SUPPLEMENTARY INFORMATION

Actinobacteria Relative abundance (%) Co-housed CD300f WT. CD300f KO. Colon length (cm) Day 9. Microscopic inflammation score

y groups y individuals 9 Actinobacteria Relative abundance (%) acteroidetes Cyanobacteria Deferribacteres Firmicutes Proteobacteria TM Tenericutes Unclassified CDf CDf Co-housed CDf Co-housed CDf CDf CDf

SUPPLEMENTARY INFORMATION

SULEMENTARY INORMATION doi:1.138/nture1394 Trnsduced Mcrophges 293T-Nip trnsfectnts NAI2 N2 N5 5 Blot: Nip2 Blot: Nip5 N1 lg N6 5 c Blot: lg Blot: Nip6 Wild-type Legionell infection: fla Legionell infection:

supplementary information

DOI: 1.138/nc8 Top-GFP!-ctenin GFP Intensity 3 1 1 3 5 6 7 8 Nucler Bet-Ctenin c MUC FABP KRT 8 5 3 6 15 1 5 LGR5 ASCL AXIN 15 5 15 5 Figure S1 TOP-GFP expression nd reltion with nucler β-ctenin, wnt trgets

FSC-W FSC-H CD4 CD62-L

Supplementary Fig. 1 a SSC-A FSC-A FSC-W FSC-H SSC-W SSC-H CD4 CD62-L b SSC-A FSC-A FSC-W FSC-A FSC-A 7-AAD FSC-A CD4 IL-9 CD4 c SSC-A FSC-A FSC-W FSC-H SSC-W SSC-H 7-AAD KI67 Annexin-V 7-AAD d I L -5

SUPPLEMENTARY INFORMATION

doi:.38/nture8499 doi:.38/nture8499 5 6 5 4.5 Firing rte (Hz) -67-65 -66-6 -58 V m (mv) -7-67 -68-66 -64 c Thet power (mv ) -73-69 -7-7 -7.5.8 3....9.9.4.6.6. 9 8 9 8 9 8 9 8 9 8 Supplementry Figure Firing

SUPPLEMENTARY INFORMATION

doi:1.138/nture11444 CMKIIN Gold prticles/ mitochondril re ( m ) 4 3 1 CMKIIN mtcmkiin mtcmkiin SERCA ATP synthse HA mitoplsts mtcmkiin CMKIIN cytosolic mtcmkiin CMKIIN 97 kdl 64 kdl 51 kdl 14 kdl 6 kdl

Vertical uniformity of cells and nuclei in epithelial monolayers

Supplementry informtion Verticl uniformity of cells nd nuclei in epithelil monolyers Srujn Neelm b, Peter Hyes, Qio Zhng, Richrd B. Dickinson nd Tnmy P. Lele, Figure S1. Histogrm plots compre the frequency

SUPPLEMENTARY INFORMATION

doi:1.1/nture1 NF-κB/RE-GFP TNF-α pdna CA CA + DN d e NF-κB/RE-GFP GFP+DAPI NF-κB/RE-GFP GFP+DAPI NF-κB/RE-GFP GFP+DAPI V V DAPI DAPI NF-κB RE/GFP V V Mediosl hypothlmus Thlmus Cortex Suppl. Figure 1.

Supplementary figure 1

Supplementry figure 1 Igf 1 mrna 5 15 1 5 Arg1 mrna 16 1 8 Col11 mrna 5 3 1 Mmp 13 mrna 15 1 5 Tslp mrna 3 1 Il5 mrna 3 1-1 Il33 mrna 6 Figure 1s. Kinetis of woun heling ftors n erly Th-type response ytokines

Supporting Information. Cytosolic Irradiation of Femtosecond Laser Induces Mitochondria-dependent Apoptosis-like

Supporting Informtion Cytosolic Irrdition of Femtosecond Lser Induces Mitochondri-dependent Apoptosis-like Cell Deth vi Intrinsic Rective Oxygen Cscdes Jonghee Yoon 1,2, Seung-wook Ryu 1,3, Seunghee Lee

SUPPLEMENTARY INFORMATION

GP2 Type I-piliated bacteria FAE M cell M cell pocket idc T cell mdc Generation of antigenspecific T cells Induction of antigen-specific mucosal immune response Supplementary Figure 1 Schematic diagram

