SUPPLEMENTARY INFORMATION
|
|
- Barbra Charles
- 6 years ago
- Views:
Transcription
1 doi:1.138/nture11813 NK cells NKp46 + RORγt RORγt + ILCs SSC-A FSC-H Linege NKp NKp46 NKp46 + RORγt + ILCs NKp46 - RORγt + ILCs FSC-A FSC-A CD45 RORγt RORγt CCR6 + T-et - CCR6 - T-et +/- Supplementry Figure 1: Gting strtegy for intestinl RORγt + ILCs Lmin propri lymphocytes were stined nd nlyzed y flow cytometry. Gting ws performed on lymphocytes nd doulets were excluded. In the next step, non-hemtopoietic nd Lin + cells (CD3 + CD8α + CD19 + Gr-1 + ) were excluded. Lin - CD45 + cells were then nlyzed for the expression of RORγt nd NKp46 llowing for the discrimintion of the vrious ILC susets: NKp46 + RORγt - ( NK cells ), NKp46 + RORγt + ILCs nd NKp46 - RORγt + ILCs. RORγt + ILC susets were then further nlyzed for the expression of CCR6 nd T-et or other cell surfce mrkers. 1
2 RESEARCH SUPPLEMENTARY INFORMATION Eomes 61.3 RORγt 34.6 Supplementry Figure 2: RORγt + ILCs do not express Eomes Lin - CD45 + lmin propri lymphocytes cells were nlyzed for expression of Eomes nd RORγt y intrcellulr stining nd flow cytometry nlysis. 2
3 RESEARCH NKp46 + RORγt CD9 Sc Kit CD Reltive to Hprt1 1 5 Kit 2 1 Ccr6 RORγt + ILCs NKp46 + NKp46 - CD4 - CD4 + CCR6 - T-et + CCR6 + T-et - CCR CD CCR6.8 T-et 93.1 IL-12Rβ1.6.2 c Reltive to Hprt Tx Fsl.5.25 Prf Gzm.5.25 Cxcr Ccl Ccl4 RORγt + ILCs NKp46 + NKp46 - CD4 - CD4 + CCR6 - T-et + CCR6 + T-et - d 5 *** NKp46 + RORγt - 4 NKp46 + RORγt + T-et (MFI) 3 2 *** *** CCR6 - CCR6 + NKp46 - RORγt + 1 Supplementry Figure 3: T-et trget genes re expressed in T-et + RORγt + ILCs, Coexpression of T-et with the indicted cell surfce mrkers in NKp46 + RORγt + ILCs. Numers represent percentge of cells per qudrnt.,c, Expression of the indicted genes in highly purified susets of RORγt + ILCs s determined y qrt-pcr. d, Men fluoresecence intensity (MFI ± s.d.; n=7) of T-et in the indicted ILC susets. ***p <
4 RESEARCH SUPPLEMENTARY INFORMATION Reltive to Hprt1.2.1 Lt 2 1 Lt 1 5 Tnfsf14 (Light) RORγt + ILCs NKp46 + CCR6 - NKp46 - CD4 - CCR6 CD4 + + Reltive to Hprt Il22 Ifng Il17f Il17 c IL-22 + RORγt + ILCs (%) CCR6 + T-et - CCR6 - T-et Supplementry Figure 4: CCR6 + nd CCR6 - RORγt + ILCs express LTi genes nd IL-22,, Expression of the indicted genes in highly purified susets of RORγt + ILCs s determined y qrt-pcr. c, Percentge (men ± s.d.; n=3) of IL-22-expressing cells within the T-et - nd T-et + frctions of NKp46 - RORγt + ILCs. One representtive experiment of three is shown. 4
5 RESEARCH CD45.1 Tx21 +/+ CD45.1 Tx21+/+ c NKp46 + RORγt + ILCs (x1 4 ) 6 3 *** CD45.2 Tx21 +/ NKp CD45.2 Tx21 -/- CD CD NKp46 + cells mong CD45.2 RORγt + ILCs (%) 2 1 *** RORγt d e Tx21 +/+ Tx21 -/- RORγt + ILCs CCR6 - CCR6 + CXCR3 IL-12Rβ1 Tx21 +/+ Tx21 -/- IFN-γ TNF IL-17 IL CD25 Supplementry Figure 5: T-et regultes phenotype nd function of CCR6 - RORγt + ILCs, Asolute numers (men ± s.d.; n=12) of NKp46 + RORγt + ILCs in the smll intestine of Tx21 +/+ nd Tx21 -/- mice.,c, Groups (n=5) of lethlly irrdited C57BL/6 mice (CD45.2) were reconstituted either with mixed one mrrow (rtio 1:1) from wildtype (CD45.1) nd Tx21 +/+ mice (CD45.2) or wildtype (CD45.1) nd Tx21 -/- mice (CD45.2). After 8 weeks, NKp46 nd RORγt expression y CD nd CD cells within Lin - cells of the smll intestinl lmin propri ws nlyzed y flow cytometry. Numers represent percent of cells 5
