PAM-1 Matrix 10,000. From: Ala Arg Asn Asp Cys Gln Glu To:

Size: px
Start display at page:

Download "PAM-1 Matrix 10,000. From: Ala Arg Asn Asp Cys Gln Glu To:"

Transcription

1 119-1 atrix 10,000 rom: la rg sn sp ys ln lu o: la rg sn sp ys ln lu

2 120 1 is the expectation after approximately 1% of the sequence has been substituted. 2 is calculated as 1 1 x is calculated as (x-1) is generally used for distant comparisons. t corresponds to 2.5 differences per site ( 20% identity). O: hese measure divergence not time.

3 atrix 100 rom: la rg sn sp ys ln lu o: la rg sn sp ys ln lu

4 122 scoring matrix he scoring values are generally shown as a symmetric log odds ratio matrix. Odds (for those who do not gamble) are 1 p where p is the probability of an event and 1 p is the probability of some other event. or example if p = 0.5 then the odds are 50/50 or 1 to 1 ( = 1). hile if p = 0.75 then the odds are 3 to 1 ( = 3). he odds ratio is the ratio of the odds for and against. p

5 123 scoring matrix enerally the odds are presented as log values. or matrices it is generally log 10 that is used and so each integer value represents an order of magnitude. or example if p = 0.08, odds are 0.08/0.92 = (11 to 1) and log odds are log 10 (0.087) = 1.06 while if p = 0.996, odds are 0.996/0.004 = 249 (order magnitude larger and opposite direction), the log odds are log 10 (249) =

6 124 or a scoring matrix ij = log p i ij p i p j = log ij p j = log observed frequency expected frequency his matrix will be symmetric.

7 alues multiplied by 10.

8 126 log odds of zero implies the two amino acids are found across from each in an alignment as often as expected by chance (given their mutabilities and frequencies of occurrence). log odds greater than zero implies the two amino acids are found across from each in an alignment more often than expected by chance (given their mutabilities and frequencies of occurrence). log odds less than zero implies the two amino acids are found across from each in an alignment less often than expected by chance (given their mutabilities and frequencies of occurrence).

9 127 wo uses for matrices, coring matrix 250 (very distant) 160 (distant) 70 (less distant) 30 (more similar) etc ransition matrix 1

10 128-1 atrix 10,000 rom: la rg sn sp ys ln lu o: la rg sn sp ys ln lu

11 129 - strange (?) patterns ots of interesting properties any exchanges between amino acids and ar more double codon substitutions than expected ewer of some single codon substitutions; e.g. and

12 130 - scoring an amino acid alignment onsider an alignment... eq1 eq otal score is = 16 he chances of getting an alignment this good by chance is given by the odds. ormally one would multiply the odds at each site (assuming independence) but since log s have been taken we can add the log odds. he log 10 odds of 1.6 corresponds to odds of o this is an unusual similarity between these two peptides despite their length (in large part due to rare cysteines across from each other).

13 131 he matrix was computed on globular proteins and may therefore not be a good representation of the substitution matrix for membrane or other non-globular proteins. t assumes that all sites are equally mutable (but not all residues). Only a limited number of proteins were available in comparison to the huge numbers today.

14 132 he J matrix (Jones, aylor, hornton 1992) was an update of the matrix. t is mostly used as a transition matrix rather than as a scoring matrix (for the later purpose 250 still seems the method of choice).

15 133 matrix of BO BOcks Ubstitution atrix Based on the analysis of conserved proteins regions from the BO database. ore reliable than the matrix for distantly related proteins efault for B searches Used in many other programs including

16 134 BOU matrix 1 ind the frequency of occurrence of one amino acid p i = q ii + q ij /2 2 xpected frequencies e ij = p 2 i if i = j 3 core e ij = 2p i p j if i j s ij = 2 log 2 (q ij /e ij )

17 135 he matrix consist of the scores... s ij = 2 log 2 (q ij /e ij ). f the observed number of differences between a pair of amino acids is equal to the expected number then s ij = 0 f the observed is less than expected then s ij < 0 f the observed is greater than expected s ij > 0

18 136 BOU matrix he lower left gives the log odds matrix (BOU62).

