Multiple Sequence Alignments

Size: px
Start display at page:

Download "Multiple Sequence Alignments"

Transcription

1 Multiple Sequence Alignments Elements of Bioinformatics Spring, 2003 Tom Carter tom/ March,

2 Sequence Alignments Often, we would like to make direct comparisons between two or more residue sequences. This allows us to see which subsequences are conserved, and what differences there are between the two sequences. In many cases, we would like to make comparisons among more than two sequences. These comparisons can help us understand evolutionary changes in molecules, and to identify functional or structurally important regions of the molecules. 2

3 In general, it can be computationally infeasible to look for globally optimal alignments of sequences, particularly when we allow gaps in the sequences. There may also be ambiguities about what should be considered optimal alignments in particular cases. There are a variety of ways in which two residue sequences (or subsequences of a sequence) might be similar. They might be evolutionarily homologous, sharing a (relatively) recent common ancestor. They might be structurally similar, contributing in similar ways to the secondary (or tertiary) structure of the molecule (e.g., alpha helices or beta sheets). They might have functional similarity, such as binding sites. In general, we would expect two evolutionarily homologous sequences to match each other fairly well at the residue level, and for 3

4 similarity scoring via such models as PAM or BLOSUM to work fairly well. On the other hand, these scoring matrices may not do very well in recognizing structural or functional similarities. For these purposes, we may need more sophisticated methods for building alignments. For example, an algorithm might use a simple PAM or BLOSUM scoring matrix approach in its early phases, and in later phases use a matching model more closely tailored to structural or functional features. For example, current implementations of ClustalW use a variety of approaches, including: Variation of amino acid substitution matrices at different alignment stages according to the divergence of the sequences to be aligned. Residue specific gap penalties and locally reduced gap penalties in hydrophilic 4

5 regions encourage new gaps in potential loop regions rather than regular secondary structure. Positions in early alignments where gaps have been opened receive locally reduced gap penalties to encourage the opening up of new gaps at these positions. (These are from the ClustalW 1.7 descriptive material.) This is a fairly active area of research. New approaches, such as HMM (hidden Markov models), are providing new tools and methods. 5

6 Basic approach to multiple sequence alignments The general approach used by many algorithms such as ClustalW for building multiple sequence alignments is as follows: Using a scoring matrix approach, do pairwise comparisons between the sequences. If there are n sequences, we will be doing n(n 1)/2 pairwise comparisons. Using the pairwise comparison scores, build a relatedness tree for the sequences. Starting with the most closely related pair of sequences, build successively larger clusters of sequence alignments until all sequences are aligned. 6

7 Here is a brief example, using some sequences from the Copper-Zinc superoxide dismutase (SODC) family: SOD2-LYCES [Lycopersicon esculentum (Tomato)] SODC-SPIOL [Spinacia oleracea (Spinach)] SODC-YEAST [Saccharomyces cerevisiae (Baker s yeast)] SODC-XENLA [Xenopus laevis (African clawed frog)] SODC-RAT [Rattus norvegicus (Rat)] SODC-MOUSE [Mus musculus (Mouse)] SODC-HUMAN [Homo sapiens (Human)] SODC-DROVI [Drosophila virilis (Fruit fly)] SODC-CHICK [Gallus gallus (Chicken)] 7

8 The first step is to do pairwise similarity scoring of the sequences. In this case, we use a Gonnet variation of the PAM250 scoring matrix: SOD2_LYCES SODC_SPIOL SODC_YEAST SODC_XENLA SODC_RAT SODC_MOUSE SODC_HUMAN SODC_DROVI 8 63 SODC_CHICK 9 Then we build a relatedness tree: ((LYCES, SPIOL 84), (YEAST, (XENLA, (((RAT, MOUSE 96), HUMAN 83), CHICK 71) 66), DROVI 58)) 8

9 Here is a pictorial version of the unrooted relatedness tree: SODC unrooted relatedness tree 9

10 Here is a multiple alignment: SODC multiple alignment (ClustalW 1.81) 10

11 Here is another version of the multiple alignment: SODC multiple alignment (boxshade) 11

12 Notations in ClustalW output: The conservation line output in the clustal format alignment file uses three characters: * indicates positions which have a single, fully conserved residue : indicates that one of the following strong groups is fully conserved:- STA NEQK NHQK NDEQ QHRK MILV MILF HY FYW 12

