Phylogeny and Molecular Evolution. Introduction
|
|
- Lee Simon
- 5 years ago
- Views:
Transcription
1 Phylogeny and Molecular Evolution Introduction 1
2 Credit Serafim Batzoglou (UPGMA slides) Notes by Nir Friedman, Dan Geiger, Shlomo Moran, Ron Shamir, Sagi Snir, Michal Ziv-Ukelson Durbin et al. Jones and Pevzner s lecture notes Bioinformatics Algorithms book by Phillip Compeau and Pavel Pvzner. 2/62
3 3/62
4 4/62
5 Characterizing Evolution Anatomical and behavioral features were the dominant criteria used to derive evolutionary relationships between species since Darwin Equipped with analysis based on these relatively subjective observations, the evolutionary relationships derived from them were often inconclusive and/or later proved incorrect 5/62
6 How did the panda evolve? For roughly 100 years scientists were unable to figure out which family the giant panda belongs to In 1870 Père Armand David, returned to Paris from China with the bones of the mysterious creature which he called simply black and white bear. Biologists examined the bones and concluded that they more closely resembled the bones of a red panda (raccoons) than those of bears. In 1985, Steve O Brien et al. solved the giant panda classification problem using DNA sequences (the giant panda is a bear) Giant panda Red panda 6/62
7 Evolutionary Tree of Bears and Raccoons (O Brien 1985) O Brien s study used about 500,000 nucleotides to construct the evolutionary tree of bears and raccoons. Note that bears and raccoons diverged just 35 million years ago and they share many morphological features. 7/62
8 Human closer to Dog or Mouse? 8/62
9 Human closer to Dog or Mouse? 9/62
10 Human closer to Dog or Mouse? Which Monkey is Human Closest to? 10/62
11 Evolutionary Trees: DNA-based Approach 40 years ago: Emile Zuckerkandl and Linus Pauling brought reconstructing evolutionary relationships with DNA into the spotlight In the first few years after Zuckerkandl and Pauling proposed using DNA for evolutionary studies, the possibility of reconstructing evolutionary trees by DNA analysis was hotly debated Now it is a dominant approach to study evolution.
12 Emile Zuckerkandl on human-gorilla evolutionary relationships: From the point of hemoglobin structure, it appears that gorilla is just an abnormal human, or man an abnormal gorilla, and the two species form actually one continuous population. Emile Zuckerkandl, Classification and Human Evolution, 1963
13 Gaylord Simpson vs. Emile Zuckerkandl: From the point of hemoglobin structure, it appears that gorilla is just an abnormal human, or man an abnormal gorilla, and the two species form actually one continuous population. Emile Zuckerkandl, Classification and Human Evolution, 1963 From any point of view other than that properly specified, that is of course nonsense. What the comparison really indicate is that hemoglobin is a bad choice and has nothing to tell us about attributes, or indeed tells us a lie. Gaylord Simpson, Science, 1964
14 Who are closer?
15 Different Trees Obtained Based on Different Genes Betta Globin Dopamine D4 receptor 15/62
16 Evolutionary Tree of Humans Around the time the giant panda riddle was solved, a DNA-based model of the human evolutionary tree lead to the Out of Africa Hypothesis: Claims our most ancient ancestor lived in Africa roughly 200,000 years ago 19/62
17 Human Evolutionary Tree (cont d) Based on 53 individuals mitochondrial DNA (16,587bp ) 20/62
18 The Origin of Humans: Out of Africa vs Multiregional Hypothesis Out of Africa: Humans evolved in Africa ~150,000 years ago Humans migrated out of Africa, replacing other humanoids around the globe There is no direct descendence from Neanderthals Multiregional: Humans evolved in the last two million years as a single species. Independent appearance of modern traits in different areas Humans migrated out of Africa mixing with other humanoids on the way There is a genetic continuity from Neanderthals to humans
19 Human Migration Out of Africa
20 Evolutionary Tree of Humans (mtdna) The evolutionary tree separates one group of Africans from a group containing all five populations. Vigilant, Stoneking, Harpending, Hawkes, and Wilson (1991)
21 mtdna analysis supports Out of Africa Hypothesis African origin of humans inferred from: African population was the most diverse (sub-populations had more time to diverge) The evolutionary tree separated one group of Africans from a group containing all five populations. Tree was rooted on branch between groups of greatest difference.