Lung-residing myeloid-derived suppressors display dual functionality in murine. pulmonary tuberculosis

Lung-residing myeloid-derived suppressors display dual functionality in murine pulmonary tuberculosis Julia K. Knaul, Sabine Jörg, Dagmar Oberbeck-Mueller, Ellen Heinemann, Lisa Scheuermann, Volker Brinkmann,

SUPPLEMENTARY FIGURES

A m ultory distnce (cm ) % C enter distnce C e n te r tim e (s ) A m ultory distnce (cm ) % C enter distnce C e n te r tim e (s ) N o v e l c g e % h o m e c g e c o n s u m p tio n % M ic e fe e d in

SUPPLEMENTARY INFORMATION

doi:10.1038/nature11419 Supplementary Figure 1 Schematic representation of innate immune signaling pathways induced by intracellular Salmonella in cultured macrophages. a, During the infection Salmonella

SUPPLEMENTARY INFORMATION

VOLUME: ARTICLE NUMBER: 3 In the formt provided y the uthors nd unedited. Developmentl constrints shpe the evolution of the nemtode mid-developmentl trnsition Hrel Zlts nd Iti Yni,3 Fculty of Biology,

Changes in ph and microbial composition in the ruminal and reticular fluids of SARA cattle

66 th EAAP Annul Meeting (Wrsw, 215) Chnges in ph nd microil composition in the ruminl nd reticulr fluids of SARA cttle Shigeru SATO Coopertive Deprtment of Veterinry Medicine, Fculty of Agriculture, Iwte

DOI:.8/nc5 Cpilities of MCAK Sidesliding, endctching on microtuules MCAKdecorted ed Functions in mitotic spindle Prometphse Slides on the microtuule surfce + Redily slides long the microtuule surfce Strongly

Transient Stimulation of Distinct Subpopulations of Striatal Neurons Mimics Changes in the Value of Competing Actions

Supplementl mterils for: Trnsient Stimultion of Distinct Supopultions of Stritl Neurons Mimics Chnges in the Vlue of Competing Actions Lung-Ho Ti, A. Moses Lee,2, Nor Benvidez 3, Antonello Bonci 4,,6,

THE EFFECT OF GRADED DIETARY LEVELS OF VITAMIN A, GIVEN TO EARLY SEA BREAM (Sparus aurata) LARVAE ON SKELETAL DEFORMITIES AND GENOMIC EXPRESSION

THE EFFECT OF GRADED DIETARY LEVELS OF VITAMIN A, GIVEN TO EARLY SEA BREAM (Sprus urt) LARVAE ON SKELETAL DEFORMITIES AND GENOMIC EXPRESSION B. Ginzourg, W.M. Koven, S. Fontgne, A. Sgi, D. M. Power nd

SUPPLEMENTARY INFORMATION

Metal nanoparticles in the presence of lipopolysaccharides trigger the onset of metal allergy in mice Toshiro Hirai, Yasuo Yoshioka, Natsumi Izumi, Ko-ichi Ichihashi, Takayuki Handa, Nobuo Nishijima, Eiichiro

dsrna GFP 0 Ca 0 Ca 0 Ca TG Iono Time (s)

Rtio (FL1/FL3) MFI dsrna GFP C dsrna dori C 1 2 1 2 Rtio (FL1/FL3) MFI C 1 2 Rtio (FL1/FL3) MFI C 1 2 C 1 2 C 1 2 Supplementry Figure 1. RNAi-medited depletion of dori hs no effet on the filling stte of

SUPPLEMENTARY INFORMATION

DOI: 1.138/nc2975 GM13 / DNA F-ctin α shrna CLASP1 shrna shrna shrna CLASP1 shrna shrna e Tuulin CLASP1 CLASP1 shrna #32 shrna #33 #55 #58 Tuulin c Tuulin ppmlc E-Cdherin shrna CLASP1 shrna shrna f Golgi

Diverse modes of eco-evolutionary dynamics in communities of antibiotic-producing microorganisms

In the formt provided y the uthors nd unedited. ULEMENTAY INFOMATION VOLUME: 1 ATICLE NUMBE: 0189 iverse modes of eco-evolutionry dynmics in communities of ntiiotic-producing microorgnisms Klin Vetsigin