6 RESEARCH SUPPLEMENTARY INFORMATION in the indicted gtes. A representtive dot plot () or percentge (men ± s.d.; n=5) of NKp46 + cells mong CD RORγt + ILCs (c) is shown. d, Flow cytometry nlysis of CXCR3 nd IL-12Rβ1 expression y CCR6 - or CCR6 + NKp46 - RORγt + ILCs from Tx21 +/+ or Tx21 -/- mice. Cxcr3 nd Il12r1 re cnonicl T-et trget genes. e, Lmin propri lymphocytes from Tx21 +/+ nd Tx21 -/- mice were incuted for 4h in medium contining PMA, ionomycin nd refeldin A. Expression of the indicted cytokines in NKp46 - RORγt + ILCs ws determined y intrcellulr cytokine stining nd flow cytometry nlysis. Numers represent percent cells in the indicted gtes. ***p <
7 RESEARCH Ki67 NKp46 - RORγt T-et 28. NKp46 + NKp46 + RORγt + RORγt Ki67 + cells (%) 2 1 CD4 + RORγt + *** *** CD4 - RORγt + NKp46 - RORγt + ** NKp46 + RORγt + NKp46 + RORγt - CCR6 + CCR6 - Supplementry Figure 6: CCR6 - RORγt + ILCs proliferte, Flow cytometry nlysis of Ki67 nd T-et expression y the indicted ILC susets in the lmin propri of the smll intestine of 8-week old mice. Numers represent percentge of cells per qudrnt., Percentge (men ± s.d.; n=5) of Ki67 + cells mong the indicted ILC susets. Dt shown re representtive of 5 independent experiments. **p <.1 nd ***p <
8 RESEARCH SUPPLEMENTARY INFORMATION CCR6 + RORγt + CCR6 + RORγt + ILCs CCR6 - RORγt + ILCs CD4 - CD CD4 - CD NKp46 - NKp NKp T-et T-et 21. RORγt Supplementry Figure 7: CCR6 + RORγt + ILCs constitute stle ILC linege, Highly purified CD4 - or CD4 + CCR6 + RORγt + ILCs isolted from Rorc(γt) GFP/+ mice (H-2 ) were doptively trnsferred into lymphoid BALB/c Rg2 -/- Il2rg -/- mice (H-2 d ). Three weeks fter doptive trnsfer, donor-derived cells were nlyzed for the expression of NKp46 nd T- et., The indicted highly purified RORγt + ILC popultions from Rorc(γt) GFP/+ mice were cultured in medium contining SCF, IL-7 nd IL-2. After 14 dys, cells were nlyzed for the expression of T-et nd RORγt (GFP) y flow cytometry. Numers represent percentge of cells in qudrnts. Dt re representtive of 3 independent experiments. 8
9 RESEARCH Tx21 +/+ Tx21 -/ NKp46 - RORγt + ILCs CCR6 + CCR6 - T-et + Kit CCR6 - CCR T-et Tx21 +/+ CCR6 - T-et - CCR6 + Tx21 -/- CD127 Kit Supplementry Figure 8: T-et represses Kit nd CD127 expression y RORγt + ILCs, Flow cytometry nlysis of Kit (top) nd CD127 (ottom) expression y NKp46 - CCR6 - RORγt + ILCs (CCR6 - ) nd NKp46 - CCR6 + RORγt + ILCs (CCR6 + ) from the smll intestine of Tx21 +/+ or Tx21 -/- mice., Flow cytometry nlysis of Kit expression y NKp46 - CCR6 - T-et + RORγt + ILCs (CCR6 - T-et + ), NKp46 - CCR6 - T-et - RORγt + ILCs (CCR6 - T-et - ) nd NKp46 - CCR6 + RORγt + ILCs (CCR6 + ) from the smll intestine of Tx21 +/+ or Tx21 -/- mice. Top pnel depicts the gting strtegy to identify the vrious susets of NKp46 - RORγt + ILCs. 9
10 RESEARCH SUPPLEMENTARY INFORMATION CCR6 Myd88 f/f T-et Myd88 ΔLTi,T CCR6 - T-et + cells (%) n.s. c CCR6 - T-et + cells (x 1 3 ) n.s. Myd88 f/f Myd88 ΔLTi,T Supplementry Figure 9: Genetic deletion of Myd88 in RORγt + ILCs does not interfere with the induction of T-et expression, Flow cytometry nlysis of T-et nd CCR6 expression y electroniclly gted NKp46 - RORγt + ILCs from the smll intestine of the indicted mouse strins., Percentge (men ± s.d.; n=3) of CCR6 - T-et + lymphocytes mong NKp46 - RORγt + ILCs from the indicted mouse strins. c, Asolute cell numers (men ± s.d.; n=3) of CCR6 - T-et + lymphocytes mong NKp46 - RORγt + ILCs. n.s., not significnt. 1