22 Evolutionary Tree of Humans (mtdna) The evolutionary tree separates one group of Africans from a group containing all five populations. Vigilant, Stoneking, Harpending, Hawkes, and Wilson (1991)
23 Two Neanderthal Discoveries Feldhofer, Germany Mezmaiskaya, Caucasus Distance: 25,000km
24 Two Neanderthal Discoveries Is there a connection between Neanderthals and today s Europeans? If humans did not evolve from Neanderthals, whom did we evolve from?
25 Multiregional Hypothesis? May predict some genetic continuity from the Neanderthals through to the Cro- Magnons up to today s Europeans Can explain the occurrence of varying regional characteristics
26 Sequencing Neanderthal s mtdna mtdna from the bone of Neanderthal is used because it is up to 1,000x more abundant than nuclear DNA DNA decay over time and only a small amount of ancient DNA can be recovered (upper limit: 100,000 years) PCR of mtdna (fragments are too short, human DNA may mixed in)
27 Neanderthals vs Humans: surprisingly large divergence AMH vs Neanderthal: 22 substitutions and 6 indels in 357 bp region AMH vs AMH only 8 substitutions AMH = Anatomically Modern Human
28 31/62
29 New Fossil (Manot Cave) Supports OOA This means several things. 1. First, unless and until other fossil evidence is found, AMHs once they left Africa came though the Sinai and Levant region stopping in what is now modern day Israel before migrating outwards into Europe and the rest of Asia. 2. Secondly, this discovery conclusively shows that AMHs were indeed living near and perhaps even next to Neanderthals as early as 60,000 years ago. 3. Thirdly, the Out of Africa (OOA) hypothesis becomes the best evidenced hypothesis regarding how early humans migrated and conquered the planet. 32/62
30 Phylogenetic Trees applied as Crime Evidence 33/62
31 Phylogenetic Analysis of HIV Virus Lafayette, Louisiana, 1994 A woman claimed her ex-lover (who was a physician) injected her with HIV+ blood Records show the physician had drawn blood from an HIV+ patient that day But how to prove the blood from that HIV+ patient ended up in the woman?i HIV is the virus causing AIDS!!!
32 HIV Transmission HIV has a high mutation rate, which can be used to trace paths of transmission Two people who got the virus from two different people will have very different HIV sequences Three different tree reconstruction methods (including parsimony) were used to track changes in two genes in HIV (gp120 and RT) HIV is the virus causing AIDS!!!
33 HIV Transmission Took multiple samples from the patient, the woman, and controls (non-related HIV+ people) In every reconstruction, the woman s sequences were found to be evolved from the patient s sequences, indicating a close relationship between the two Nesting of the victim s sequences within the patient sequence indicated the direction of transmission was from patient to victim This was the first time phylogenetic analysis was used in a court case as evidence (Metzker, et. al., 2002) HIV is the virus causing AIDS!!!