19 137 BOU matrix he BOU matrix is less tolerant of substitutions to or from hydrophilic amino acids, but more tolerant of hydrophobic changes, cysteine, and tryptophan mismatches than a similar level matrix.

20 138 BOU matrix his is a BOU62 matrix. t is roughly equivalent to a 160 matrix. he levels come from weighting different entries. n this case all proteins within 62% identity sum to a weight of 1.

21 139 B s recommendations uery length ubstitution matrix ap costs <35-30 ( 9,1) (10,1) BOU-80 (10,1) >85 BOU-62 (11,1) mpirical measures still seem to work best despite many advances.

22 O matrix Uses classical distance measures to produce protein alignments iven the alignments it computes a new distance matrix lign again using the new distance matrix epeat this process many times 140

23 O matrix Uses classical distance measures to produce protein alignments iven the alignments it computes a new distance matrix lign again using the new distance matrix epeat this process many times n addition, they computed empirical measures for gap penalties. hey suggest or a probability of a gap of length k 10 ln() = ln( distance) ln(k) f a distance is not available 10 ln() = ln(k 1) 141

24 142 O matrix he log odds matrix is lower left. t is 10 times the log of the prob these aa are aligned / prob of chance alignment.

25 143 pecialized matrices ome matrices also incorporate additional information - matrix includes information about protein structure and can be used with very distantly related sequences Other matrices are specific for different types of proteins - (coreatrix eading to ntra-embrane) and (redicted ydrophobic and ransmembrane matrix) are designed from/for membrane proteins (not soluble proteins) s of 2006, 94 matrices in enomeet

Scoring Matrices. Shifra Ben-Dor Irit Orr

Scoring Matrices. Shifra Ben-Dor Irit Orr Scoring Matrices Shifra Ben-Dor Irit Orr Scoring matrices Sequence alignment and database searching programs compare sequences to each other as a series of characters. All algorithms (programs) for comparison

More information

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas Sequence comparison: Score matrices Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas Informal inductive proof of best alignment path onsider the last step in the best

More information

Sequence comparison: Score matrices

Sequence comparison: Score matrices Sequence comparison: Score matrices http://facultywashingtonedu/jht/gs559_2013/ Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas FYI - informal inductive proof of best

More information

Quantifying sequence similarity

Quantifying sequence similarity Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity

More information

Scoring Matrices. Shifra Ben Dor Irit Orr

Scoring Matrices. Shifra Ben Dor Irit Orr Scoring Matrices Shifra Ben Dor Irit Orr Scoring matrices Sequence alignment and database searching programs compare sequences to each other as a series of characters. All algorithms (programs) for comparison

More information

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas Sequence comparison: Score matrices Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas FYI - informal inductive proof of best alignment path onsider the last step in

More information

Bioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre

Bioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre Bioinformatics Scoring Matrices David Gilbert Bioinformatics Research Centre www.brc.dcs.gla.ac.uk Department of Computing Science, University of Glasgow Learning Objectives To explain the requirement

More information

Sequence analysis and comparison

Sequence analysis and comparison The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species

More information

Sequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University

Sequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University Sequence Alignment: A General Overview COMP 571 - Fall 2010 Luay Nakhleh, Rice University Life through Evolution All living organisms are related to each other through evolution This means: any pair of

More information

Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm. Alignment scoring schemes and theory: substitution matrices and gap models

Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm. Alignment scoring schemes and theory: substitution matrices and gap models Lecture 2, 5/12/2001: Local alignment the Smith-Waterman algorithm Alignment scoring schemes and theory: substitution matrices and gap models 1 Local sequence alignments Local sequence alignments are necessary

More information

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded

More information

Biochemistry 324 Bioinformatics. Pairwise sequence alignment

Biochemistry 324 Bioinformatics. Pairwise sequence alignment Biochemistry 324 Bioinformatics Pairwise sequence alignment How do we compare genes/proteins? When we have sequenced a genome, we try and identify the function of unknown genes by finding a similar gene

More information

Practical considerations of working with sequencing data

Practical considerations of working with sequencing data Practical considerations of working with sequencing data File Types Fastq ->aligner -> reference(genome) coordinates Coordinate files SAM/BAM most complete, contains all of the info in fastq and more!