Control NaCl ABA * * Control 4ºC 37ºC

Dul regultion of wter retention nd cell growth y stress-ssocited protein (SAP) gene in Prunus A. Lloret, A. Conejero, C. Leid, C. Petri, F. Gil-Muñoz, L. Burgos, M.L. Bdenes, nd G. Ríos.5 PpSAP Reltive

Partial Derivatives. Limits. For a single variable function f (x), the limit lim

Limits Prtil Derivtives For single vrible function f (x), the limit lim x f (x) exists only if the right-hnd side limit equls to the left-hnd side limit, i.e., lim f (x) = lim f (x). x x + For two vribles

Tests for the Ratio of Two Poisson Rates

Chpter 437 Tests for the Rtio of Two Poisson Rtes Introduction The Poisson probbility lw gives the probbility distribution of the number of events occurring in specified intervl of time or spce. The Poisson

Chapter 9: Inferences based on Two samples: Confidence intervals and tests of hypotheses

Chpter 9: Inferences bsed on Two smples: Confidence intervls nd tests of hypotheses 9.1 The trget prmeter : difference between two popultion mens : difference between two popultion proportions : rtio of

First Semester Review Calculus BC

First Semester Review lculus. Wht is the coordinte of the point of inflection on the grph of Multiple hoice: No lcultor y 3 3 5 4? 5 0 0 3 5 0. The grph of piecewise-liner function f, for 4, is shown below.

Supplementary Information

Supplementry Informtion Coopertion of locl motions in the Hsp90 moleculr chperone ATPse mechnism Andre Schulze 1, Gerti Beliu 1, Dominic A. Helmerich 1, Jonthn Schubert 1, Lurence H. Perl 2, Chrisostomos

SUPPLEMENTARY INFORMATION. For

Eletroni Supplementry Mteril (ESI) for Journl of Mterils Chemistry B. This journl is The Royl Soiety of Chemistry 217 SUPPLEMETARY IFRMATI For Phyoynin-bsed nnorrier s new nnopltform for effiient overoming

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature14242 Supplementary Methods Mathematical modelling Hematopoietic fluxes. Consider two successive cell compartments in hematopoiesis, an upstream and a reference

1,6. Tu18 1,2 0,8 0,4 0,0. Tu29. >10x down * 1,6. Tu43 1,2 0,8 0,4 0,0 8 0,0 1,6. Tu80 0,8 0,4 0,0

Reltive expression Tu14,9,6,3 2, Tu16 1,5 1,,5 Tu18,4 3 2 1 Tu19 >1x down * Reltive expression 3,2 Tu23 2,4 3 25 2 15 1 5 Tu28 >1x down * 4 Tu29 3 2 1 Tu31,9,6,3 Tu32 3,2 Tu33 Tu43 Tu57 Reltive expression

3.94 ± 0.50 (95% CI) Correlative inhibition index (slope)

Supplementl Tle S. Selected rchitecturl prmeters of phy nd phyphy grown under. Vlues re mens ± SE, except for predicted primry rosette rnches where the vlues re the men with the ssocited 9% confidence

SUPPLEMENTARY INFORMATION

doi:.38/nture896 c Resting stte Resting stte Resting stte Supplementry Figure Illustrtion of pttern clssifiction nd its effects on neuronl representtions. Dynmic ctivity ptterns evoked y different stimuli

Nature Biotechnology: doi: /nbt Supplementary Figure 1. The inflammatory response in the mammalian gut leads to tetrathionate generation.

Supplementary Figure 1 The inflammatory response in the mammalian gut leads to tetrathionate generation. Cytokine signaling following an inflammatory insult leads to, among other responses, release of

Research Article. EFFECT OF ph ON BIOFILM FORMATION AND MOTILITIES OF Pseudomonas aeruginosa, Escherichia coli AND Staphylococcus aureus ATCC STRAINS

BMR Microiology www.dvncejournls.org Open ccess Scientific Pulisher Reserch rticle EFFECT OF ph ON BIOFILM FORMTION ND MOTILITIES OF Pseudomons eruginos, Escherichi coli ND Stphylococcus ureus TCC STRINS

Population Dynamics Definition Model A model is defined as a physical representation of any natural phenomena Example: 1. A miniature building model.