11 RESEARCH NKp46 Il12r2 +/ RORγt Il12r2 -/ CCR6 - T-et + cells (%) 5 25 n.s. Il12r2 +/+ Il12r2 -/- CCR T-et c NKp46 - NKp46 + NKp46 + RORγt + RORγt + RORγt - d NKp CCR Stt4 +/+ Stt4 -/- CCR6 - T-et + cells mong RORγt + ILC (%) n.s. Stt4 +/+ Stt4 -/- RORγt T-et e NKp46 + RORγt - cells (%) n.s. NKp46 + RORγt - cells (x1 3 ) n.s. Il23p19 +/+ Il23p19 -/- Supplementry Figure 1: STAT4 nd IL-12 signling re dispensle for the induction of T-et expression in CCR6 - RORγt + ILCs, Flow cytometry nlysis of NKp46 nd RORγt expression of Lin - lmin propri lymphocytes from the smll intestine of Il12r2 -/- or control mice (upper pnels). Numers represent percentge of cells in gtes or qudrnts. CCR6 nd T-et expression of electoniclly gted NKp46 - RORγt + ILCs is shown in the lower pnels., Percentge (men ± s.d.; n=5) of CCR6 - T-et + lymphocytes mong NKp46 - RORγt + ILCs from the indicted mouse strins. c, NKp46 - RORγt + ILCs (left) from Stt4 +/+ nd Stt4 -/- mice were nlyzed for 11
12 RESEARCH SUPPLEMENTARY INFORMATION CCR6 nd T-et expression (right). Numers represent percentge of cells in gtes (left) or per qudrnt (right). d, Percentge (men ± s.d.; n=3) of CCR6 - T-et + cells mong NKp46 - RORγt + ILCs in the lmin propri of the smll intestine of the indicted mouse strins. e, Percentge (men ± s.d.; n=3) nd solute numers (men ± s.d.; n=3) of NKp46 + RORγt - cells (i.e., NK cells ) from Il23p19 -/- nd control mice. Dt re representtive of three independent experiments. n.s., not significnt. 12
13 RESEARCH Il23 c Reltive to Hprt1 (x1-2 ) CD4 proximl T-et 14.4 middle distl T-et + mong RORγt + cells (%) 5 25 * * d NKp46 + RORγt + cells mong Lin - CD45 + cells (%) 2 1 *** * Supplementry Figure 11: T-et + RORγt + ILCs re etter represented in the distl prts of the smll intestine, Il23 expression in cells purified from the indicted prts of the smll intestine s determined y qrt-pcr., Flow cytometry nlysis of CD4 nd T-et expression y NKp46 - RORγt + ILCs isolted from the proximl, middle nd distl third of the smll intestine. Numers represent percentge of cells per qudrnt. c, Percentge (men ± s.d.; n=8) of T-et + cells within NKp46 - RORγt + ILCs in the proximl, middle nd distl third of the smll intestine. d, Percentge (men ± s.d., n=5) of NKp46 + RORγt + ILCs mong Lin - CD45 + cells of the proximl, middle nd distl prt (equl thirds) of the smll intestine. *p <.5 nd ***p <
14 RESEARCH SUPPLEMENTARY INFORMATION d IL-22 Tx21 +/+ Tx21 -/ IFN-γ Reltive to Hprt Reg3g n.s. c Body weight (%) Tx21 +/+ Tx21 -/ Dys post infection Mesenteric LN Spleen Liver Feces CFU/g Tx21 +/+ Tx21 -/- Supplementry Figure 12: Tx21 -/- mice control Citrocter rodentium infection, Lmin propri lymphocytes from Tx21 +/+ or Tx21 -/- mice were incuted for 4h in medium contining PMA, ionomycin nd refeldin A. IFN-γ nd IL-22 production y electroniclly gted RORγt + ILCs ws determined y flow cytometry. Numers represent percentge of cells per qudrnt., Reg3g expression y smll intestinl epithelil cells isolted from Tx21 +/+ or Tx21 -/- mice. c, Weight s the percentge (men ± s.d.; n=5) of ody weight t dy of C. rodentium infection. d, Bcteril titers per grm of indicted orgn eight dys fter infection with C. rodentium. Lines represent the men. n.s., not significnt. 14
15 RESEARCH Phylum Bcteroidetes Phylum Firmicutes Totl cteril lod Mouse intestinl Bcteroides Bcteroides species Lctocillus species Segmented filmentous cteri S rdna copies /ng DNA Tx21 +/+ Tx21 -/ Smll intestine Colon Enterococcus Enteroctericee Aneroes Bcteri /ng intestinl content Tx21 +/ Tx21 -/ Smll intestine Colon Supplementry Figure 13: Norml microiot in Tx21 -/- mice, Quntifiction of totl cteri lod or the indicted cteril species s mesured y 16S rdna qpcr., Quntifiction of the indicted cteril species y culture in the indicted orgns. 15