More information

Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM)

Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Bioinformatics II Probability and Statistics Universität Zürich and ETH Zürich Spring Semester 2009 Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Dr Fraser Daly adapted from

More information

Multiple Alignment. Slides revised and adapted to Bioinformática IST Ana Teresa Freitas

Multiple Alignment. Slides revised and adapted to Bioinformática IST Ana Teresa Freitas n Introduction to Bioinformatics lgorithms Multiple lignment Slides revised and adapted to Bioinformática IS 2005 na eresa Freitas n Introduction to Bioinformatics lgorithms Outline Dynamic Programming

More information

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot

More information

Background: comparative genomics. Sequence similarity. Homologs. Similarity vs homology (2) Similarity vs homology. Sequence Alignment (chapter 6)

Background: comparative genomics. Sequence similarity. Homologs. Similarity vs homology (2) Similarity vs homology. Sequence Alignment (chapter 6) Sequence lignment (chapter ) he biological problem lobal alignment Local alignment Multiple alignment Background: comparative genomics Basic question in biology: what properties are shared among organisms?

More information

BLAST: Target frequencies and information content Dannie Durand

BLAST: Target frequencies and information content Dannie Durand Computational Genomics and Molecular Biology, Fall 2016 1 BLAST: Target frequencies and information content Dannie Durand BLAST has two components: a fast heuristic for searching for similar sequences

More information

Substitution matrices

Substitution matrices Introduction to Bioinformatics Substitution matrices Jacques van Helden Jacques.van-Helden@univ-amu.fr Université d Aix-Marseille, France Lab. Technological Advances for Genomics and Clinics (TAGC, INSERM

More information

Sequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013

Sequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013 Sequence Alignments Dynamic programming approaches, scoring, and significance Lucy Skrabanek ICB, WMC January 31, 213 Sequence alignment Compare two (or more) sequences to: Find regions of conservation

More information

Tools and Algorithms in Bioinformatics

Tools and Algorithms in Bioinformatics Tools and Algorithms in Bioinformatics GCBA815, Fall 2013 Week3: Blast Algorithm, theory and practice Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and Systems Biology

More information

Sequence Alignment (chapter 6)

Sequence Alignment (chapter 6) Sequence lignment (chapter 6) he biological problem lobal alignment Local alignment Multiple alignment Introduction to bioinformatics, utumn 6 Background: comparative genomics Basic question in biology:

More information

Sequence Database Search Techniques I: Blast and PatternHunter tools

Sequence Database Search Techniques I: Blast and PatternHunter tools Sequence Database Search Techniques I: Blast and PatternHunter tools Zhang Louxin National University of Singapore Outline. Database search 2. BLAST (and filtration technique) 3. PatternHunter (empowered

More information

Stephen Scott.

Stephen Scott. 1 / 21 sscott@cse.unl.edu 2 / 21 Introduction Designed to model (profile) a multiple alignment of a protein family (e.g., Fig. 5.1) Gives a probabilistic model of the proteins in the family Useful for

More information

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and

More information

Sequence Alignment: Scoring Schemes. COMP 571 Luay Nakhleh, Rice University

Sequence Alignment: Scoring Schemes. COMP 571 Luay Nakhleh, Rice University Sequence Alignment: Scoring Schemes COMP 571 Luay Nakhleh, Rice University Scoring Schemes Recall that an alignment score is aimed at providing a scale to measure the degree of similarity (or difference)

More information

Lecture 4: Evolutionary models and substitution matrices (PAM and BLOSUM).

