Framework for a Protein Ontology

Transcription

1 Framework for a rotein Ontology TMBIO November 2006 Darren A. Natale, h.d. rotein Science Team Lead, IR Research Assistant rofessor, GUMC

2 GO: ontologies that pertain, in part, to the locations, the processes, and the functions of proteins SI-MOD: ontology that describe the possible modifications to protein amino acid residues SO: ontology that can describe the possible causes of protein sequence, expression, or structure changes DO: ontology that can describe the possible effects of protein sequence, expression, or structure changes

3 Mothers against decapentaplegic homolog 2 GO annotation of SMAD2_HUMAN: Cellular Component: - nucleus Molecular Function: - protein binding Biological rocess: - signal transduction - regulation of transcription, DNA-dependent

4 TGF-β II I TGF-beta receptor 1 phosphorylation Smad 4 2 complex formation Smad 4 3 nuclear translocation Nucleus Smad 4 4 DNA binding Transcription Regulation

5 TGF-β II I TGF-beta receptor 1 phosphorylation Smad 4 ERK1 2 complex formation Smad 4 3 nuclear translocation Nucleus Smad 4 4 DNA binding Transcription Regulation ++

6 CAMK2 TGF-β II I TGF-beta receptor 1 phosphorylation Smad 4 2 complex formation Smad 4 3 nuclear translocation Cytoplasm Nucleus Transcription Regulation

7 normal Cytoplasmic RO: SMAD2_HUMAN TGF-β receptor phosphorylated Forms complex Nuclear Txn upregulation RO: SMAD2_HUMAN ERK1 phosphorylated Forms complex Nuclear Txn upregulation++ RO: SMAD2_HUMAN CAMK2 phosphorylated Forms complex Cytoplasmic No Txn upregulation RO: SMAD2_HUMAN alternatively spliced short form Cytoplasmic RO: SMAD2_HUMAN phosphorylated short form Nuclear Txn upregulation RO: SMAD2_HUMAN x point mutation (causative agent: large intestine carcinoma) Doesn t form complex Cytoplasmic No Txn upregulation RO: SMAD2_HUMAN

8 Important Considerations Need to consider the various forms a protein might take Need to provide connections to established ontologies Need to account for the possibility that a protein might not share the traits of its parent or siblings

9 %RO: Smad2 <RO: Smad2 sequence 1 (long form) >RO: Smad2 sequence 1 phosphorylated form %RO: Smad2 sequence 1, TGF-β receptor I-phosphorylated %RO: Smad2 sequence 1, TGF-β receptor I and ERK1-phosphorylated has_modification MOD:O-phosphorylated L-serine has_modification MOD:O-phosphorylated L-threonine has_function GO: TGF-β receptor, pathway-specific cytoplasmic mediator activity has_function GO:SMAD binding has_function GO:transcription coactivator activity participates_in GO:signal transduction participates_in GO:SMAD protein heteromerization participates_in GO:regulation of transcription, DNA-dependent located_in GO:nucleus part_of GO:transcription factor complex %RO: Smad2 sequence 1, TGF-β receptor I and CAMK2-phosphorylated <RO: Smad2 sequence 2 (short form) - splice variant >RO: Smad2 sequence 2 phosphorylated form %RO: Smad2 sequence 2, TGF-β receptor I-phosphorylated <RO: Smad2 sequence 3 - genetic variant related to colorectal carcinoma has_agent SO: amino_acid_substitution lacks_modification MOD: phosphorylated residue lacks_function GO: transcription coactivator activity agent_of DO: carcinoma of the large intestine % is_a < variant_of > derives_from

10 Important Considerations Need to consider the various forms a protein might take Need to provide connections to established ontologies Need to account for the possibility that a protein might not share the traits of its parent or siblings Need to take advantage of model organism data to generate hypotheses about human biology

11 Implications of rotein Evolution Human Chimp Mouse Rat Fly Worm Yeast E.coli B.subtilis Conclusions from experiments performed on proteins from one organism are often applicable to the homologous protein from another organism. Information learned about existing proteins allows us to infer the properties of ancestral proteins.

12 rotein Evolution Sequence changes Domain shuffling With enough similarity, one can trace back to a common origin What about these?

13 Levels of rotein Classification Evolutionary Divergence End-to-End Alignment Example Conservation Database Very Ancient Domain structure Very general biochemical activity SCO Superfamily Ancient Domain sequence CVSGSGNNTSITATGGVVDLQSSSAVKVRSTK CYKSG---IQVRLGEDNINVVEGNEQFISASK General biochemical activity fam *....:. :::... : ::* Recent rotein sequence Specific biochemical activity IRSF Domain architecture Functionally Specialized rotein sequence Domain CYKSRIQVRLGEHNIDVLEGNEQFINAAKIIT CYKSGIQVRLGEDNINVVEGNEQFISASKSIV **** *******.**:*:*******.*:* *. Specific biological function ANTHER architecture

14 TGM3 & EB42 TGM3 = rotein-glutamine gamma-glutamyltransferase (Transglutaminase; involved in protein modification) EB42 = Erythrocyte membrane protein band 4.2 (Constituent of cytoskeleton; involved in cell shape) Q: Are these related? Q: What is known? Q: How to capture?

15 Gene Duplication (TGM3/EB42 split) TGM3 branch EB42 branch Speciation (Human/mouse split) Human Mouse Human Mouse TGM3 (Human) TGM3 (Mouse) EB42 (Human) EB42 (Mouse) TGM3 (Human) TGM3 (Mouse) EB42 (Human) EB42 (Mouse) GO: cell shape (biological process) GO: constituent of cytoskelton (molecular function) has_ancestral_property has_ancestral_property TGM3 (Human) EB42 (Human) IRSF TGM3 (Mouse) EB42 (Mouse) THR11590:SF11 THR11590:SF5 lacks_ancestral_property lacks_ancestral_property has_ancestral_property has_ancestral_property has_part GO: rotein Modification (biological process) F00868 (domain) F01841 (domain) F00927 (domain) GO: TGase activity (molecular function)

16 RO Root level Unit Level The two types of evolutionary units Not substituted by any other terms Domain Family Level (structure) Related by structural similarity Source: SCO Superfamily Domain Family Level (sequence) Related by sequence similarity Source: fam domain is_a domain is_a structure domain is_a sequence domain rotein Family Level Evolutionarily-related full-length proteins May contain finer-grain sub-categories Sources: IRSF family/subfamily, anther subfamily rotein Modification Level rotein as modified after translation Source: UnirotKB evolutionary unit has_part is_a lacks rotein Sequence Level ossible sequence forms derived from genetic variation or splicing Source: UnirotKB is_a protein is_a whole protein is_a sequence form derives_from cleaved and/or modified product GO Gene Ontology molecular function has_ancestral_property has_function lacks_function biological process has_ancestral_property participates_in cellular component has_ancestral_property part_of (for complexes) located_in (for compartments) DO/UMLS SO disease agent_of SI-MOD protein modification has_modification Disease Sequence Ontology sequence changes has_agent (sequence change) agent_of (effect on function) Modification

17 RO Team (so far ) rinciple Investigators Cathy Wu Judith Blake Hongfang Liu Barry Smith Curators Darren Natale Cecilia Arighi Winona Barker Zhang-zhi Hu (IR at GUMC) (The Jackson Laboratory) (GUMC) (SUNY Buffalo) (IR at GUMC) (IR at GUMC) (IR at GUMC) (IR at GUMC)