16 RESEARCH SUPPLEMENTARY INFORMATION Tnf c Reltive to Hprt n.s. Tx21 +/+ Tx21 -/ TNF TNF + mong colonic MHCII + CD11 + DC (%) n.s. Supplementry Figure 14: Norml TNF response in Tx21 -/- mice, Expression of Tnf in cells purified from the colon of Tx21 +/+ or Tx21 -/- mice s determined y qrt-pcr., TNF production y colonic myeloid cells (CD11 + MHCII + intestinl mononucler phgocytes) s determined y flow cytometry. c, Percentge (men ± s.d.; n=6) of TNF-producing cells mong CD11 + MHCII + intestinl mononucler phgocytes. n.s., not significnt. 16
17 RESEARCH c Infected IFN-γ + CD127 + mong NKp46 + cells (%) Shm Dy 2 Dy 4 Smll intestine Cecum Colon Tx21 +/+ Tx21 +/+ Tx21 -/- Infected Tx21 +/+ Tx21 +/+ Tx21 -/ IFN-γ CD127 d Body weight (%) Dys post infection Tx21 +/+ ** Tx21 -/- * e Tx21 +/+ Infected Tx21 +/+ Tx21 -/- f Cecum length (cm) ** Tx21 +/+ Tx21 +/+ Infected Tx21 -/- Supplementry Figure 15: IFN-γ-producing NKp46 + CCR6 - T-et + RORγt + ILCs control mucus relese nd inflmmtion following Slmonell infection, Groups of Rg2 -/- mice were infected with S. typhimurium. Control mice received only streptomycin tretment (shm tretment). Lmin propri lymphocytes from smll intestine, cecum nd colon were purified t the indicted time points nd incuted for 4h in medium contining refeldin A. Percentge (men ± s.d.; n=3) of IFN-γ-producing CD127 + cells mong NKp46 + cells ws determined y intrcellulr cytokine stining nd flow cytometry nlysis., Groups of mice from the indicted strins were infected with S. typhimurium. Two dys lter, lmin propri lymphocytes from the smll intestine were isolted nd 17
18 RESEARCH SUPPLEMENTARY INFORMATION incuted for 4h medium contining refeldin A nd IL-12 (1ng/ml). Expression of CD127 nd IFN-γ y electroniclly gted NKp46 + ILCs. One representtive experiment out of two experiments with 3-5 mice per group is shown. c, Top: Representtive photomicrogrphs of cecum of uninfected Tx21 +/+ mice or Tx21 +/+ nd Tx21 -/- mice 48h fter infection with S. typhimurium (r, 1 µm, mgnifiction, x1). Middle: Representtive photomicrogrphs showing the filure of Tx21 -/- mice to relese mucus from Golet cells fter infection with S. typhimurium (r, 1 µm). Bottom: Digitl mgnifiction of selected regions, rrows identify mucus-filled Golet cells in infected Tx21 -/- mice. d, Weight s the percentge (men ± s.d.; n=5) of ody weight t dy of S. typhimurium infection. e, Representtive pictures of cec from the indicted mouse strins 48h fter infection. f, Cecum length (men ± s.d.; n=5) 48h fter infection. *p <.5 nd **p <
19 RESEARCH Infected Rg2 -/- Rg2 -/- Rg2 -/- Rg2 -/- + α-silo-gm1 + α-thy-1 Rg2 -/- Il2rg -/- Dys post infection c Body weight (%) * -25 * -3 PBS α Thy1 α silo-gm1 Rg2 -/- Il2rg -/- Rg2 -/- PBS Rg2 -/- α-thy1 d 3.5 * ** e Cecum length (cm) Rg2 -/- 2-Rg2 -/- 3-Rg2 -/- α Thy1 4-Rg2 -/- α-silo-gm1 5 Rg2 -/- Il2rg -/- Infected Ifngr1 +/+ Ifngr1 -/ f g Body weight (%) Dys post infection 1 2 Ifngr1 +/+ Ifngr1 -/- * Cecum length (cm) *** Supplemetry Figure 16: Depletion of ILCs meliortes Slmonell-induced enterocolitis -d, Groups of Rg2 -/- or Rg2 -/- Il2rg -/- mice were infected with S. typhimurium (dy ) nd received the indicted depleting ntiodies t dy -2, dy nd dy +2. Control groups received injections of PBS. Representtive photomicrogrph of H&E stined cecum sections 19