Lecture 4: Evolutionary models and substitution matrices (PAM and BLOSUM). 1 Bioinformatics: In-depth PROBABILITY & STATISTICS Spring Semester 2011 University of Zürich and ETH Zürich Lecture 4: Evolutionary models and substitution matrices (PAM and BLOSUM). Dr. Stefanie Muff

More information

CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018

CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018 CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of

More information

Advanced topics in bioinformatics

Advanced topics in bioinformatics Feinberg Graduate School of the Weizmann Institute of Science Advanced topics in bioinformatics Shmuel Pietrokovski & Eitan Rubin Spring 2003 Course WWW site: http://bioinformatics.weizmann.ac.il/courses/atib

More information

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Structure Comparison CMPS 6630: Introduction to Computational Biology and Bioinformatics Structure Comparison Protein Structure Comparison Motivation Understand sequence and structure variability Understand Domain architecture

More information

Neural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha

Neural Networks for Protein Structure Prediction Brown, JMB CS 466 Saurabh Sinha Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha Outline Goal is to predict secondary structure of a protein from its sequence Artificial Neural Network used for this

More information

CSE 549: Computational Biology. Substitution Matrices

CSE 549: Computational Biology. Substitution Matrices CSE 9: Computational Biology Substitution Matrices How should we score alignments So far, we ve looked at arbitrary schemes for scoring mutations. How can we assign scores in a more meaningful way? Are

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of omputer Science San José State University San José, alifornia, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Pairwise Sequence Alignment Homology

More information

Sequence Analysis 17: lecture 5. Substitution matrices Multiple sequence alignment

Sequence Analysis 17: lecture 5. Substitution matrices Multiple sequence alignment Sequence Analysis 17: lecture 5 Substitution matrices Multiple sequence alignment Substitution matrices Used to score aligned positions, usually of amino acids. Expressed as the log-likelihood ratio of

More information

Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:

Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17: Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:50 5001 5 Multiple Sequence Alignment The first part of this exposition is based on the following sources, which are recommended reading:

More information

Local Alignment Statistics

Local Alignment Statistics Local Alignment Statistics Stephen Altschul National Center for Biotechnology Information National Library of Medicine National Institutes of Health Bethesda, MD Central Issues in Biological Sequence Comparison

More information

An Introduction to Sequence Similarity ( Homology ) Searching

An Introduction to Sequence Similarity ( Homology ) Searching An Introduction to Sequence Similarity ( Homology ) Searching Gary D. Stormo 1 UNIT 3.1 1 Washington University, School of Medicine, St. Louis, Missouri ABSTRACT Homologous sequences usually have the same,

More information

First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences

First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences First generation sequencing and pairwise alignment (High-tech, not high throughput) Analysis of Biological Sequences 140.638 where do sequences come from? DNA is not hard to extract (getting DNA from a

More information

Lecture 26: Polymers: DNA Packing and Protein folding 26.1 Problem Set 4 due today. Reading for Lectures 22 24: PKT Chapter 8 [ ].

Lecture 26: Polymers: DNA Packing and Protein folding 26.1 Problem Set 4 due today. Reading for Lectures 22 24: PKT Chapter 8 [ ]. Lecture 26: Polymers: DA Packing and Protein folding 26.1 Problem Set 4 due today. eading for Lectures 22 24: PKT hapter 8 DA Packing for Eukaryotes: The packing problem for the larger eukaryotic genomes

More information

Sara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)

Sara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) Bioinformática Sequence Alignment Pairwise Sequence Alignment Universidade da Beira Interior (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) 1 16/3/29 & 23/3/29 27/4/29 Outline

More information

Week 10: Homology Modelling (II) - HHpred

Week 10: Homology Modelling (II) - HHpred Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative

More information

Computational Biology

Computational Biology Computational Biology Lecture 6 31 October 2004 1 Overview Scoring matrices (Thanks to Shannon McWeeney) BLAST algorithm Start sequence alignment 2 1 What is a homologous sequence? A homologous sequence,

More information

Pairwise & Multiple sequence alignments

Pairwise & Multiple sequence alignments Pairwise & Multiple sequence alignments Urmila Kulkarni-Kale Bioinformatics Centre 411 007 urmila@bioinfo.ernet.in Basis for Sequence comparison Theory of evolution: gene sequences have evolved/derived

More information

Can protein model accuracy be. identified? NO! CBS, BioCentrum, Morten Nielsen, DTU