34 Evolutionary Tree Leads to Conviction
35 Study evolution? If two sequences from different organisms are similar, they may have a common ancestor (Homologues). So sequence alignment (both pairwise and multiple ) can help construct the phylogenetic tree. -GCGC-ATGGATTGAGCGA TGCGCCATTGAT-GACC-A Edit Distance = 4
36 Phylogenetic Tree Reconstruction Input: four nucleotide sequences: AAG, AAA, GGA, AGA taken from four species. Question: Which evolutionary tree best explains these sequences? One Answer (the parsimony principle): Pick a tree that has a minimum total number of substitutions of symbols between species and their originator in the evolutionary tree (also called phylogenetic tree). Total #substitutions = 4 AAG AAA GGA AAA AAA AAA AGA 39
37 Example Continued There are many trees possible. For example: AAA AAA AAA AGA AAA AAA AAG AAA GGA AGA AAG AGA AAA GGA 40
38 Example Continued There are many trees possible. For example: 1 AAG AAA AAA AAA 1 1 GGA AGA AGA Total #substitutions = 3 Total #substitutions = 4 The left tree is better than the right tree. 41 AAG AAA AGA AAA AAA AAA GGA Questions: Is this principle yielding realistic phylogenetic trees? (Evolution) How can we compute the best tree efficiently? (Computer Science) What is the probability of substitutions given the data? (Learning) Is the best tree found significantly better than others? (Statistics)
39 Tree Reconstruction How are these trees built from sequences? First, a little background 42/62
40 Rooted and Unrooted Trees 43/62
41 Rooted Trees Infer an evolutionary ancestor leaves represent existing species internal vertices represent hypothetical ancestors can be viewed as directed trees from the root to the leaves 44/62
42 Tree of life
43 46/62
44 47
45 Unrooted Trees DO NOT infer an evolutionary ancestor, therefore cannot be viewed as a directed graph Otherwise, they are like rooted trees 48/62
46 49/62
47 Binary trees Biologists often work with binary weighted trees: every internal vertex has degree 3 if the tree is rooted then the root has degree 2 every edge has a positive weight (or length) 50/62
48 End Lecture 51/62
Phylogeny and Molecular Evolution. Introduction
Phylogeny and Molecular Evolution Introduction 1 2/62 3/62 Credit Serafim Batzoglou (UPGMA slides) http://www.stanford.edu/class/cs262/slides Notes by Nir Friedman, Dan Geiger, Shlomo Moran, Ron Shamir,
More informationEvolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between
More informationEvolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies Anatomical features were the dominant
More informationLecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
More informationCSCI1950 Z Computa3onal Methods for Biology* (*Working Title) Lecture 1. Ben Raphael January 21, Course Par3culars
CSCI1950 Z Computa3onal Methods for Biology* (*Working Title) Lecture 1 Ben Raphael January 21, 2009 Course Par3culars Three major topics 1. Phylogeny: ~50% lectures 2. Func3onal Genomics: ~25% lectures
More informationPhylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
More information31/10/2012. Human Evolution. Cytochrome c DNA tree
Human Evolution Cytochrome c DNA tree 1 Human Evolution! Primate phylogeny! Primates branched off other mammalian lineages ~65 mya (mya = million years ago) Two types of monkeys within lineage 1. New World
More informationMolecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,
More informationCasey Leonard. Multiregional model vs. Out of Africa theory SLCC
Casey Leonard Multiregional model vs. Out of Africa theory SLCC 2 It is debated where humans came from and how they spread across the world. Since people don't all look the same, or are categorized into
More informationCREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
More informationPhylogenetic Trees. How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species?
Why? Phylogenetic Trees How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species? The saying Don t judge a book by its cover. could be applied
More information"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
More informationEvolution Problem Drill 10: Human Evolution
Evolution Problem Drill 10: Human Evolution Question No. 1 of 10 Question 1. Which of the following statements is true regarding the human phylogenetic relationship with the African great apes? Question
More informationExamples of Phylogenetic Reconstruction
Examples of Phylogenetic Reconstruction 1. HIV transmission Recently, an HIV-positive Florida dentist was suspected of having transmitted the HIV virus to his dental patients. Although a number of his
More informationOut of Africa: The origin of Homo Sapiens (Us!)
Out of Africa: The origin of Homo Sapiens (Us!) Our History from the DNA Record and other methods Robin Clegg Genetics, DNA A Detective Story Involving. Fossils, skulls and skeletons - new extraction of
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
More informationSCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of
More informationPOPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
More informationPhylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
More informationDarwin's Theory. Use Target Reading Skills. Darwin's Observations. Changes Over Time Guided Reading and Study
Darwin's Theory This section discusses Charles Darwin and his theories ofevolution, which are based on what he saw during his trip around the world. Use Target Reading Skills In the graphic organizer,
More informationReading for Lecture 13 Release v10
Reading for Lecture 13 Release v10 Christopher Lee November 15, 2011 Contents 1 Evolutionary Trees i 1.1 Evolution as a Markov Process...................................... ii 1.2 Rooted vs. Unrooted Trees........................................