20 RESEARCH SUPPLEMENTARY INFORMATION of the indicted mouse strins 96h fter infection (). Weight s the percentge (men ± s.d.; n=5) of ody weight t the dy of S. typhimurium infection (). Representtive pictures of cec from the indicted tretment groups 96h fter infection (c). Cecum length (men ± s.d.; n=5) 96h fter infection (d). e-g, Groups of Ifngr1 -/- nd control mice were infected with S. typhimurium. Representtive photomicrogrphs of H&E stined cec (e) of Ifngr1 +/+ nd Ifngr1 -/- mice 48h fter infection (r, 1 µm, mgnifiction, x1). Weight s the percentge (men ± s.d.; n=5) of ody weight t the dy of S. typhimurium infection (f). Cecum length (men ± s.d.; n=5) 48h fter infection (g). *p <.5; **p <.1 nd ***p <
21 RESEARCH T-et - CCR6 + (Fetl) CD4 + CD4 - NKp46 - Kit hi IL-17 IL-22 T-et - T-et + CCR6 - (Postntl) CD4 - NKp46 - NKp46 - Kit hi AhR Microiot Kit lo IL-23 T-et NKp46 + Kit lo IL-22 IFN-γ TNF Supplementry Figure 17: Model of RORγt + ILC lineges CCR6 + RORγt + ILCs seed the intestine efore irth nd express high levels of the receptor tyrosine kinse Kit. They re composed of CD4 + nd CD4 - suset nd they re potent producers of IL-22, IL17A nd IL-17F. CCR6 + RORγt + ILCs do not cquire NKp46 expression, do not express T-et nd their pool size is not sustntilly ffected y Ahr deficiency. CCR6 - RORγt + ILCs emerge postntlly (week 2 onwrds) s lrgely T-et - popultion. Expnsion of CCR6 - RORγt + ILCs requires AhR expression. CCR6 - RORγt + ILCs up-regulte T-et expression under the prtil control of signls from the commensl microiot nd IL-23. T-et represses Kit nd controls IFN-γ nd TNF expression. CCR6 - T- et + RORγt + ILCs differentite into NKp46 + cells, process strictly dependent on the presence of T-et. 21
Actinobacteria Relative abundance (%) Co-housed CD300f WT. CD300f KO. Colon length (cm) Day 9. Microscopic inflammation score
y groups y individuals 9 Actinobacteria Relative abundance (%) acteroidetes Cyanobacteria Deferribacteres Firmicutes Proteobacteria TM Tenericutes Unclassified CDf CDf Co-housed CDf Co-housed CDf CDf CDf
More informationSUPPLEMENTARY INFORMATION
SULEMENTARY INORMATION doi:1.138/nture1394 Trnsduced Mcrophges 293T-Nip trnsfectnts NAI2 N2 N5 5 Blot: Nip2 Blot: Nip5 N1 lg N6 5 c Blot: lg Blot: Nip6 Wild-type Legionell infection: fla Legionell infection:
More informationsupplementary information
DOI: 1.138/nc8 Top-GFP!-ctenin GFP Intensity 3 1 1 3 5 6 7 8 Nucler Bet-Ctenin c MUC FABP KRT 8 5 3 6 15 1 5 LGR5 ASCL AXIN 15 5 15 5 Figure S1 TOP-GFP expression nd reltion with nucler β-ctenin, wnt trgets
More informationFSC-W FSC-H CD4 CD62-L
Supplementary Fig. 1 a SSC-A FSC-A FSC-W FSC-H SSC-W SSC-H CD4 CD62-L b SSC-A FSC-A FSC-W FSC-A FSC-A 7-AAD FSC-A CD4 IL-9 CD4 c SSC-A FSC-A FSC-W FSC-H SSC-W SSC-H 7-AAD KI67 Annexin-V 7-AAD d I L -5
More informationSUPPLEMENTARY INFORMATION
doi:.38/nture8499 doi:.38/nture8499 5 6 5 4.5 Firing rte (Hz) -67-65 -66-6 -58 V m (mv) -7-67 -68-66 -64 c Thet power (mv ) -73-69 -7-7 -7.5.8 3....9.9.4.6.6. 9 8 9 8 9 8 9 8 9 8 Supplementry Figure Firing
More informationSUPPLEMENTARY INFORMATION
doi:1.138/nture11444 CMKIIN Gold prticles/ mitochondril re ( m ) 4 3 1 CMKIIN mtcmkiin mtcmkiin SERCA ATP synthse HA mitoplsts mtcmkiin CMKIIN cytosolic mtcmkiin CMKIIN 97 kdl 64 kdl 51 kdl 14 kdl 6 kdl
More informationVertical uniformity of cells and nuclei in epithelial monolayers
Supplementry informtion Verticl uniformity of cells nd nuclei in epithelil monolyers Srujn Neelm b, Peter Hyes, Qio Zhng, Richrd B. Dickinson nd Tnmy P. Lele, Figure S1. Histogrm plots compre the frequency
More informationSUPPLEMENTARY INFORMATION
doi:1.1/nture1 NF-κB/RE-GFP TNF-α pdna CA CA + DN d e NF-κB/RE-GFP GFP+DAPI NF-κB/RE-GFP GFP+DAPI NF-κB/RE-GFP GFP+DAPI V V DAPI DAPI NF-κB RE/GFP V V Mediosl hypothlmus Thlmus Cortex Suppl. Figure 1.