Can protein model accuracy be. identified? NO! CBS, BioCentrum, Morten Nielsen, DTU Can protein model accuracy be identified? Morten Nielsen, CBS, BioCentrum, DTU NO! Identification of Protein-model accuracy Why is it important? What is accuracy RMSD, fraction correct, Protein model correctness/quality

More information

Exercise 5. Sequence Profiles & BLAST

Exercise 5. Sequence Profiles & BLAST Exercise 5 Sequence Profiles & BLAST 1 Substitution Matrix (BLOSUM62) Likelihood to substitute one amino acid with another Figure taken from https://en.wikipedia.org/wiki/blosum 2 Substitution Matrix (BLOSUM62)

More information

M.O. Dayhoff, R.M. Schwartz, and B. C, Orcutt

M.O. Dayhoff, R.M. Schwartz, and B. C, Orcutt A Model of volutionary Change in Proteins M.O. Dayhoff, R.M. Schwartz, and B. C, Orcutt n the eight years since we last examined the amino acid exchanges seen in closely related proteins,' the information

More information

Moreover, the circular logic

Moreover, the circular logic Moreover, the circular logic How do we know what is the right distance without a good alignment? And how do we construct a good alignment without knowing what substitutions were made previously? ATGCGT--GCAAGT

More information

Large-Scale Genomic Surveys

Large-Scale Genomic Surveys Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction

More information

Protein Sequence Alignment and Database Scanning

Protein Sequence Alignment and Database Scanning Protein Sequence Alignment and Database Scanning Geoffrey J. Barton Laboratory of Molecular Biophysics University of Oxford Rex Richards Building South Parks Road Oxford OX1 3QU U.K. Tel: 0865-275368 Fax:

More information

Page 1. References. Hidden Markov models and multiple sequence alignment. Markov chains. Probability review. Example. Markovian sequence

Page 1. References. Hidden Markov models and multiple sequence alignment. Markov chains. Probability review. Example. Markovian sequence Page Hidden Markov models and multiple sequence alignment Russ B Altman BMI 4 CS 74 Some slides borrowed from Scott C Schmidler (BMI graduate student) References Bioinformatics Classic: Krogh et al (994)

More information

5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT

5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT 5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT.03.239 03.10.2012 ALIGNMENT Alignment is the task of locating equivalent regions of two or more sequences to maximize their similarity. Homology:

More information

Alignment & BLAST. By: Hadi Mozafari KUMS

Alignment & BLAST. By: Hadi Mozafari KUMS Alignment & BLAST By: Hadi Mozafari KUMS SIMILARITY - ALIGNMENT Comparison of primary DNA or protein sequences to other primary or secondary sequences Expecting that the function of the similar sequence

More information

Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment

Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Module: Sequence Alignment Theory and Applications Session: Introduction to Searching and Sequence Alignment Introduction to Bioinformatics online course : IBT Jonathan Kayondo Learning Objectives Understand

More information

Lecture 1, 31/10/2001: Introduction to sequence alignment. The Needleman-Wunsch algorithm for global sequence alignment: description and properties

Lecture 1, 31/10/2001: Introduction to sequence alignment. The Needleman-Wunsch algorithm for global sequence alignment: description and properties Lecture 1, 31/10/2001: Introduction to sequence alignment The Needleman-Wunsch algorithm for global sequence alignment: description and properties 1 Computational sequence-analysis The major goal of computational

More information

Single alignment: Substitution Matrix. 16 march 2017

Single alignment: Substitution Matrix. 16 march 2017 Single alignment: Substitution Matrix 16 march 2017 BLOSUM Matrix BLOSUM Matrix [2] (Blocks Amino Acid Substitution Matrices ) It is based on the amino acids substitutions observed in ~2000 conserved block

More information

CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I)

CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) Contents Alignment algorithms Needleman-Wunsch (global alignment) Smith-Waterman (local alignment) Heuristic algorithms FASTA BLAST

More information

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding

More information

Similarity searching summary (2)

Similarity searching summary (2) Similarity searching / sequence alignment summary Biol4230 Thurs, February 22, 2016 Bill Pearson wrp@virginia.edu 4-2818 Pinn 6-057 What have we covered? Homology excess similiarity but no excess similarity

More information

Pairwise sequence alignments

Pairwise sequence alignments Pairwise sequence alignments Volker Flegel VI, October 2003 Page 1 Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs VI, October

More information

Protein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki.

