNMENT Alignment is the task of locating equivalent regions of two or more sequences to maximize their similarity. Homology:
More informationIn-Depth Assessment of Local Sequence Alignment
2012 International Conference on Environment Science and Engieering IPCBEE vol.3 2(2012) (2012)IACSIT Press, Singapoore In-Depth Assessment of Local Sequence Alignment Atoosa Ghahremani and Mahmood A.
More informationBioinformatics. Molecular Biophysics & Biochemistry 447b3 / 747b3. Class 3, 1/19/98. Mark Gerstein. Yale University
Molecular Biophysics & Biochemistry 447b3 / 747b3 Bioinformatics Mark Gerstein Class 3, 1/19/98 Yale University 1 Aligning Text Strings Raw Data??? T C A T G C A T T G 2 matches, 0 gaps T C A T G C A T
More informationBioinformatics and BLAST
Bioinformatics and BLAST Overview Recap of last time Similarity discussion Algorithms: Needleman-Wunsch Smith-Waterman BLAST Implementation issues and current research Recap from Last Time Genome consists
More informationCONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018
CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of
More informationSEQUENCE ALIGNMENT BACKGROUND: BIOINFORMATICS. Prokaryotes and Eukaryotes. DNA and RNA
SEQUENCE ALIGNMENT BACKGROUND: BIOINFORMATICS 1 Prokaryotes and Eukaryotes 2 DNA and RNA 3 4 Double helix structure Codons Codons are triplets of bases from the RNA sequence. Each triplet defines an amino-acid.
More informationLecture 2: Pairwise Alignment. CG Ron Shamir
Lecture 2: Pairwise Alignment 1 Main source 2 Why compare sequences? Human hexosaminidase A vs Mouse hexosaminidase A 3 www.mathworks.com/.../jan04/bio_genome.html Sequence Alignment עימוד רצפים The problem:
More informationSequence analysis and comparison
The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species
More informationCopyright 2000 N. AYDIN. All rights reserved. 1
Introduction to Bioinformatics Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Multiple Sequence Alignment Outline Multiple sequence alignment introduction to msa methods of msa progressive global alignment
More informationSequence Alignment Techniques and Their Uses
Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this
More informationC E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 5 G R A T I V. Pair-wise Sequence Alignment
C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Introduction to bioinformatics 2007 Lecture 5 Pair-wise Sequence Alignment Bioinformatics Nothing in Biology makes sense except in
More informationSequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013
Sequence Alignments Dynamic programming approaches, scoring, and significance Lucy Skrabanek ICB, WMC January 31, 213 Sequence alignment Compare two (or more) sequences to: Find regions of conservation
More informationTools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2015 Week-4 BLAST Algorithm Continued Multiple Sequence Alignment Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and
More information20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, Global and local alignment of two sequences using dynamic programming
20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, 2008 4 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance 4. Global and local alignment
More informationInDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9
Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic
More information1.5 Sequence alignment
1.5 Sequence alignment The dramatic increase in the number of sequenced genomes and proteomes has lead to development of various bioinformatic methods and algorithms for extracting information (data mining)
More informationQuantifying sequence similarity
Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity
More informationAn Introduction to Sequence Similarity ( Homology ) Searching
An Introduction to Sequence Similarity ( Homology ) Searching Gary D. Stormo 1 UNIT 3.1 1 Washington University, School of Medicine, St. Louis, Missouri ABSTRACT Homologous sequences usually have the same,
More informationSequence Comparison. mouse human
Sequence Comparison Sequence Comparison mouse human Why Compare Sequences? The first fact of biological sequence analysis In biomolecular sequences (DNA, RNA, or amino acid sequences), high sequence similarity
More informationTools and Algorithms in Bioinformatics
Tools and Algorithms in Bioinformatics GCBA815, Fall 2013 Week3: Blast Algorithm, theory and practice Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and Systems Biology
More informationIntroduction to Computation & Pairwise Alignment
Introduction to Computation & Pairwise Alignment Eunok Paek eunokpaek@hanyang.ac.kr Algorithm what you already know about programming Pan-Fried Fish with Spicy Dipping Sauce This spicy fish dish is quick
More informationPairwise Sequence Alignment
Introduction to Bioinformatics Pairwise Sequence Alignment Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Outline Introduction to sequence alignment pair wise sequence alignment The Dot Matrix Scoring
More informationIntroduction to Bioinformatics
Introduction to Bioinformatics Lecture : p he biological problem p lobal alignment p Local alignment p Multiple alignment 6 Background: comparative genomics p Basic question in biology: what properties
More informationAdministration. ndrew Torda April /04/2008 [ 1 ]
ndrew Torda April 2008 Administration 22/04/2008 [ 1 ] Sprache? zu verhandeln (Englisch, Hochdeutsch, Bayerisch) Selection of topics Proteins / DNA / RNA Two halves to course week 1-7 Prof Torda (larger
More informationMoreover, the circular logic
Moreover, the circular logic How do we know what is the right distance without a good alignment? And how do we construct a good alignment without knowing what substitutions were made previously? ATGCGT--GCAAGT
More informationBackground: comparative genomics. Sequence similarity. Homologs. Similarity vs homology (2) Similarity vs homology. Sequence Alignment (chapter 6)
Sequence lignment (chapter ) he biological problem lobal alignment Local alignment Multiple alignment Background: comparative genomics Basic question in biology: what properties are shared among organisms?