13 . indicates that one of the following weaker groups is fully conserved:- CSA ATV SAG STNK STPA SGND SNDEQK NDEQHK NEQHRK FVLIM HFY These are all the positively scoring groups that occur in the Gonnet Pam250 matrix. The strong and weak groups are defined as strong score > 0.5 and weak score <= 0.5 respectively. 13

Ch. 9 Multiple Sequence Alignment (MSA)

Ch. 9 Multiple Sequence Alignment (MSA) Ch. 9 Multiple Sequence Alignment (MSA) - gather seqs. to make MSA - doing MSA with ClustalW - doing MSA with Tcoffee - comparing seqs. that cannot align Introduction - from pairwise alignment to MSA -

More information

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between

More information

Week 10: Homology Modelling (II) - HHpred

Week 10: Homology Modelling (II) - HHpred Week 10: Homology Modelling (II) - HHpred Course: Tools for Structural Biology Fabian Glaser BKU - Technion 1 2 Identify and align related structures by sequence methods is not an easy task All comparative

More information

Introduction to protein alignments

Introduction to protein alignments Introduction to protein alignments Comparative Analysis of Proteins Experimental evidence from one or more proteins can be used to infer function of related protein(s). Gene A Gene X Protein A compare

More information

RELATIONSHIPS BETWEEN GENES/PROTEINS HOMOLOGUES

RELATIONSHIPS BETWEEN GENES/PROTEINS HOMOLOGUES Molecular Biology-2018 1 Definitions: RELATIONSHIPS BETWEEN GENES/PROTEINS HOMOLOGUES Heterologues: Genes or proteins that possess different sequences and activities. Homologues: Genes or proteins that

More information

Copyright Mark Brandt, Ph.D A third method, cryogenic electron microscopy has seen increasing use over the past few years.

Copyright Mark Brandt, Ph.D A third method, cryogenic electron microscopy has seen increasing use over the past few years. Structure Determination and Sequence Analysis The vast majority of the experimentally determined three-dimensional protein structures have been solved by one of two methods: X-ray diffraction and Nuclear

More information

Sequence Bioinformatics. Multiple Sequence Alignment Waqas Nasir

Sequence Bioinformatics. Multiple Sequence Alignment Waqas Nasir Sequence Bioinformatics Multiple Sequence Alignment Waqas Nasir 2010-11-12 Multiple Sequence Alignment One amino acid plays coy; a pair of homologous sequences whisper; many aligned sequences shout out

More information

Sara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject)

Sara C. Madeira. Universidade da Beira Interior. (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) Bioinformática Sequence Alignment Pairwise Sequence Alignment Universidade da Beira Interior (Thanks to Ana Teresa Freitas, IST for useful resources on this subject) 1 16/3/29 & 23/3/29 27/4/29 Outline

More information

Master Biomedizin ) UCSC & UniProt 2) Homology 3) MSA 4) Phylogeny. Pablo Mier

Master Biomedizin ) UCSC & UniProt 2) Homology 3) MSA 4) Phylogeny. Pablo Mier Master Biomedizin 2018 1) UCSC & UniProt 2) Homology 3) MSA 4) 1 12 a. All of the sequences in file1.fasta (https://cbdm.uni-mainz.de/mb18/) are homologs. How many groups of orthologs would you say there

More information

Quantifying sequence similarity

Quantifying sequence similarity Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity

More information

Overview Multiple Sequence Alignment

Overview Multiple Sequence Alignment Overview Multiple Sequence Alignment Inge Jonassen Bioinformatics group Dept. of Informatics, UoB Inge.Jonassen@ii.uib.no Definition/examples Use of alignments The alignment problem scoring alignments

More information

Procedure to Create NCBI KOGS

Procedure to Create NCBI KOGS Procedure to Create NCBI KOGS full details in: Tatusov et al (2003) BMC Bioinformatics 4:41. 1. Detect and mask typical repetitive domains Reason: masking prevents spurious lumping of non-orthologs based

More information

CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018

CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018 CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of

More information

5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT

5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT 5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT.03.239 03.10.2012 ALIGNMENT Alignment is the task of locating equivalent regions of two or more sequences to maximize their similarity. Homology:

More information

Comparing Genomes! Homologies and Families! Sequence Alignments!