Popultion Dynmics Definition Model A model is defined s physicl representtion of ny nturl phenomen Exmple: 1. A miniture building model. 2. A children cycle prk depicting the trffic signls 3. Disply of

Supplementary Figure 1 Supplementary Figure 2

Supplementry Figure 1 Comprtive illustrtion of the steps required to decorte n oxide support AO with ctlyst prticles M through chemicl infiltrtion or in situ redox exsolution. () chemicl infiltrtion usully

JEE(MAIN) 2015 TEST PAPER WITH SOLUTION (HELD ON SATURDAY 04 th APRIL, 2015) PART B MATHEMATICS

JEE(MAIN) 05 TEST PAPER WITH SOLUTION (HELD ON SATURDAY 0 th APRIL, 05) PART B MATHEMATICS CODE-D. Let, b nd c be three non-zero vectors such tht no two of them re colliner nd, b c b c. If is the ngle

Nature Biotechnology: doi: /nbt Supplementary Figure 1. Generation of paraxial mesoderm from the H7 hesc line.

Supplementary Figure 1 Generation of paraxial mesoderm from the H7 hesc line. H7 hescs were differentiated as shown in Figure 1a. (a) Flow cytometric analyses of the proportion of CD56+, PDGFRα+, and KDR+

8 Laplace s Method and Local Limit Theorems

8 Lplce s Method nd Locl Limit Theorems 8. Fourier Anlysis in Higher DImensions Most of the theorems of Fourier nlysis tht we hve proved hve nturl generliztions to higher dimensions, nd these cn be proved

A population-based temporal logic gate for timing and recording chemical events

Pulished online: My 7, Article A popultion-sed temporl logic gte for timing nd recording chemicl events Victori Hsio,*, Yutk Hori, Pul WK Rothemund & Richrd M Murry Astrct Engineered cteril sensors hve

7.1 Integral as Net Change and 7.2 Areas in the Plane Calculus

7.1 Integrl s Net Chnge nd 7. Ares in the Plne Clculus 7.1 INTEGRAL AS NET CHANGE Notecrds from 7.1: Displcement vs Totl Distnce, Integrl s Net Chnge We hve lredy seen how the position of n oject cn e

SUPPLEMENTARY INFORMATION

doi:10.1038/nature09414 Supplementary Figure 1 FACS-isolated 8c hepatocytes are highly pure. a, Gating strategy for identifying hepatocyte populations based on DNA content. b, Detection of mchry and mchr9

Math 259 Winter Solutions to Homework #9

Mth 59 Winter 9 Solutions to Homework #9 Prolems from Pges 658-659 (Section.8). Given f(, y, z) = + y + z nd the constrint g(, y, z) = + y + z =, the three equtions tht we get y setting up the Lgrnge multiplier

Strategy: Use the Gibbs phase rule (Equation 5.3). How many components are present?

University Chemistry Quiz 4 2014/12/11 1. (5%) Wht is the dimensionlity of the three-phse coexistence region in mixture of Al, Ni, nd Cu? Wht type of geometricl region dose this define? Strtegy: Use the

CS-E5880 Modeling biological networks Parameter estimation for biological networks

CS-E5880 Modeling biological networks Parameter estimation for biological networks Jukka Intosalmi Department of Computer Science Aalto University January 16, 2018 Outline ODE model calibration as an optimization

Supplementary Information

Supplementry Informtion Spontneously mplified homochirl orgnic-inorgnic nno-helix complex vi self-prolifertion Hlei Zhi, Yn Qun, Li Li, Xing-Yng Liu, Xurong Xu c nd Ruikng Tng*,c Centre for Biomterils

State space systems analysis (continued) Stability. A. Definitions A system is said to be Asymptotically Stable (AS) when it satisfies

Stte spce systems nlysis (continued) Stbility A. Definitions A system is sid to be Asymptoticlly Stble (AS) when it stisfies ut () = 0, t > 0 lim xt () 0. t A system is AS if nd only if the impulse response

Alg. Sheet (1) Department : Math Form : 3 rd prep. Sheet

Ciro Governorte Nozh Directorte of Eduction Nozh Lnguge Schools Ismili Rod Deprtment : Mth Form : rd prep. Sheet Alg. Sheet () [] Find the vlues of nd in ech of the following if : ) (, ) ( -5, 9 ) ) (,

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1. NAD + -related genes expression in mouse tissues and in cells overexpressing NRK1. mrna (a) and protein (b) levels of NRK1, NRK2 and other enzymes involved

CHM Physical Chemistry I Chapter 1 - Supplementary Material

CHM 3410 - Physicl Chemistry I Chpter 1 - Supplementry Mteril For review of some bsic concepts in mth, see Atkins "Mthemticl Bckground 1 (pp 59-6), nd "Mthemticl Bckground " (pp 109-111). 1. Derivtion

Supplementary Figures

Electronic Supplementry Mteril (ESI) for Integrtie Biology. This journl is The Royl Society of Chemistry 214 Supplementry Figures CWound Are µm2 A EGTA Low Clcium 8 1 min. fter wounding Wound + 1 min.