More informationEvidences of Evolution (Clues)
Evidences of Evolution (Clues) Darwin stated that all organisms descended from a common ancestor Darwin based his theory of Natural Selection on observations of: Traits, geographical distribution, selective
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationChapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
More informationOrganizing Life s Diversity
17 Organizing Life s Diversity section 2 Modern Classification Classification systems have changed over time as information has increased. What You ll Learn species concepts methods to reveal phylogeny
More informationPrimate Diversity & Human Evolution (Outline)
Primate Diversity & Human Evolution (Outline) 1. Source of evidence for evolutionary relatedness of organisms 2. Primates features and function 3. Classification of primates and representative species
More informationHomo habilis males feeding in East Africa. Two robust australopithecines are approaching. ( Myr ago) The Homo radiation
The Homo radiation Homo habilis males feeding in East Africa. Two robust australopithecines are approaching. (1.5-2.0 Myr ago) Average 640cm 3 brain compared to 500cm 3 in the Australopithecines 1965-Louis
More informationMolecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
More informationReconstructing Evolutionary Trees. Chapter 14
Reconstructing Evolutionary Trees Chapter 14 Phylogenetic trees The evolutionary history of a group of species = phylogeny The problem: Evolutionary histories can never truly be known. Once again, we are
More informationEvolution. Darwin s Voyage
Evolution Darwin s Voyage Charles Darwin Explorer on an observation trip to the Galapagos Islands. He set sail on the HMS Beagle in 1858 from England on a 5 year trip. He was a naturalist (a person who
More informationMolecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
More informationBIOL 1010 Introduction to Biology: The Evolution and Diversity of Life. Spring 2011 Sections A & B
BIOL 1010 Introduction to Biology: The Evolution and Diversity of Life. Spring 2011 Sections A & B Steve Thompson: stthompson@valdosta.edu http://www.bioinfo4u.net 1 ʻTree of Life,ʼ ʻprimitive,ʼ ʻprogressʼ
More informationUoN, CAS, DBSC BIOL102 lecture notes by: Dr. Mustafa A. Mansi. The Phylogenetic Systematics (Phylogeny and Systematics)
- Phylogeny? - Systematics? The Phylogenetic Systematics (Phylogeny and Systematics) - Phylogenetic systematics? Connection between phylogeny and classification. - Phylogenetic systematics informs the
More informationPhylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
More informationBINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
More informationWarm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab
Date: Agenda Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab Ask questions based on 5.1 and 5.2 Quiz on 5.1 and 5.2 How
More informationPopulation Genetics of Modern Human Evolution
Population Genetics of Modern Human Evolution John H Relethford, State University of New York College at Oneonta, Oneonta, New York, USA Rosalind M Harding, University of Oxford, Oxford, UK The aim of
More information8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
More informationCHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny
CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny To trace phylogeny or the evolutionary history of life, biologists use evidence from paleontology, molecular data, comparative
More informationTheory. Pattern and Process
Theory Pattern and Process Definition of Science: Science is based on evidence and always changing. Scientists test explanations and predictions of natural phenomena. Some questions are outside the realm
More informationBio 1B Lecture Outline (please print and bring along) Fall, 2007
Bio 1B Lecture Outline (please print and bring along) Fall, 2007 B.D. Mishler, Dept. of Integrative Biology 2-6810, bmishler@berkeley.edu Evolution lecture #5 -- Molecular genetics and molecular evolution
More informationClassification and Phylogeny
Classification and Phylogeny The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme
More informationDiversity and Human Evolution. Homo neanderthalensis. Homo neanderthalensis. Homo neanderthalensis. Homo neanderthalensis. Part II
Diversity and Human Evolution Part II Neanderthal 1 La Chapelle-aux-Saints Photograph byrheinisches LandesmuseumBonn Photographs by John Reader Mount Circeo Photograph by Ministry of Culture, Italy An
More informationMETHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
More information6 HOW DID OUR ANCESTORS EVOLVE?