Comparing Genomes! Homologies and Families! Sequence Alignments! Comparing Genomes! Homologies and Families! Sequence Alignments! Allows us to achieve a greater understanding of vertebrate evolution! Tells us what is common and what is unique between different species

More information

Biochemistry 324 Bioinformatics. Pairwise sequence alignment

Biochemistry 324 Bioinformatics. Pairwise sequence alignment Biochemistry 324 Bioinformatics Pairwise sequence alignment How do we compare genes/proteins? When we have sequenced a genome, we try and identify the function of unknown genes by finding a similar gene

More information

Bioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre

Bioinformatics. Scoring Matrices. David Gilbert Bioinformatics Research Centre Bioinformatics Scoring Matrices David Gilbert Bioinformatics Research Centre www.brc.dcs.gla.ac.uk Department of Computing Science, University of Glasgow Learning Objectives To explain the requirement

More information

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB

Homology Modeling (Comparative Structure Modeling) GBCB 5874: Problem Solving in GBCB Homology Modeling (Comparative Structure Modeling) Aims of Structural Genomics High-throughput 3D structure determination and analysis To determine or predict the 3D structures of all the proteins encoded

More information

Genomics and bioinformatics summary. Finding genes -- computer searches

Genomics and bioinformatics summary. Finding genes -- computer searches Genomics and bioinformatics summary 1. Gene finding: computer searches, cdnas, ESTs, 2. Microarrays 3. Use BLAST to find homologous sequences 4. Multiple sequence alignments (MSAs) 5. Trees quantify sequence

More information

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot

More information

Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science

Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.

More information

Sequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University

Sequence Alignment: A General Overview. COMP Fall 2010 Luay Nakhleh, Rice University Sequence Alignment: A General Overview COMP 571 - Fall 2010 Luay Nakhleh, Rice University Life through Evolution All living organisms are related to each other through evolution This means: any pair of

More information

Moreover, the circular logic

Moreover, the circular logic Moreover, the circular logic How do we know what is the right distance without a good alignment? And how do we construct a good alignment without knowing what substitutions were made previously? ATGCGT--GCAAGT

More information

Large-Scale Genomic Surveys

Large-Scale Genomic Surveys Bioinformatics Subtopics Fold Recognition Secondary Structure Prediction Docking & Drug Design Protein Geometry Protein Flexibility Homology Modeling Sequence Alignment Structure Classification Gene Prediction

More information

Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM)

Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Bioinformatics II Probability and Statistics Universität Zürich and ETH Zürich Spring Semester 2009 Lecture 4: Evolutionary Models and Substitution Matrices (PAM and BLOSUM) Dr Fraser Daly adapted from

More information

Supplemental Figure 1.

Supplemental Figure 1. Supplemental Material: Annu. Rev. Genet. 2015. 49:213 42 doi: 10.1146/annurev-genet-120213-092023 A Uniform System for the Annotation of Vertebrate microrna Genes and the Evolution of the Human micrornaome

More information

Phylogenetic inference

Phylogenetic inference Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types

More information

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche

Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche Protein Structure Prediction II Lecturer: Serafim Batzoglou Scribe: Samy Hamdouche The molecular structure of a protein can be broken down hierarchically. The primary structure of a protein is simply its

More information

Molecular Coevolution of the Vertebrate Cytochrome c 1 and Rieske Iron Sulfur Protein in the Cytochrome bc 1 Complex

Molecular Coevolution of the Vertebrate Cytochrome c 1 and Rieske Iron Sulfur Protein in the Cytochrome bc 1 Complex Molecular Coevolution of the Vertebrate Cytochrome c 1 and Rieske Iron Sulfur Protein in the Cytochrome bc 1 Complex Kimberly Baer *, David McClellan Department of Integrative Biology, Brigham Young University,

More information

PROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES

PROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES PROTEIN FUNCTION PREDICTION WITH AMINO ACID SEQUENCE AND SECONDARY STRUCTURE ALIGNMENT SCORES Eser Aygün 1, Caner Kömürlü 2, Zafer Aydin 3 and Zehra Çataltepe 1 1 Computer Engineering Department and 2