More informationAnalysis and Design of Algorithms Dynamic Programming
Analysis and Design of Algorithms Dynamic Programming Lecture Notes by Dr. Wang, Rui Fall 2008 Department of Computer Science Ocean University of China November 6, 2009 Introduction 2 Introduction..................................................................
More informationAlignment & BLAST. By: Hadi Mozafari KUMS
Alignment & BLAST By: Hadi Mozafari KUMS SIMILARITY - ALIGNMENT Comparison of primary DNA or protein sequences to other primary or secondary sequences Expecting that the function of the similar sequence
More informationLecture Notes: Markov chains
Computational Genomics and Molecular Biology, Fall 5 Lecture Notes: Markov chains Dannie Durand At the beginning of the semester, we introduced two simple scoring functions for pairwise alignments: a similarity
More informationPair Hidden Markov Models
Pair Hidden Markov Models Scribe: Rishi Bedi Lecturer: Serafim Batzoglou January 29, 2015 1 Recap of HMMs alphabet: Σ = {b 1,...b M } set of states: Q = {1,..., K} transition probabilities: A = [a ij ]
More informationStudy and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis
Study and Implementation of Various Techniques Involved in DNA and Protein Sequence Analysis Kumud Joseph Kujur, Sumit Pal Singh, O.P. Vyas, Ruchir Bhatia, Varun Singh* Indian Institute of Information
More informationLecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM)
Bioinformatics II Probability and Statistics Universität Zürich and ETH Zürich Spring Semester 2009 Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Dr Fraser Daly adapted from
More informationTiffany Samaroo MB&B 452a December 8, Take Home Final. Topic 1
Tiffany Samaroo MB&B 452a December 8, 2003 Take Home Final Topic 1 Prior to 1970, protein and DNA sequence alignment was limited to visual comparison. This was a very tedious process; even proteins with
More informationNUMB3RS Activity: DNA Sequence Alignment. Episode: Guns and Roses
Teacher Page 1 NUMB3RS Activity: DNA Sequence Alignment Topic: Biomathematics DNA sequence alignment Grade Level: 10-12 Objective: Use mathematics to compare two strings of DNA Prerequisite: very basic
More informationBioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment
Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value
More informationChapter 5. Proteomics and the analysis of protein sequence Ⅱ
Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and
More informationPairwise alignment, Gunnar Klau, November 9, 2005, 16:
Pairwise alignment, Gunnar Klau, November 9, 2005, 16:36 2012 2.1 Growth rates For biological sequence analysis, we prefer algorithms that have time and space requirements that are linear in the length
More informationEffects of Gap Open and Gap Extension Penalties
Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See
More informationIntroduction to Bioinformatics
Introduction to Bioinformatics Jianlin Cheng, PhD Department of Computer Science Informatics Institute 2011 Topics Introduction Biological Sequence Alignment and Database Search Analysis of gene expression
More informationComputational Biology Lecture 5: Time speedup, General gap penalty function Saad Mneimneh
Computational Biology Lecture 5: ime speedup, General gap penalty function Saad Mneimneh We saw earlier that it is possible to compute optimal global alignments in linear space (it can also be done for
More information8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011
8 Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 18, 2011 2 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance and alignment 4. The number
More informationSequence comparison: Score matrices
Sequence comparison: Score matrices http://facultywashingtonedu/jht/gs559_2013/ Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas FYI - informal inductive proof of best
More informationSubstitution matrices
Introduction to Bioinformatics Substitution matrices Jacques van Helden Jacques.van-Helden@univ-amu.fr Université d Aix-Marseille, France Lab. Technological Advances for Genomics and Clinics (TAGC, INSERM
More informationHomology Modeling. Roberto Lins EPFL - summer semester 2005
Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,
More informationString Matching Problem
String Matching Problem Pattern P Text T Set of Locations L 9/2/23 CAP/CGS 5991: Lecture 2 Computer Science Fundamentals Specify an input-output description of the problem. Design a conceptual algorithm
More informationPhylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches
Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell
More informationSequence Alignment: Scoring Schemes. COMP 571 Luay Nakhleh, Rice University
Sequence Alignment: Scoring Schemes COMP 571 Luay Nakhleh, Rice University Scoring Schemes Recall that an alignment score is aimed at providing a scale to measure the degree of similarity (or difference)
More informationHeuristic Alignment and Searching
3/28/2012 Types of alignments Global Alignment Each letter of each sequence is aligned to a letter or a gap (e.g., Needleman-Wunsch). Local Alignment An optimal pair of subsequences is taken from the two
More informationSequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas
Sequence comparison: Score matrices Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas FYI - informal inductive proof of best alignment path onsider the last step in
More informationWeek 10: Homology Modelling (II) - HHpred
Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Head, Biocomputing Whitehead Institute Bioinformatics Definitions The use of computational
More informationBasic Local Alignment Search Tool
Basic Local Alignment Search Tool Alignments used to uncover homologies between sequences combined with phylogenetic studies o can determine orthologous and paralogous relationships Local Alignment uses
More informationBioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre
Bioinformatics Scoring Matrices David Gilbert Bioinformatics Research Centre www.brc.dcs.gla.ac.uk Department of Computing Science, University of Glasgow Learning Objectives To explain the requirement
More informationSimilarity or Identity? When are molecules similar?