More informationSupplementary figure 1
Supplementry figure 1 Igf 1 mrna 5 15 1 5 Arg1 mrna 16 1 8 Col11 mrna 5 3 1 Mmp 13 mrna 15 1 5 Tslp mrna 3 1 Il5 mrna 3 1-1 Il33 mrna 6 Figure 1s. Kinetis of woun heling ftors n erly Th-type response ytokines
More informationSupporting Information. Cytosolic Irradiation of Femtosecond Laser Induces Mitochondria-dependent Apoptosis-like
Supporting Informtion Cytosolic Irrdition of Femtosecond Lser Induces Mitochondri-dependent Apoptosis-like Cell Deth vi Intrinsic Rective Oxygen Cscdes Jonghee Yoon 1,2, Seung-wook Ryu 1,3, Seunghee Lee
More informationSUPPLEMENTARY INFORMATION
GP2 Type I-piliated bacteria FAE M cell M cell pocket idc T cell mdc Generation of antigenspecific T cells Induction of antigen-specific mucosal immune response Supplementary Figure 1 Schematic diagram
More informationLung-residing myeloid-derived suppressors display dual functionality in murine. pulmonary tuberculosis
Lung-residing myeloid-derived suppressors display dual functionality in murine pulmonary tuberculosis Julia K. Knaul, Sabine Jörg, Dagmar Oberbeck-Mueller, Ellen Heinemann, Lisa Scheuermann, Volker Brinkmann,
More informationSUPPLEMENTARY FIGURES
A m ultory distnce (cm ) % C enter distnce C e n te r tim e (s ) A m ultory distnce (cm ) % C enter distnce C e n te r tim e (s ) N o v e l c g e % h o m e c g e c o n s u m p tio n % M ic e fe e d in
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11419 Supplementary Figure 1 Schematic representation of innate immune signaling pathways induced by intracellular Salmonella in cultured macrophages. a, During the infection Salmonella
More informationSUPPLEMENTARY INFORMATION
VOLUME: ARTICLE NUMBER: 3 In the formt provided y the uthors nd unedited. Developmentl constrints shpe the evolution of the nemtode mid-developmentl trnsition Hrel Zlts nd Iti Yni,3 Fculty of Biology,
More informationChanges in ph and microbial composition in the ruminal and reticular fluids of SARA cattle
66 th EAAP Annul Meeting (Wrsw, 215) Chnges in ph nd microil composition in the ruminl nd reticulr fluids of SARA cttle Shigeru SATO Coopertive Deprtment of Veterinry Medicine, Fculty of Agriculture, Iwte
More informationDOI:.8/nc5 Cpilities of MCAK Sidesliding, endctching on microtuules MCAKdecorted ed Functions in mitotic spindle Prometphse Slides on the microtuule surfce + Redily slides long the microtuule surfce Strongly
More informationTransient Stimulation of Distinct Subpopulations of Striatal Neurons Mimics Changes in the Value of Competing Actions
Supplementl mterils for: Trnsient Stimultion of Distinct Supopultions of Stritl Neurons Mimics Chnges in the Vlue of Competing Actions Lung-Ho Ti, A. Moses Lee,2, Nor Benvidez 3, Antonello Bonci 4,,6,
More informationTHE EFFECT OF GRADED DIETARY LEVELS OF VITAMIN A, GIVEN TO EARLY SEA BREAM (Sparus aurata) LARVAE ON SKELETAL DEFORMITIES AND GENOMIC EXPRESSION
THE EFFECT OF GRADED DIETARY LEVELS OF VITAMIN A, GIVEN TO EARLY SEA BREAM (Sprus urt) LARVAE ON SKELETAL DEFORMITIES AND GENOMIC EXPRESSION B. Ginzourg, W.M. Koven, S. Fontgne, A. Sgi, D. M. Power nd
More informationSUPPLEMENTARY INFORMATION
Metal nanoparticles in the presence of lipopolysaccharides trigger the onset of metal allergy in mice Toshiro Hirai, Yasuo Yoshioka, Natsumi Izumi, Ko-ichi Ichihashi, Takayuki Handa, Nobuo Nishijima, Eiichiro
More informationdsrna GFP 0 Ca 0 Ca 0 Ca TG Iono Time (s)
Rtio (FL1/FL3) MFI dsrna GFP C dsrna dori C 1 2 1 2 Rtio (FL1/FL3) MFI C 1 2 Rtio (FL1/FL3) MFI C 1 2 C 1 2 C 1 2 Supplementry Figure 1. RNAi-medited depletion of dori hs no effet on the filling stte of
More informationSUPPLEMENTARY INFORMATION