More information

Bioinformatics Exercises

Bioinformatics Exercises Bioinformatics Exercises AP Biology Teachers Workshop Susan Cates, Ph.D. Evolution of Species Phylogenetic Trees show the relatedness of organisms Common Ancestor (Root of the tree) 1 Rooted vs. Unrooted

More information

Substitution matrices

Substitution matrices Introduction to Bioinformatics Substitution matrices Jacques van Helden Jacques.van-Helden@univ-amu.fr Université d Aix-Marseille, France Lab. Technological Advances for Genomics and Clinics (TAGC, INSERM

More information

Pairwise & Multiple sequence alignments

Pairwise & Multiple sequence alignments Pairwise & Multiple sequence alignments Urmila Kulkarni-Kale Bioinformatics Centre 411 007 urmila@bioinfo.ernet.in Basis for Sequence comparison Theory of evolution: gene sequences have evolved/derived

More information

Sequence Alignment: Scoring Schemes. COMP 571 Luay Nakhleh, Rice University

Sequence Alignment: Scoring Schemes. COMP 571 Luay Nakhleh, Rice University Sequence Alignment: Scoring Schemes COMP 571 Luay Nakhleh, Rice University Scoring Schemes Recall that an alignment score is aimed at providing a scale to measure the degree of similarity (or difference)

More information

Similarity searching summary (2)

Similarity searching summary (2) Similarity searching / sequence alignment summary Biol4230 Thurs, February 22, 2016 Bill Pearson wrp@virginia.edu 4-2818 Pinn 6-057 What have we covered? Homology excess similiarity but no excess similarity

More information

BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University

BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University BIO 285/CSCI 285/MATH 285 Bioinformatics Programming Lecture 8 Pairwise Sequence Alignment 2 And Python Function Instructor: Lei Qian Fisk University Measures of Sequence Similarity Alignment with dot

More information

GATA family of transcription factors of vertebrates: phylogenetics and chromosomal synteny

GATA family of transcription factors of vertebrates: phylogenetics and chromosomal synteny Phylogenetics and chromosomal synteny of the GATAs 1273 GATA family of transcription factors of vertebrates: phylogenetics and chromosomal synteny CHUNJIANG HE, HANHUA CHENG* and RONGJIA ZHOU* Department

More information

Proteins: Structure & Function. Ulf Leser

Proteins: Structure & Function. Ulf Leser Proteins: Structure & Function Ulf Leser This Lecture Proteins Structure Function Databases Predicting Protein Secondary Structure Many figures from Zvelebil, M. and Baum, J. O. (2008). "Understanding

More information

Comparative Protein Modeling of Superoxide Dismutase Isoforms in Maize.

Comparative Protein Modeling of Superoxide Dismutase Isoforms in Maize. Comparative Protein Modeling of Superoxide Dismutase Isoforms in Maize. Kaliyugam Shiriga 1, 2, Rinku Sharma 1, Krishan Kumar 2, Firoz Hossain 1 and NepoleanThirunavukkarasu 1* Division of Genetics, Indian

More information

In-Depth Assessment of Local Sequence Alignment

In-Depth Assessment of Local Sequence Alignment 2012 International Conference on Environment Science and Engieering IPCBEE vol.3 2(2012) (2012)IACSIT Press, Singapoore In-Depth Assessment of Local Sequence Alignment Atoosa Ghahremani and Mahmood A.

More information

Pairwise sequence alignments

Pairwise sequence alignments Pairwise sequence alignments Volker Flegel VI, October 2003 Page 1 Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs VI, October

More information

Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins

Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins Multiple Alignment using Hydrophobic Clusters : a tool to align and identify distantly related proteins J. Baussand, C. Deremble, A. Carbone Analytical Genomics Laboratoire d Immuno-Biologie Cellulaire

More information

Graph Alignment and Biological Networks

Graph Alignment and Biological Networks Graph Alignment and Biological Networks Johannes Berg http://www.uni-koeln.de/ berg Institute for Theoretical Physics University of Cologne Germany p.1/12 Networks in molecular biology New large-scale

More information

Multiple Sequence Alignment. Sequences

Multiple Sequence Alignment. Sequences Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of omputer Science San José State University San José, alifornia, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Pairwise Sequence Alignment Homology