Similarity or Identity? When are molecules similar? Mapping Identity A -> A T -> T G -> G C -> C or Leu -> Leu Pro -> Pro Arg -> Arg Phe -> Phe etc If we map similarity using identity, how similar are
More informationComputational Biology
Computational Biology Lecture 6 31 October 2004 1 Overview Scoring matrices (Thanks to Shannon McWeeney) BLAST algorithm Start sequence alignment 2 1 What is a homologous sequence? A homologous sequence,
More information8 Grundlagen der Bioinformatik, SS 09, D. Huson, April 28, 2009
8 Grundlagen der Bioinformatik, SS 09, D. Huson, April 28, 2009 2 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance and alignment 4. The number
More informationLecture 4: September 19
CSCI1810: Computational Molecular Biology Fall 2017 Lecture 4: September 19 Lecturer: Sorin Istrail Scribe: Cyrus Cousins Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes
More informationSequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas
Sequence comparison: Score matrices Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas Informal inductive proof of best alignment path onsider the last step in the best
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More informationE-SICT: An Efficient Similarity and Identity Matrix Calculating Tool
2014, TextRoad Publication ISSN: 2090-4274 Journal of Applied Environmental and Biological Sciences www.textroad.com E-SICT: An Efficient Similarity and Identity Matrix Calculating Tool Muhammad Tariq
More informationBINF 730. DNA Sequence Alignment Why?
BINF 730 Lecture 2 Seuence Alignment DNA Seuence Alignment Why? Recognition sites might be common restriction enzyme start seuence stop seuence other regulatory seuences Homology evolutionary common progenitor
More informationBLAST. Varieties of BLAST
BLAST Basic Local Alignment Search Tool (1990) Altschul, Gish, Miller, Myers, & Lipman Uses short-cuts or heuristics to improve search speed Like speed-reading, does not examine every nucleotide of database
More informationCSE : Computational Issues in Molecular Biology. Lecture 6. Spring 2004
CSE 397-497: Computational Issues in Molecular Biology Lecture 6 Spring 2004-1 - Topics for today Based on premise that algorithms we've studied are too slow: Faster method for global comparison when sequences
More informationComparative Gene Finding. BMI/CS 776 Spring 2015 Colin Dewey
Comparative Gene Finding BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2015 Colin Dewey cdewey@biostat.wisc.edu Goals for Lecture the key concepts to understand are the following: using related genomes
More informationFinding the Best Biological Pairwise Alignment Through Genetic Algorithm Determinando o Melhor Alinhamento Biológico Através do Algoritmo Genético
Finding the Best Biological Pairwise Alignment Through Genetic Algorithm Determinando o Melhor Alinhamento Biológico Através do Algoritmo Genético Paulo Mologni 1, Ailton Akira Shinoda 2, Carlos Dias Maciel
More informationLecture 5: September Time Complexity Analysis of Local Alignment
CSCI1810: Computational Molecular Biology Fall 2017 Lecture 5: September 21 Lecturer: Sorin Istrail Scribe: Cyrus Cousins Note: LaTeX template courtesy of UC Berkeley EECS dept. Disclaimer: These notes
More informationDNA and protein databases. EMBL/GenBank/DDBJ database of nucleic acids
Database searches 1 DNA and protein databases EMBL/GenBank/DDBJ database of nucleic acids 2 DNA and protein databases EMBL/GenBank/DDBJ database of nucleic acids (cntd) 3 DNA and protein databases SWISS-PROT
More informationPacific Symposium on Biocomputing 4: (1999)
OPTIMIZING SMITH-WATERMAN ALIGNMENTS ROLF OLSEN, TERENCE HWA Department of Physics, University of California at San Diego La Jolla, CA 92093-0319 email: rolf@cezanne.ucsd.edu, hwa@ucsd.edu MICHAEL L ASSIG
More informationMATHEMATICAL MODELS - Vol. III - Mathematical Modeling and the Human Genome - Hilary S. Booth MATHEMATICAL MODELING AND THE HUMAN GENOME
MATHEMATICAL MODELING AND THE HUMAN GENOME Hilary S. Booth Australian National University, Australia Keywords: Human genome, DNA, bioinformatics, sequence analysis, evolution. Contents 1. Introduction:
More information