Protein Bioinformatics. Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet sandberg.cmb.ki. Protein Bioinformatics Rickard Sandberg Dept. of Cell and Molecular Biology Karolinska Institutet rickard.sandberg@ki.se sandberg.cmb.ki.se Outline Protein features motifs patterns profiles signals 2 Protein

More information

BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University

BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University Measures of Sequence Similarity Alignment with dot

More information

Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment

Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Bioinformatics (GLOBEX, Summer 2015) Pairwise sequence alignment Substitution score matrices, PAM, BLOSUM Needleman-Wunsch algorithm (Global) Smith-Waterman algorithm (Local) BLAST (local, heuristic) E-value

More information

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between

More information

INFORMATION-THEORETIC BOUNDS OF EVOLUTIONARY PROCESSES MODELED AS A PROTEIN COMMUNICATION SYSTEM. Liuling Gong, Nidhal Bouaynaya and Dan Schonfeld

INFORMATION-THEORETIC BOUNDS OF EVOLUTIONARY PROCESSES MODELED AS A PROTEIN COMMUNICATION SYSTEM. Liuling Gong, Nidhal Bouaynaya and Dan Schonfeld INFORMATION-THEORETIC BOUNDS OF EVOLUTIONARY PROCESSES MODELED AS A PROTEIN COMMUNICATION SYSTEM Liuling Gong, Nidhal Bouaynaya and Dan Schonfeld University of Illinois at Chicago, Dept. of Electrical

More information

3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT

3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT 3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode

More information

Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics Jianlin Cheng, PhD Department of Computer Science Informatics Institute 2011 Topics Introduction Biological Sequence Alignment and Database Search Analysis of gene expression

More information

Introduction to sequence alignment. Local alignment the Smith-Waterman algorithm

Introduction to sequence alignment. Local alignment the Smith-Waterman algorithm Lecture 2, 12/3/2003: Introduction to sequence alignment The Needleman-Wunsch algorithm for global sequence alignment: description and properties Local alignment the Smith-Waterman algorithm 1 Computational

More information

Sequence Bioinformatics. Multiple Sequence Alignment Waqas Nasir

Sequence Bioinformatics. Multiple Sequence Alignment Waqas Nasir Sequence Bioinformatics Multiple Sequence Alignment Waqas Nasir 2010-11-12 Multiple Sequence Alignment One amino acid plays coy; a pair of homologous sequences whisper; many aligned sequences shout out

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 05: Index-based alignment algorithms Slides adapted from Dr. Shaojie Zhang (University of Central Florida) Real applications of alignment Database search

More information

Practice Midterm Exam 200 points total 75 minutes Multiple Choice (3 pts each 30 pts total) Mark your answers in the space to the left:

Practice Midterm Exam 200 points total 75 minutes Multiple Choice (3 pts each 30 pts total) Mark your answers in the space to the left: MITES ame Practice Midterm Exam 200 points total 75 minutes Multiple hoice (3 pts each 30 pts total) Mark your answers in the space to the left: 1. Amphipathic molecules have regions that are: a) polar

More information

Ch. 9 Multiple Sequence Alignment (MSA)

Ch. 9 Multiple Sequence Alignment (MSA) Ch. 9 Multiple Sequence Alignment (MSA) - gather seqs. to make MSA - doing MSA with ClustalW - doing MSA with Tcoffee - comparing seqs. that cannot align Introduction - from pairwise alignment to MSA -

More information

Local Alignment: Smith-Waterman algorithm

Local Alignment: Smith-Waterman algorithm Local Alignment: Smith-Waterman algorithm Example: a shared common domain of two protein sequences; extended sections of genomic DNA sequence. Sensitive to detect similarity in highly diverged sequences.