More information

Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics

Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 4. Bioinformatics 1: Biology, Sequences, Phylogenetics Bioinformatics 1 Biology, Sequences, Phylogenetics Part 4 Sepp Hochreiter Klausur Mo. 30.01.2011 Zeit: 15:30 17:00 Raum: HS14 Anmeldung Kusss Contents Methods and Bootstrapping of Maximum Methods Methods

More information

Small RNA in rice genome

Small RNA in rice genome Vol. 45 No. 5 SCIENCE IN CHINA (Series C) October 2002 Small RNA in rice genome WANG Kai ( 1, ZHU Xiaopeng ( 2, ZHONG Lan ( 1,3 & CHEN Runsheng ( 1,2 1. Beijing Genomics Institute/Center of Genomics and

More information

G4120: Introduction to Computational Biology

G4120: Introduction to Computational Biology ICB Fall 2003 G4120: Introduction to Computational Biology Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology Copyright 2003 Oliver Jovanovic, All Rights Reserved. Bioinformatics and

More information

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments

More information

CAP 5510 Lecture 3 Protein Structures

CAP 5510 Lecture 3 Protein Structures CAP 5510 Lecture 3 Protein Structures Su-Shing Chen Bioinformatics CISE 8/19/2005 Su-Shing Chen, CISE 1 Protein Conformation 8/19/2005 Su-Shing Chen, CISE 2 Protein Conformational Structures Hydrophobicity

More information

CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I)

CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) CISC 889 Bioinformatics (Spring 2004) Sequence pairwise alignment (I) Contents Alignment algorithms Needleman-Wunsch (global alignment) Smith-Waterman (local alignment) Heuristic algorithms FASTA BLAST

More information

Sequence analysis and comparison

Sequence analysis and comparison The aim with sequence identification: Sequence analysis and comparison Marjolein Thunnissen Lund September 2012 Is there any known protein sequence that is homologous to mine? Are there any other species

More information

Sequence Analysis 17: lecture 5. Substitution matrices Multiple sequence alignment

Sequence Analysis 17: lecture 5. Substitution matrices Multiple sequence alignment Sequence Analysis 17: lecture 5 Substitution matrices Multiple sequence alignment Substitution matrices Used to score aligned positions, usually of amino acids. Expressed as the log-likelihood ratio of

More information

Scoring Matrices. Shifra Ben-Dor Irit Orr

Scoring Matrices. Shifra Ben-Dor Irit Orr Scoring Matrices Shifra Ben-Dor Irit Orr Scoring matrices Sequence alignment and database searching programs compare sequences to each other as a series of characters. All algorithms (programs) for comparison

More information

Computational Structural Bioinformatics

Computational Structural Bioinformatics Computational Structural Bioinformatics ECS129 Instructor: Patrice Koehl http://koehllab.genomecenter.ucdavis.edu/teaching/ecs129 koehl@cs.ucdavis.edu Learning curve Math / CS Biology/ Chemistry Pre-requisite

More information

Sequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013

Sequence Alignments. Dynamic programming approaches, scoring, and significance. Lucy Skrabanek ICB, WMC January 31, 2013 Sequence Alignments Dynamic programming approaches, scoring, and significance Lucy Skrabanek ICB, WMC January 31, 213 Sequence alignment Compare two (or more) sequences to: Find regions of conservation

More information

Pairwise sequence alignments. Vassilios Ioannidis (From Volker Flegel )

Pairwise sequence alignments. Vassilios Ioannidis (From Volker Flegel ) Pairwise sequence alignments Vassilios Ioannidis (From Volker Flegel ) Outline Introduction Definitions Biological context of pairwise alignments Computing of pairwise alignments Some programs Importance

More information

Protein Structure Prediction Using Neural Networks

Protein Structure Prediction Using Neural Networks Protein Structure Prediction Using Neural Networks Martha Mercaldi Kasia Wilamowska Literature Review December 16, 2003 The Protein Folding Problem Evolution of Neural Networks Neural networks originally

More information

Supporting Text 1. Comparison of GRoSS sequence alignment to HMM-HMM and GPCRDB

Supporting Text 1. Comparison of GRoSS sequence alignment to HMM-HMM and GPCRDB Structure-Based Sequence Alignment of the Transmembrane Domains of All Human GPCRs: Phylogenetic, Structural and Functional Implications, Cvicek et al. Supporting Text 1 Here we compare the GRoSS alignment