Supplementary Figure 1. Markedly decreased numbers of marginal zone B cells in DOCK8 mutant mice Supplementary Figure 2.

Supplementary Figure 1. Markedly decreased numbers of marginal zone B cells in DOCK8 mutant mice. Percentage of marginal zone B cells in the spleen of wild-type mice (+/+), mice homozygous for cpm or pri

Student Activity 3: Single Factor ANOVA

MATH 40 Student Activity 3: Single Fctor ANOVA Some Bsic Concepts In designed experiment, two or more tretments, or combintions of tretments, is pplied to experimentl units The number of tretments, whether

Supplementary Information

Supplementry Informtion Lignd exchnge triggered controlled-relese trgeted drug delivery system sed on core shell superprmgnetic mesoporous microspheres cpped with nnoprticles Zhogng Teng, Xingng Zhu, Gengfeng

polyimide Spray-coated ZrP/epoxy film Spray-coated ZrP/epoxy film glass

c d e polyimide Spry-coted ZrP/epoxy film glss Spry-coted ZrP/epoxy film f g Supplementry Figure 1. Opticl microscopy of smectic ( = 0.044) α-zrp/epoxy films., Trnsmission opticl microscopy (TOM) of smectic

Supplemental Data. Perrella et al. (2013). Plant Cell /tpc

Intensity Intensity Intensity Intensity Intensity Intensity 150 50 150 0 10 20 50 C 150 0 10 20 50 D 0 10 20 Distance (μm) 50 20 40 E 50 F 0 10 20 50 0 15 30 Distance (μm) Supplemental Figure 1: Co-localization

Granulocytes Impose a Tight Bottleneck upon the Gut Luminal Pathogen Population during Salmonella Typhimurium Colitis

Granulocytes Impose a Tight Bottleneck upon the Gut Luminal Pathogen Population during Salmonella Typhimurium Colitis Lisa Maier 1,Médéric Diard 1, Mikael E. Sellin 1, Elsa-Sarah Chouffane 1, Kerstin Trautwein-Weidner

supplementary information

DOI:.38/nc293 KNL-3 knl- KBP- ZWL- knl- NDC-8 KLP-9 knl- KNL-3 NDC-8 knl-3 ndc-8 KLP-9 u- klp-9 ZWL- zwl- Figure S Locliztion of kinetochore proteins nd of KLP-9 on meiosis I spindles. Immunostining of

350 cutoff ln(growth-ratio) Rescuer candidates that localize to the plasma membrane. 1

DOI: 1.138/nc2444 Δdnf2 35 cutoff 3 25 # of strins 2 15 1 5-5 5 ln(growth-rtio) Rescuer cndidtes tht loclize to the plsm memrne. LEM3 THI73 PUN1 FUS1 ROD1 SSO1 SSO2 YPS1 PSR2 PMP3 YPS3 SNC2 LDB19 SUR7

Supplementary material

10.1071/FP11237_AC CSIRO 2012 Accessory Puliction: Functionl Plnt Biology 2012, 39(5), 379 393. Supplementry mteril Tle S1. Effect of wter regime nd genotype on different growth prmeters: spike dry mtter

supplementary information

DOI: 1.138/n2131 Protein levels (% of ) e Full-length protein remining (%) 1 5 1 5 1 1 5 5 Hs7 Syt1 Syt2 β-atin CSP +tsyn Hs7 Syt1 Syt2 P4 rin.1.1.1 1 [Trypsin] (g/l) f +tsyn SNARE-omplexes remining (%)