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 07: profile Hidden Markov Model http://bibiserv.techfak.uni-bielefeld.de/sadr2/databasesearch/hmmer/profilehmm.gif Slides adapted from Dr. Shaojie Zhang

More information

Lecture 5,6 Local sequence alignment

Lecture 5,6 Local sequence alignment Lecture 5,6 Local sequence alignment Chapter 6 in Jones and Pevzner Fall 2018 September 4,6, 2018 Evolution as a tool for biological insight Nothing in biology makes sense except in the light of evolution

More information

Pairwise sequence alignments. Vassilios Ioannidis (From Volker Flegel )

Pairwise sequence alignments. Vassilios Ioannidis (From Volker Flegel ) Pairwise sequence alignments Vassilios Ioannidis (From Volker Flegel ) Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs Importance

More information

Basics of protein structure

Basics of protein structure Today: 1. Projects a. Requirements: i. Critical review of one paper ii. At least one computational result b. Noon, Dec. 3 rd written report and oral presentation are due; submit via email to bphys101@fas.harvard.edu

More information

6-3 Solving Systems by Elimination

6-3 Solving Systems by Elimination Another method for solving systems of equations is elimination. Like substitution, the goal of elimination is to get one equation that has only one variable. To do this by elimination, you add the two

More information

InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9

InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9 Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic

More information

In-Depth Assessment of Local Sequence Alignment

In-Depth Assessment of Local Sequence Alignment 2012 International Conference on Environment Science and Engieering IPCBEE vol.3 2(2012) (2012)IACSIT Press, Singapoore In-Depth Assessment of Local Sequence Alignment Atoosa Ghahremani and Mahmood A.

More information

114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009

114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009 114 Grundlagen der Bioinformatik, SS 09, D. Huson, July 6, 2009 9 Protein tertiary structure Sources for this chapter, which are all recommended reading: D.W. Mount. Bioinformatics: Sequences and Genome

More information

Sequence Database Search. 北京大学生物信息学中心高歌 Ge Gao, Ph.D. Center for Bioinformatics, Peking University

Sequence Database Search. 北京大学生物信息学中心高歌 Ge Gao, Ph.D. Center for Bioinformatics, Peking University Sequence Database Search 北京大学生物信息学中心高歌 Ge Gao, Ph.D. Center for Bioinformatics, Peking University Unit 2: BLAST Algorithm: a Primer 北京大学生物信息学中心高歌 Ge Gao, Ph.D. Center for Bioinformatics, Peking University

More information

Substitution Matrices

Substitution Matrices C E N T R F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U E [1] Substitution matrices Sequence analysis 2006 Substitution Matrices Introduction to bioinformatics 2007 Lecture 8 C E N T R F

More information

BINF 730. DNA Sequence Alignment Why?

BINF 730. DNA Sequence Alignment Why? BINF 730 Lecture 2 Seuence Alignment DNA Seuence Alignment Why? Recognition sites might be common restriction enzyme start seuence stop seuence other regulatory seuences Homology evolutionary common progenitor

More information

BLAST: Basic Local Alignment Search Tool

BLAST: Basic Local Alignment Search Tool .. CSC 448 Bioinformatics Algorithms Alexander Dekhtyar.. (Rapid) Local Sequence Alignment BLAST BLAST: Basic Local Alignment Search Tool BLAST is a family of rapid approximate local alignment algorithms[2].

More information

Lecture 2-3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability

Lecture 2-3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability Lecture 2-3: Review of forces (ctd.) and elementary statistical mechanics. Contributions to protein stability Part I. Review of forces Covalent bonds Non-covalent Interactions Van der Waals Interactions

More information

7.36/7.91 recitation CB Lecture #4

7.36/7.91 recitation CB Lecture #4 7.36/7.91 recitation 2-19-2014 CB Lecture #4 1 Announcements / Reminders Homework: - PS#1 due Feb. 20th at noon. - Late policy: ½ credit if received within 24 hrs of due date, otherwise no credit - Answer

More information

Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins

Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins J. Baussand, C. Deremble, A. Carbone Analytical Genomics Laboratoire d Immuno-Biologie Cellulaire