More information

A bioinformatics approach to the structural and functional analysis of the glycogen phosphorylase protein family

A bioinformatics approach to the structural and functional analysis of the glycogen phosphorylase protein family A bioinformatics approach to the structural and functional analysis of the glycogen phosphorylase protein family Jieming Shen 1,2 and Hugh B. Nicholas, Jr. 3 1 Bioengineering and Bioinformatics Summer

More information

BIOINFORMATICS LAB AP BIOLOGY

BIOINFORMATICS LAB AP BIOLOGY BIOINFORMATICS LAB AP BIOLOGY Bioinformatics is the science of collecting and analyzing complex biological data. Bioinformatics combines computer science, statistics and biology to allow scientists to

More information

Application of new distance matrix to phylogenetic tree construction

Application of new distance matrix to phylogenetic tree construction Application of new distance matrix to phylogenetic tree construction P.V.Lakshmi Computer Science & Engg Dept GITAM Institute of Technology GITAM University Andhra Pradesh India Allam Appa Rao Jawaharlal

More information

Bio nformatics. Lecture 23. Saad Mneimneh

Bio nformatics. Lecture 23. Saad Mneimneh Bio nformatics Lecture 23 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely

More information

Multiple Alignment. Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis

Multiple Alignment. Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis Multiple Alignment Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis gorm@cbs.dtu.dk Refresher: pairwise alignments 43.2% identity; Global alignment score: 374 10 20

More information

CSE P 590 A Spring : MLE, EM

CSE P 590 A Spring : MLE, EM CSE P 590 A Spring 2013 4: MLE, EM 1 Outline HW#2 Discussion MLE: Maximum Likelihood Estimators EM: the Expectation Maximization Algorithm Next: Motif description & discovery 2 HW # 2 Discussion Species

More information

Cubic Spline Interpolation Reveals Different Evolutionary Trends of Various Species

Cubic Spline Interpolation Reveals Different Evolutionary Trends of Various Species Cubic Spline Interpolation Reveals Different Evolutionary Trends of Various Species Zhiqiang Li 1 and Peter Z. Revesz 1,a 1 Department of Computer Science, University of Nebraska-Lincoln, Lincoln, NE,

More information

Protein folding. α-helix. Lecture 21. An α-helix is a simple helix having on average 10 residues (3 turns of the helix)

Protein folding. α-helix. Lecture 21. An α-helix is a simple helix having on average 10 residues (3 turns of the helix) Computat onal Biology Lecture 21 Protein folding The goal is to determine the three-dimensional structure of a protein based on its amino acid sequence Assumption: amino acid sequence completely and uniquely

More information

Introduction to Bioinformatics Online Course: IBT

Introduction to Bioinformatics Online Course: IBT Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 07: profile Hidden Markov Model http://bibiserv.techfak.uni-bielefeld.de/sadr2/databasesearch/hmmer/profilehmm.gif Slides adapted from Dr. Shaojie Zhang

More information

Sequence Database Search Techniques I: Blast and PatternHunter tools

Sequence Database Search Techniques I: Blast and PatternHunter tools Sequence Database Search Techniques I: Blast and PatternHunter tools Zhang Louxin National University of Singapore Outline. Database search 2. BLAST (and filtration technique) 3. PatternHunter (empowered

More information

Computational Genomics and Molecular Biology, Fall

Computational Genomics and Molecular Biology, Fall Computational Genomics and Molecular Biology, Fall 2014 1 HMM Lecture Notes Dannie Durand and Rose Hoberman November 6th Introduction In the last few lectures, we have focused on three problems related

More information

Practical considerations of working with sequencing data

Practical considerations of working with sequencing data Practical considerations of working with sequencing data File Types Fastq ->aligner -> reference(genome) coordinates Coordinate files SAM/BAM most complete, contains all of the info in fastq and more!