6 HOW DID OUR ANCESTORS EVOLVE? David Christian introduces the science of taxonomy and explains some of the important methods used to identify and classify different species and several key human ancestors.
More informationModern Evolutionary Classification. Section 18-2 pgs
Modern Evolutionary Classification Section 18-2 pgs 451-455 Modern Evolutionary Classification In a sense, organisms determine who belongs to their species by choosing with whom they will mate. Taxonomic
More informationClassification and Phylogeny
Classification and Phylogeny The diversity it of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme
More informationNGSS UNIT OVERVIEW EVOLUTION
UNIT SPECIFIC RESOURCES TEACHER RESOURCES IV NGSS UNIT OVERVIEW EVOLUTION Performance Expectation MS-LS4-1: Analyze interpret data for patterns in the fossil record that document the existence, diversity,
More informationEvidences of Evolution
Evidences of Evolution Darwin stated that all organisms descend from a common ancestor Darwin based his theory of Natural Selection on observations of: Traits, geographical distribution, selective breeding,
More informationBackground Reading: The Earliest Humans
Background Reading: The Earliest Humans What type of information do you need to look for in the reading to learn about who discovered these early humans? List some ideas of what to look for here: 1. 2.
More informationOrigin and Evolution of Life
Origin and Evolution of Life OCN 201 Science of the Sea Biology Lecture 2 The Handfish -BBC Blue Planet!1!1 Evolution Nothing in biology makes sense except in the light of evolution I am a creationist
More informationHUMAN EVOLUTION. Where did we come from?
HUMAN EVOLUTION Where did we come from? www.christs.cam.ac.uk/darwin200 Darwin & Human evolution Darwin was very aware of the implications his theory had for humans. He saw monkeys during the Beagle voyage
More informationTopics. Antibiotic resistance, changing environment LITERACY MATHEMATICS. Traits, variation, population MATHEMATICS
UNIT OVERVIEW EVOLUTION Listed below is a summary of the activities in this unit. Note that the total teaching time is listed as 9 34 periods of approximately 45 50 minutes (approximately 6-7 weeks). 1.
More informationHow should we organize the diversity of animal life?
How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)
More informationChapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Biologists estimate that there are about 5 to 100 million species of organisms living on Earth today. Evidence from morphological, biochemical, and gene sequence
More informationHUMAN EVOLUTION 17 APRIL 2013
HUMAN EVOLUTION 17 APRIL 2013 Lesson Description In this lesson, we: Consider the following aspects of Human Evolution: - Interpretation of a phylogenetic tree to show the place of the family Hominidae
More informationIn 1831 people thought:
In 1831 people thought: A) Earth and life were a few thousand years old B) The planet and species on it had not changed since the beginning of time C) Geologic features showed up due to catastrophic changes
More informationOrganizing Life on Earth
Organizing Life on Earth Inquire: Organizing Life on Earth Overview Scientists continually obtain new information that helps to understand the evolutionary history of life on Earth. Each group of organisms
More informationEvidence of Species Change
Evidence of Species Change Evidence of Evolution What is evolution? Evolution is change over time Scientific theory of evolution explains how living things descended from earlier organisms Evidence of
More informationChapter 19 Organizing Information About Species: Taxonomy and Cladistics
Chapter 19 Organizing Information About Species: Taxonomy and Cladistics An unexpected family tree. What are the evolutionary relationships among a human, a mushroom, and a tulip? Molecular systematics
More informationPhylogeny: traditional and Bayesian approaches
Phylogeny: traditional and Bayesian approaches 5-Feb-2014 DEKM book Notes from Dr. B. John Holder and Lewis, Nature Reviews Genetics 4, 275-284, 2003 1 Phylogeny A graph depicting the ancestor-descendent
More informationChapter 26. Phylogeny and the Tree of Life. Lecture Presentations by Nicole Tunbridge and Kathleen Fitzpatrick Pearson Education, Inc.
Chapter 26 Phylogeny and the Tree of Life Lecture Presentations by Nicole Tunbridge and Kathleen Fitzpatrick Investigating the Tree of Life Phylogeny is the evolutionary history of a species or group of
More informationSkulls & Evolution. Procedure In this lab, groups at the same table will work together.