SUPPLEMENTARY INFORMATION

oi:1.138/nture1233 1.2 P=.7 P=.38 P=.44 e G1+G7 Single CD34 -Flk2 - LSK ells olonies Cre: (mt) + (pt) P=.18 Normlize expression.8.4 P=.4 LoxP: 36 p WT: 296 p G1+G l: 1.9 kp Cre: (mt) + (pt) Gtm Ospl H13

Correspondence should be addressed to Ulrike Lodemann;

Hindwi Meditors of Inflmmtion Volume 217, Article ID 2748192, 13 pges https://doi.org/1.1155/217/2748192 Reserch Article Altered Cytokine Expression nd Brrier Properties fter In Vitro Infection of Porcine

Tremor-rich shallow dyke formation followed by silent magma flow at Bárðarbunga in Iceland

In the formt provided y the uthors nd unedited. SUPPLEMENTARY INFORMATION DOI: 1.138/NGEO9 Tremor-rich shllow dyke formtion followed y silent mgm flow t Bárðrung in Icelnd 1,, 1, 3 1, 1 1, NATURE GEOSCIENCE

Ab1 (57-68) Ab2 ( ) Ab3 ( ) Ab4 ( ) GBP-N domain GBP-C domain CARD domain

MDKPVCLIDTGSDGKLCVQQAALQVLQQIQQPVVVVAVVGLYRTGKSFLMNRLAG 55 KRTGFALSSNIKPKTEGIWMWCVPHPTKAGTSLVLLDTKGLGDVEKGDSKRDTYI 110 FSLTVLLSSTLVYNSRGVIDNKAMEELQYVTELIEHIKVTPDEDADDCTAFAKFF 165 PHFIWCLRDFTLELKLDGKDLTEDEYLEFALKLRPGTLKKVMMYNLPRECIQKFF

Innate and Adaptive Immunity Interact to Quench Microbiome Flagellar Motility in the Gut

Article Innte nd Adptive Immunity Interct to Quench Microbiome Flgellr Motility in the Gut Tyler C. Cullender, 1,2 Benoit Chssing, 3 Anders Jnzon, 1,2 Krithik Kumr, 1,2 Ctherine E. Muller, 4 Jeffrey J.

Math 42 Chapter 7 Practice Problems Set B

Mth 42 Chpter 7 Prctice Problems Set B 1. Which of the following functions is solution of the differentil eqution dy dx = 4xy? () y = e 4x (c) y = e 2x2 (e) y = e 2x (g) y = 4e2x2 (b) y = 4x (d) y = 4x

A Brief Review on Akkar, Sandikkaya and Bommer (ASB13) GMPE

Southwestern U.S. Ground Motion Chrcteriztion Senior Seismic Hzrd Anlysis Committee Level 3 Workshop #2 October 22-24, 2013 A Brief Review on Akkr, Sndikky nd Bommer (ASB13 GMPE Sinn Akkr Deprtment of

Chapter 1. Basic Concepts

Socrtes Dilecticl Process: The Þrst step is the seprtion of subject into its elements. After this, by deþning nd discovering more bout its prts, one better comprehends the entire subject Socrtes (469-399)

The 1 th International and The 4 th National Congress on Recycling of Organic Waste in Agriculture April 2012 in Isfahan, Iran

The 1 th Interntionl nd The 4 th Ntionl Congress on The Effect of Prticle Size nd Composting Period on (C/N) Rtio of Dte- Plm Wste Min Mortzvi 1, Ahmd Mohmmdi Ghehsreh 2 nd Mhmoud Klsi 3 1. M.Sc. Student,

Chapter 4: Techniques of Circuit Analysis. Chapter 4: Techniques of Circuit Analysis

Chpter 4: Techniques of Circuit Anlysis Terminology Node-Voltge Method Introduction Dependent Sources Specil Cses Mesh-Current Method Introduction Dependent Sources Specil Cses Comprison of Methods Source

NK cells are part of the innate immune response. Early response to injury and infection

NK cells are part of the innate immune response Early response to injury and infection Functions: Natural Killer (NK) Cells. Cytolysis: killing infected or damaged cells 2. Cytokine production: IFNγ, GM-CSF,

LATE AND ABSENT HOMEWORK IS ACCEPTED UP TO THE TIME OF THE CHAPTER TEST ON HW NO. SECTIONS ASSIGNMENT DUE

Trig/Mth Anl Nme No LATE AND ABSENT HOMEWORK IS ACCEPTED UP TO THE TIME OF THE CHAPTER TEST ON HW NO. SECTIONS ASSIGNMENT DUE LG- 0-/0- Prctice Set E #,, 9,, 7,,, 9,, 7,,, 9, Prctice Set F #-9 odd Prctice