More information

Hidden Markov Models in computational biology. Ron Elber Computer Science Cornell

Hidden Markov Models in computational biology. Ron Elber Computer Science Cornell Hidden Markov Models in computational biology Ron Elber Computer Science Cornell 1 Or: how to fish homolog sequences from a database Many sequences in database RPOBESEQ Partitioned data base 2 An accessible

More information

Sequence Alignment Techniques and Their Uses

Sequence Alignment Techniques and Their Uses Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this

More information

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder

HMM applications. Applications of HMMs. Gene finding with HMMs. Using the gene finder HMM applications Applications of HMMs Gene finding Pairwise alignment (pair HMMs) Characterizing protein families (profile HMMs) Predicting membrane proteins, and membrane protein topology Gene finding

More information

Copyright 2000 N. AYDIN. All rights reserved. 1

Copyright 2000 N. AYDIN. All rights reserved. 1 Introduction to Bioinformatics Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Multiple Sequence Alignment Outline Multiple sequence alignment introduction to msa methods of msa progressive global alignment

More information

11/24/13. Science, then, and now. Computational Structural Bioinformatics. Learning curve. ECS129 Instructor: Patrice Koehl

11/24/13. Science, then, and now. Computational Structural Bioinformatics. Learning curve. ECS129 Instructor: Patrice Koehl Computational Structural Bioinformatics ECS129 Instructor: Patrice Koehl http://www.cs.ucdavis.edu/~koehl/teaching/ecs129/index.html koehl@cs.ucdavis.edu Learning curve Math / CS Biology/ Chemistry Pre-requisite

More information

Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny

More information

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas Sequence comparison: Score matrices Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas Informal inductive proof of best alignment path onsider the last step in the best

More information

Exploring Evolution & Bioinformatics

Exploring Evolution & Bioinformatics Chapter 6 Exploring Evolution & Bioinformatics Jane Goodall The human sequence (red) differs from the chimpanzee sequence (blue) in only one amino acid in a protein chain of 153 residues for myoglobin

More information

Multiple Sequence Alignment

Multiple Sequence Alignment Multiple equence lignment Four ami Khuri Dept of omputer cience an José tate University Multiple equence lignment v Progressive lignment v Guide Tree v lustalw v Toffee v Muscle v MFFT * 20 * 0 * 60 *

More information

Sequence Analysis and Databases 2: Sequences and Multiple Alignments

Sequence Analysis and Databases 2: Sequences and Multiple Alignments 1 Sequence Analysis and Databases 2: Sequences and Multiple Alignments Jose María González-Izarzugaza Martínez CNIO Spanish National Cancer Research Centre (jmgonzalez@cnio.es) 2 Sequence Comparisons:

More information

CRISPRseek Workshop Design of target-specific guide RNAs in CRISPR-Cas9 genome-editing systems

CRISPRseek Workshop Design of target-specific guide RNAs in CRISPR-Cas9 genome-editing systems April 2008 CRISPRseek Workshop Design of target-specific guide RNAs in CRISPR-Cas9 genome-editing systems Lihua Julie Zhu Sept 10th 2014 Michael Brodsky Jianhong Ou INSTALLATION First install R 3.1.0 Windows:

More information

Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:

Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17: Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:50 5001 5 Multiple Sequence Alignment The first part of this exposition is based on the following sources, which are recommended reading:

More information

CSE 549: Computational Biology. Substitution Matrices

CSE 549: Computational Biology. Substitution Matrices CSE 9: Computational Biology Substitution Matrices How should we score alignments So far, we ve looked at arbitrary schemes for scoring mutations. How can we assign scores in a more meaningful way? Are

More information

7.36/7.91 recitation CB Lecture #4

7.36/7.91 recitation CB Lecture #4 7.36/7.91 recitation 2-19-2014 CB Lecture #4 1 Announcements / Reminders Homework: - PS#1 due Feb. 20th at noon. - Late policy: ½ credit if received within 24 hrs of due date, otherwise no credit - Answer

More information

IMPORTANCE OF SECONDARY STRUCTURE ELEMENTS FOR PREDICTION OF GO ANNOTATIONS

IMPORTANCE OF SECONDARY STRUCTURE ELEMENTS FOR PREDICTION OF GO ANNOTATIONS IMPORTANCE OF SECONDARY STRUCTURE ELEMENTS FOR PREDICTION OF GO ANNOTATIONS Aslı Filiz 1, Eser Aygün 2, Özlem Keskin 3 and Zehra Cataltepe 2 1 Informatics Institute and 2 Computer Engineering Department,