DOI: 1.138/nc2975 GM13 / DNA F-ctin α shrna CLASP1 shrna shrna shrna CLASP1 shrna shrna e Tuulin CLASP1 CLASP1 shrna #32 shrna #33 #55 #58 Tuulin c Tuulin ppmlc E-Cdherin shrna CLASP1 shrna shrna f Golgi
More informationDiverse modes of eco-evolutionary dynamics in communities of antibiotic-producing microorganisms
In the formt provided y the uthors nd unedited. ULEMENTAY INFOMATION VOLUME: 1 ATICLE NUMBE: 0189 iverse modes of eco-evolutionry dynmics in communities of ntiiotic-producing microorgnisms Klin Vetsigin
More informationControl NaCl ABA * * Control 4ºC 37ºC
Dul regultion of wter retention nd cell growth y stress-ssocited protein (SAP) gene in Prunus A. Lloret, A. Conejero, C. Leid, C. Petri, F. Gil-Muñoz, L. Burgos, M.L. Bdenes, nd G. Ríos.5 PpSAP Reltive
More informationPartial Derivatives. Limits. For a single variable function f (x), the limit lim
Limits Prtil Derivtives For single vrible function f (x), the limit lim x f (x) exists only if the right-hnd side limit equls to the left-hnd side limit, i.e., lim f (x) = lim f (x). x x + For two vribles
More informationTests for the Ratio of Two Poisson Rates
Chpter 437 Tests for the Rtio of Two Poisson Rtes Introduction The Poisson probbility lw gives the probbility distribution of the number of events occurring in specified intervl of time or spce. The Poisson
More informationChapter 9: Inferences based on Two samples: Confidence intervals and tests of hypotheses
Chpter 9: Inferences bsed on Two smples: Confidence intervls nd tests of hypotheses 9.1 The trget prmeter : difference between two popultion mens : difference between two popultion proportions : rtio of
More informationFirst Semester Review Calculus BC
First Semester Review lculus. Wht is the coordinte of the point of inflection on the grph of Multiple hoice: No lcultor y 3 3 5 4? 5 0 0 3 5 0. The grph of piecewise-liner function f, for 4, is shown below.
More informationSupplementary Information
Supplementry Informtion Coopertion of locl motions in the Hsp90 moleculr chperone ATPse mechnism Andre Schulze 1, Gerti Beliu 1, Dominic A. Helmerich 1, Jonthn Schubert 1, Lurence H. Perl 2, Chrisostomos
More informationSUPPLEMENTARY INFORMATION. For
Eletroni Supplementry Mteril (ESI) for Journl of Mterils Chemistry B. This journl is The Royl Soiety of Chemistry 217 SUPPLEMETARY IFRMATI For Phyoynin-bsed nnorrier s new nnopltform for effiient overoming
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature14242 Supplementary Methods Mathematical modelling Hematopoietic fluxes. Consider two successive cell compartments in hematopoiesis, an upstream and a reference
More information1,6. Tu18 1,2 0,8 0,4 0,0. Tu29. >10x down * 1,6. Tu43 1,2 0,8 0,4 0,0 8 0,0 1,6. Tu80 0,8 0,4 0,0
Reltive expression Tu14,9,6,3 2, Tu16 1,5 1,,5 Tu18,4 3 2 1 Tu19 >1x down * Reltive expression 3,2 Tu23 2,4 3 25 2 15 1 5 Tu28 >1x down * 4 Tu29 3 2 1 Tu31,9,6,3 Tu32 3,2 Tu33 Tu43 Tu57 Reltive expression
More information3.94 ± 0.50 (95% CI) Correlative inhibition index (slope)
Supplementl Tle S. Selected rchitecturl prmeters of phy nd phyphy grown under. Vlues re mens ± SE, except for predicted primry rosette rnches where the vlues re the men with the ssocited 9% confidence
More informationSUPPLEMENTARY INFORMATION
doi:.38/nture896 c Resting stte Resting stte Resting stte Supplementry Figure Illustrtion of pttern clssifiction nd its effects on neuronl representtions. Dynmic ctivity ptterns evoked y different stimuli
More informationNature Biotechnology: doi: /nbt Supplementary Figure 1. The inflammatory response in the mammalian gut leads to tetrathionate generation.