M e a n. F l u o r e s c e n c e I n t e n s i t y P r o t e i n ( p g / m L )

0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0. 0. 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P r o t e i n ( p g / m L ) 0. 0. 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P r o t e i n ( p g / m L ) Figure. Representative

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:138/nture123 Supplementry Discussion Chrcteriztion of ABI-PP s sustrte of efflux trnsporters. Among efflux trnsporter inhiitors, oligopeptide derivtives such s PAβN re exported

4.4 Areas, Integrals and Antiderivatives

. res, integrls nd ntiderivtives 333. Ares, Integrls nd Antiderivtives This section explores properties of functions defined s res nd exmines some connections mong res, integrls nd ntiderivtives. In order

10 Vector Integral Calculus

Vector Integrl lculus Vector integrl clculus extends integrls s known from clculus to integrls over curves ("line integrls"), surfces ("surfce integrls") nd solids ("volume integrls"). These integrls hve

Lecture INF4350 October 12008

Biosttistics ti ti Lecture INF4350 October 12008 Anj Bråthen Kristoffersen Biomedicl Reserch Group Deprtment of informtics, UiO Gol Presenttion of dt descriptive tbles nd grphs Sensitivity, specificity,

Haplotype Frequencies and Linkage Disequilibrium. Biostatistics 666

Hlotye Frequencies nd Linkge isequilirium iosttistics 666 Lst Lecture Genotye Frequencies llele Frequencies Phenotyes nd Penetrnces Hrdy-Weinerg Equilirium Simle demonstrtion Exercise: NO2 nd owel isese

Muscle and serum acylcarnitine profiles in dairy cows during the periparturient period

Muscle nd serum cylcrnitine profiles in diry cows during the periprturient period Y. Yng, 1 C. Prehn, 2 J. Admski, 2 J. Rehge, 3 S. Dänicke, 4 H. Suerwein, 1 H. Sdri 1 1 Institute of Animl Science, Physiology

Math 100 Review Sheet

Mth 100 Review Sheet Joseph H. Silvermn December 2010 This outline of Mth 100 is summry of the mteril covered in the course. It is designed to be study id, but it is only n outline nd should be used s

2 b. , a. area is S= 2π xds. Again, understand where these formulas came from (pages ).

AP Clculus BC Review Chpter 8 Prt nd Chpter 9 Things to Know nd Be Ale to Do Know everything from the first prt of Chpter 8 Given n integrnd figure out how to ntidifferentite it using ny of the following

Comparison Procedures

Comprison Procedures Single Fctor, Between-Subects Cse /8/ Comprison Procedures, One-Fctor ANOVA, Between Subects Two Comprison Strtegies post hoc (fter-the-fct) pproch You re interested in discovering

u( t) + K 2 ( ) = 1 t > 0 Analyzing Damped Oscillations Problem (Meador, example 2-18, pp 44-48): Determine the equation of the following graph.

nlyzing Dmped Oscilltions Prolem (Medor, exmple 2-18, pp 44-48): Determine the eqution of the following grph. The eqution is ssumed to e of the following form f ( t) = K 1 u( t) + K 2 e!"t sin (#t + $

z TRANSFORMS z Transform Basics z Transform Basics Transfer Functions Back to the Time Domain Transfer Function and Stability

TRASFORS Trnsform Bsics Trnsfer Functions Bck to the Time Domin Trnsfer Function nd Stility DSP-G 6. Trnsform Bsics The definition of the trnsform for digitl signl is: -n X x[ n is complex vrile The trnsform

The Atwood Machine OBJECTIVE INTRODUCTION APPARATUS THEORY

The Atwood Mchine OBJECTIVE To derive the ening of Newton's second lw of otion s it pplies to the Atwood chine. To explin how ss iblnce cn led to the ccelertion of the syste. To deterine the ccelertion

HIF-1 can act as a tumor suppressor gene in murine Acute Myeloid Leukemia.