More information

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror

Protein structure prediction. CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror Protein structure prediction CS/CME/BioE/Biophys/BMI 279 Oct. 10 and 12, 2017 Ron Dror 1 Outline Why predict protein structure? Can we use (pure) physics-based methods? Knowledge-based methods Two major

More information

Sequence analysis and Genomics

Sequence analysis and Genomics Sequence analysis and Genomics October 12 th November 23 rd 2 PM 5 PM Prof. Peter Stadler Dr. Katja Nowick Katja: group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute

More information

3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT

3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT 3. SEQUENCE ANALYSIS BIOINFORMATICS COURSE MTAT.03.239 25.09.2012 SEQUENCE ANALYSIS IS IMPORTANT FOR... Prediction of function Gene finding the process of identifying the regions of genomic DNA that encode

More information

Bioinformatics. Can Keşmir Theoretical Biology/Bioinformatics, UU

Bioinformatics. Can Keşmir Theoretical Biology/Bioinformatics, UU Bioinformatics Can Keşmir Theoretical Biology/Bioinformatics, UU 2013 i c Utrecht University, 2013 Ebook publically available at: http://theory.bio.uu.nl/bpa/bioinf2013.pdf ii Contents 1 Introduction to

More information

Similarity or Identity? When are molecules similar?

Similarity or Identity? When are molecules similar? Similarity or Identity? When are molecules similar? Mapping Identity A -> A T -> T G -> G C -> C or Leu -> Leu Pro -> Pro Arg -> Arg Phe -> Phe etc If we map similarity using identity, how similar are

More information

Sequence comparison: Score matrices

Sequence comparison: Score matrices Sequence comparison: Score matrices http://facultywashingtonedu/jht/gs559_2013/ Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas FYI - informal inductive proof of best

More information

Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics Lecture : p he biological problem p lobal alignment p Local alignment p Multiple alignment 6 Background: comparative genomics p Basic question in biology: what properties

More information

Genome Sequencing & DNA Sequence Analysis

Genome Sequencing & DNA Sequence Analysis 7.91 / 7.36 / BE.490 Lecture #1 Feb. 24, 2004 Genome Sequencing & DNA Sequence Analysis Chris Burge What is a Genome? A genome is NOT a bag of proteins What s in the Human Genome? Outline of Unit II: DNA/RNA

More information

20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, Global and local alignment of two sequences using dynamic programming

20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, Global and local alignment of two sequences using dynamic programming 20 Grundlagen der Bioinformatik, SS 08, D. Huson, May 27, 2008 4 Pairwise alignment We will discuss: 1. Strings 2. Dot matrix method for comparing sequences 3. Edit distance 4. Global and local alignment

More information

COPIA: A New Software for Finding Consensus Patterns. Chengzhi Liang. A thesis. presented to the University ofwaterloo. in fulfilment of the

COPIA: A New Software for Finding Consensus Patterns. Chengzhi Liang. A thesis. presented to the University ofwaterloo. in fulfilment of the COPIA: A New Software for Finding Consensus Patterns in Unaligned Protein Sequences by Chengzhi Liang A thesis presented to the University ofwaterloo in fulfilment of the thesis requirement for the degree

More information

Letter to the Editor. Temperature Hypotheses. David P. Mindell, Alec Knight,? Christine Baer,$ and Christopher J. Huddlestons

Letter to the Editor. Temperature Hypotheses. David P. Mindell, Alec Knight,? Christine Baer,$ and Christopher J. Huddlestons Letter to the Editor Slow Rates of Molecular Evolution Temperature Hypotheses in Birds and the Metabolic Rate and Body David P. Mindell, Alec Knight,? Christine Baer,$ and Christopher J. Huddlestons *Department

More information

Sequence Based Bioinformatics

Sequence Based Bioinformatics Structural and Functional Analysis of Inosine Monophosphate Dehydrogenase using Sequence-Based Bioinformatics Barry Sexton 1,2 and Troy Wymore 3 1 Bioengineering and Bioinformatics Summer Institute, Department

More information

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas

Sequence comparison: Score matrices. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas Sequence comparison: Score matrices Genome 559: Introduction to Statistical and omputational Genomics Prof James H Thomas FYI - informal inductive proof of best alignment path onsider the last step in

More information