More information

Global alignments - review

Global alignments - review Global alignments - review Take two sequences: X[j] and Y[j] M[i-1, j-1] ± 1 M[i, j] = max M[i, j-1] 2 M[i-1, j] 2 The best alignment for X[1 i] and Y[1 j] is called M[i, j] X[j] Initiation: M[,]= pply

More information

bioinformatics 1 -- lecture 7

bioinformatics 1 -- lecture 7 bioinformatics 1 -- lecture 7 Probability and conditional probability Random sequences and significance (real sequences are not random) Erdos & Renyi: theoretical basis for the significance of an alignment

More information

Linear Algebra Section 2.6 : LU Decomposition Section 2.7 : Permutations and transposes Wednesday, February 13th Math 301 Week #4

Linear Algebra Section 2.6 : LU Decomposition Section 2.7 : Permutations and transposes Wednesday, February 13th Math 301 Week #4 Linear Algebra Section. : LU Decomposition Section. : Permutations and transposes Wednesday, February 1th Math 01 Week # 1 The LU Decomposition We learned last time that we can factor a invertible matrix

More information

Pairwise sequence alignment

Pairwise sequence alignment Department of Evolutionary Biology Example Alignment between very similar human alpha- and beta globins: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL G+ +VK+HGKKV A+++++AH+D++ +++++LS+LH KL GNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKL

More information

Lec.1 Chemistry Of Water

Lec.1 Chemistry Of Water Lec.1 Chemistry Of Water Biochemistry & Medicine Biochemistry can be defined as the science concerned with the chemical basis of life. Biochemistry can be described as the science concerned with the chemical

More information

Sequence Analysis '17 -- lecture 7

Sequence Analysis '17 -- lecture 7 Sequence Analysis '17 -- lecture 7 Significance E-values How significant is that? Please give me a number for......how likely the data would not have been the result of chance,......as opposed to......a

More information

Analysis and Design of Algorithms Dynamic Programming

Analysis and Design of Algorithms Dynamic Programming Analysis and Design of Algorithms Dynamic Programming Lecture Notes by Dr. Wang, Rui Fall 2008 Department of Computer Science Ocean University of China November 6, 2009 Introduction 2 Introduction..................................................................

More information

CSE182-L7. Protein Sequence Analysis Patterns (regular expressions) Profiles HMM Gene Finding CSE182

CSE182-L7. Protein Sequence Analysis Patterns (regular expressions) Profiles HMM Gene Finding CSE182 CSE182-L7 Protein Sequence Analysis Patterns (regular expressions) Profiles HMM Gene Finding 10-07 CSE182 Bell Labs Honors Pattern matching 10-07 CSE182 Just the Facts Consider the set of all substrings

More information

Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics Lecture : p he biological problem p lobal alignment p Local alignment p Multiple alignment 6 Background: comparative genomics p Basic question in biology: what properties

More information

Foreword by. Stephen Altschul. An Essential Guide to the Basic Local Alignment Search Tool BLAST. Ian Korf, Mark Yandell & Joseph Bedell

Foreword by. Stephen Altschul. An Essential Guide to the Basic Local Alignment Search Tool BLAST. Ian Korf, Mark Yandell & Joseph Bedell An Essential Guide to the Basic Local Alignment Search Tool Foreword by Stephen Altschul BLAST Ian Korf, Mark Yandell & Joseph Bedell BLAST Other resources from O Reilly oreilly.com oreilly.com is more

More information

Today s Lecture: HMMs

Today s Lecture: HMMs Today s Lecture: HMMs Definitions Examples Probability calculations WDAG Dynamic programming algorithms: Forward Viterbi Parameter estimation Viterbi training 1 Hidden Markov Models Probability models

More information

Introduction to spectral alignment

Introduction to spectral alignment SI Appendix C. Introduction to spectral alignment Due to the complexity of the anti-symmetric spectral alignment algorithm described in Appendix A, this appendix provides an extended introduction to the

More information

4. Determinants.

4. Determinants. 4. Determinants 4.1. Determinants; Cofactor Expansion Determinants of 2 2 and 3 3 Matrices 2 2 determinant 4.1. Determinants; Cofactor Expansion Determinants of 2 2 and 3 3 Matrices 3 3 determinant 4.1.

More information