HIF-1 can act as a tumor suppressor gene in murine Acute Myeloid Leukemia. Velasco, Talia; Hyrenius Wittsten, Axel; Rehn, Matilda; Bryder, David; Cammenga, Jörg Published in: Blood DOI: 1.1182/blood-14-4-56765

Colorimetric detection and separation of chiral tyrosine. based on N-acetyl-L-cysteine modified gold. nanoparticles

Colorimetric detection nd seprtion of chirl tyrosine sed on N-cetyl-L-cysteine modified gold nnoprticles Hiyn Su, Qiuling Zheng nd Hiing Li* Key Lortory of Pesticide nd Chemicl Biology (CCNU), Ministry

Silicon Nanowire Based Single-Molecule SERS Sensor

Supporting informtion Silicon Nnowire Bsed Single-Molecule SERS Sensor Hui Wng, Xuemei Hn, Xuemei Ou, Chun-Sing Lee, Xiohong Zhng* nd Shuit-Tong Lee S1, A series of Si nnowires coted with compct ggregtes

Enhanced zinc-finger-nuclease activity with improved obligate heterodimeric architectures

Nature Methods Enhanced zinc-finger-nuclease activity with improved obligate heterodimeric architectures Yannick Doyon, Thuy D Vo, Matthew C Mendel, Shon G Greenberg, Jianbin Wang, Danny F Xia, Jeffrey

Characterization of the Murine T-Lymphocyte Response to Salmonella enterica Serovar Typhimurium Infection

INFECTION AND IMMUNITY, Jan. 2002, p. 199 203 Vol. 70, No. 1 0019-9567/02/$04.00 0 DOI: 10.1128/IAI.70.1.199 203.2002 Copyright 2002, American Society for Microbiology. All Rights Reserved. Characterization

SUPPLEMENTARY INFORMATION

doi:3/nture5 Δp y Pr ric ol rb in * e c mrna fold chnge reltive to wild type in NHCl medi < / >6 Supplementl Figure. Glol nd pyrimidine-relted gene expression in ΔpyrI crb* strin.. Fold chnges of RNA trnscripts

Standardized and flexible eight colour flow cytometry panels harmonized between different. laboratories to study human NK cell phenotype and function

Standardized and flexible eight colour flow cytometry panels harmonized between different laboratories to study human NK cell phenotype and function John P Veluchamy 1,2, María Delso-Vallejo 3, Nina Kok

Fundamentals of Analytical Chemistry

Homework Fundmentls of nlyticl hemistry hpter 9 0, 1, 5, 7, 9 cids, Bses, nd hpter 9(b) Definitions cid Releses H ions in wter (rrhenius) Proton donor (Bronsted( Lowry) Electron-pir cceptor (Lewis) hrcteristic

DYNAMIC HARDNESS DURING DIFFERENT PHASES OF INDENTATION. Vytautas Vasauskas Kaunas University of Technology, Lithuania.

DYNAMIC HARDNESS DURING DIFFERENT PHASES OF INDENTATION ytuts susks Kuns University of Technology, Lithuni. Abstrct. The pper reports on the underlying concept for securing the mesuring bsis used in the

Supplementary Figure 1: To test the role of mir-17~92 in orthologous genetic model of ADPKD, we generated Ksp/Cre;Pkd1 F/F (Pkd1-KO) and Ksp/Cre;Pkd1

Supplementary Figure 1: To test the role of mir-17~92 in orthologous genetic model of ADPKD, we generated Ksp/Cre;Pkd1 F/F (Pkd1-KO) and Ksp/Cre;Pkd1 F/F ;mir-17~92 F/F (Pkd1-miR-17~92KO) mice. (A) Q-PCR

: IPREM/LCABIE, UMR VNRS Université de Pau et des Pays de l Adour (UPPA), F Pau Cedex 09 b. : CEA, DAM, DIF, F Arpajon, Cedex.

Are polytomic interferences, cross contmintion, mixing-effect, etc., ostcles for use of Lser ltion - ICP-MS coupling s n opertionl technique for urnium isotope rtio prticle nlysis? Arine DONARD,, Fien

Table S1. Sequence of primers used in RT-qPCR

Table S1. Sequence of primers used in RT-qPCR Primer Name P16Ink4a-F P16Ink4a-R P15Ink4b-F P15Ink4b-R P19Arf-F P19Arf-R P53-F P53-R P21cip1-F P21cip1-R P27kip1-F P27kip1-R P18Ink4c-F P18Ink4c-R P19Ink4d-F