Skulls & Evolution Objectives To illustrate trends in the evolution of humans. To demonstrate what you can learn from bones & fossils. To show the adaptations of various mammals to different habitats and
More informationGENETICS - CLUTCH CH.22 EVOLUTIONARY GENETICS.
!! www.clutchprep.com CONCEPT: OVERVIEW OF EVOLUTION Evolution is a process through which variation in individuals makes it more likely for them to survive and reproduce There are principles to the theory
More informationCommon Descent with Modification Evolution and Its Core Principles. Common Descent with Modification. Natural Selection
16.1 Evolution and Its Core Principles Common Descent with Modification Descent with modification A key theory of evolution Describes the process by which species of living things can undergo modification
More informationWhich concept would be correctly placed in box X? A) use and disuse B) variation C) changes in nucleic acids D) transmission of acquired traits
1. Base your answer to the following question on Some of the concepts included in Darwin's theory of natural selection are represented in the diagram below. Which concept would be correctly placed in box
More informationCHAPTERS 24-25: Evidence for Evolution and Phylogeny
CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology
More informationHuman Evolution
http://www.pwasoh.com.co Human Evolution Cantius, ca 55 mya The continent-hopping habits of early primates have long puzzled scientists, and several scenarios have been proposed to explain how the first
More informationUnit 4 Evolution (Ch. 14, 15, 16)
Ch. 16 - Evolution Unit 4 Evolution (Ch. 14, 15, 16) 1. Define Evolution 2. List the major events that led to Charles Darwin s development of his theory of Evolution by means of Natural Selection 3. Summarize
More informationB. Phylogeny and Systematics:
Tracing Phylogeny A. Fossils: Some fossils form as is weathered and eroded from the land and carried by rivers to seas and where the particles settle to the bottom. Deposits pile up and the older sediments
More informationIntroduction to characters and parsimony analysis
Introduction to characters and parsimony analysis Genetic Relationships Genetic relationships exist between individuals within populations These include ancestordescendent relationships and more indirect
More informationHuman Evolution. Darwinius masillae. Ida Primate fossil from. in Germany Ca.47 M years old. Cantius, ca 55 mya
http://www.pwasoh.com Human Evolution Cantius, ca 55 mya The continent-hopping habits of early primates have long puzzled scientists, and several scenarios have been proposed to explain how the first true
More informationPage 1. Evolutionary Trees. Why build evolutionary tree? Outline
Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny
More informationC3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
More informationEvolutionary Tree Analysis. Overview
CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based
More informationPHYLOGENY & THE TREE OF LIFE
PHYLOGENY & THE TREE OF LIFE PREFACE In this powerpoint we learn how biologists distinguish and categorize the millions of species on earth. Early we looked at the process of evolution here we look at
More informationList of Code Challenges. About the Textbook Meet the Authors... xix Meet the Development Team... xx Acknowledgments... xxi
Contents List of Code Challenges xvii About the Textbook xix Meet the Authors................................... xix Meet the Development Team............................ xx Acknowledgments..................................
More informationBackground: Imagine it is time for your lunch break, you take your sandwich outside and you sit down to enjoy your lunch with a beautiful view of
Background: Imagine it is time for your lunch break, you take your sandwich outside and you sit down to enjoy your lunch with a beautiful view of Montana s Rocky Mountains. As you look up, you see what
More informationEVOLUTION: BIOLOGY S UNIFYING THEME
EVOLUTION: BIOLOGY S UNIFYING THEME The history of life is a saga of a constantly changing Earth billions of years old. Fossils document this history. CONCEPT 3-7 2013 Pearson Education, Inc. Figure 1.9
More informationWho Were Neanderthals and Did They Interbreed with Modern Humans?
Anthropology 1020 Sharon Vidriales-Estrada Who Were Neanderthals and Did They Interbreed with Modern Humans? References 1. Wikipedia (Internet) www.wikipedia.org Neanderthals search 2. Scientific American
More informationGENETICS OF MODERN HUMAN ORIGINS AND DIVERSITY
Annu. Rev. Anthropol. 1998. 27:1 23 Copyright 1998 by Annual Reviews. All rights reserved GENETICS OF MODERN HUMAN ORIGINS AND DIVERSITY John H. Relethford Department of Anthropology, State University
More informationPhylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26
Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,
More informationTheory of Evolution. Data Driven Process Supported by Evidence
Theory of Evolution Data Driven Process Supported by Evidence TEKS (7) The student knows evolutionary theory is a scientific explanation for the unity and diversity of life. The student is expected to:
More informationCladistics and Bioinformatics Questions 2013
AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species
More informationEvolution & Natural Selection
Evolution & Natural Selection Human Origins & Adaptations Charles Darwin Darwin did not discover evolution Darwin explain how natural selection decided which genes would be selected and passed on to the
More informationUSING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES
USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES HOW CAN BIOINFORMATICS BE USED AS A TOOL TO DETERMINE EVOLUTIONARY RELATIONSHPS AND TO BETTER UNDERSTAND PROTEIN HERITAGE?
More information--Therefore, congruence among all postulated homologies provides a test of any single character in question [the central epistemological advance].
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2008 University of California, Berkeley B.D. Mishler Jan. 29, 2008. The Hennig Principle: Homology, Synapomorphy, Rooting issues The fundamental
More informationTheory of Evolution. Chapter 15
Theory of Evolution Chapter 15 The History of Evolutionary Thought Evolution The development of new types of organisms from preexisting types of organisms over time. Also could be described as a heritable
More informationLINEAGE ACTIVITIES Draft Descriptions December 10, Whale Evolution
LINEAGE ACTIVITIES Draft Descriptions December 10, 2018 Institutions participating in the Lineage program will receive three fossil-based activities. All participants will receive Whale Evolution, and
More informationLevel 3 Biology, 2014
91606 916060 3SUPERVISOR S Level 3 Biology, 2014 91606 Demonstrate understanding of trends in human evolution 9.30 am Thursday 13 November 2014 Credits: Four Achievement Achievement with Merit Achievement
More informationbs148h 18 September 2007 Read: Text pgs , ch 25 & 26
bs148h 18 September 2007 Read: Text pgs 400-410, ch 25 & 26 geology & fossils Linnean systematics vs phylogenetic cladistics five kingdoms three domains tree of life homologous vs analogous (convergent)
More informationC.DARWIN ( )
C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships
More informationClassification, Phylogeny yand Evolutionary History
Classification, Phylogeny yand Evolutionary History The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize
More information9.3 Classification. Lesson Objectives. Vocabulary. Introduction. Linnaean Classification
9.3 Classification Lesson Objectives Outline the Linnaean classification, and define binomial nomenclature. Describe phylogenetic classification, and explain how it differs from Linnaean classification.
More informationMechanisms of Evolution Darwinian Evolution
Mechanisms of Evolution Darwinian Evolution Descent with modification by means of natural selection All life has descended from a common ancestor The mechanism of modification is natural selection Concept
More informationAmira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
More informationWhat is the purpose of the Classifying System? To allow the accurate identification of a particular organism
What is the purpose of the Classifying System? To allow the accurate identification of a particular organism Taxonomy The practice of classifying organisms -Taxonomy was founded nearly 300 years ago by
More informationChapter 16: Reconstructing and Using Phylogenies
Chapter Review 1. Use the phylogenetic tree shown at the right to complete the following. a. Explain how many clades are indicated: Three: (1) chimpanzee/human, (2) chimpanzee/ human/gorilla, and (3)chimpanzee/human/
More informationObjectives. Classification. Activity. Scientists classify millions of species
Objectives Classification Notes 8.1 Summarize classification Describe the evidence used to classify organisms. List the seven levels of classification. Describe and list the six kingdoms of living organisms
More informationName: Class: Date: ID: A
Class: _ Date: _ Ch 17 Practice test 1. A segment of DNA that stores genetic information is called a(n) a. amino acid. b. gene. c. protein. d. intron. 2. In which of the following processes does change
More information