Supplementary Figure 1 The inflammatory response in the mammalian gut leads to tetrathionate generation. Cytokine signaling following an inflammatory insult leads to, among other responses, release of
More informationResearch Article. EFFECT OF ph ON BIOFILM FORMATION AND MOTILITIES OF Pseudomonas aeruginosa, Escherichia coli AND Staphylococcus aureus ATCC STRAINS
BMR Microiology www.dvncejournls.org Open ccess Scientific Pulisher Reserch rticle EFFECT OF ph ON BIOFILM FORMTION ND MOTILITIES OF Pseudomons eruginos, Escherichi coli ND Stphylococcus ureus TCC STRINS
More informationPopulation Dynamics Definition Model A model is defined as a physical representation of any natural phenomena Example: 1. A miniature building model.
Popultion Dynmics Definition Model A model is defined s physicl representtion of ny nturl phenomen Exmple: 1. A miniture building model. 2. A children cycle prk depicting the trffic signls 3. Disply of
More informationSupplementary Figure 1 Supplementary Figure 2
Supplementry Figure 1 Comprtive illustrtion of the steps required to decorte n oxide support AO with ctlyst prticles M through chemicl infiltrtion or in situ redox exsolution. () chemicl infiltrtion usully
More informationJEE(MAIN) 2015 TEST PAPER WITH SOLUTION (HELD ON SATURDAY 04 th APRIL, 2015) PART B MATHEMATICS
JEE(MAIN) 05 TEST PAPER WITH SOLUTION (HELD ON SATURDAY 0 th APRIL, 05) PART B MATHEMATICS CODE-D. Let, b nd c be three non-zero vectors such tht no two of them re colliner nd, b c b c. If is the ngle
More informationNature Biotechnology: doi: /nbt Supplementary Figure 1. Generation of paraxial mesoderm from the H7 hesc line.
Supplementary Figure 1 Generation of paraxial mesoderm from the H7 hesc line. H7 hescs were differentiated as shown in Figure 1a. (a) Flow cytometric analyses of the proportion of CD56+, PDGFRα+, and KDR+
More information8 Laplace s Method and Local Limit Theorems
8 Lplce s Method nd Locl Limit Theorems 8. Fourier Anlysis in Higher DImensions Most of the theorems of Fourier nlysis tht we hve proved hve nturl generliztions to higher dimensions, nd these cn be proved
More informationA population-based temporal logic gate for timing and recording chemical events
Pulished online: My 7, Article A popultion-sed temporl logic gte for timing nd recording chemicl events Victori Hsio,*, Yutk Hori, Pul WK Rothemund & Richrd M Murry Astrct Engineered cteril sensors hve
More information7.1 Integral as Net Change and 7.2 Areas in the Plane Calculus
7.1 Integrl s Net Chnge nd 7. Ares in the Plne Clculus 7.1 INTEGRAL AS NET CHANGE Notecrds from 7.1: Displcement vs Totl Distnce, Integrl s Net Chnge We hve lredy seen how the position of n oject cn e
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature09414 Supplementary Figure 1 FACS-isolated 8c hepatocytes are highly pure. a, Gating strategy for identifying hepatocyte populations based on DNA content. b, Detection of mchry and mchr9
More informationMath 259 Winter Solutions to Homework #9
Mth 59 Winter 9 Solutions to Homework #9 Prolems from Pges 658-659 (Section.8). Given f(, y, z) = + y + z nd the constrint g(, y, z) = + y + z =, the three equtions tht we get y setting up the Lgrnge multiplier
More informationStrategy: Use the Gibbs phase rule (Equation 5.3). How many components are present?
University Chemistry Quiz 4 2014/12/11 1. (5%) Wht is the dimensionlity of the three-phse coexistence region in mixture of Al, Ni, nd Cu? Wht type of geometricl region dose this define? Strtegy: Use the
More informationCS-E5880 Modeling biological networks Parameter estimation for biological networks
CS-E5880 Modeling biological networks Parameter estimation for biological networks Jukka Intosalmi Department of Computer Science Aalto University January 16, 2018 Outline ODE model calibration as an optimization
More informationSupplementary Information
Supplementry Informtion Spontneously mplified homochirl orgnic-inorgnic nno-helix complex vi self-prolifertion Hlei Zhi, Yn Qun, Li Li, Xing-Yng Liu, Xurong Xu c nd Ruikng Tng*,c Centre for Biomterils
More informationState space systems analysis (continued) Stability. A. Definitions A system is said to be Asymptotically Stable (AS) when it satisfies
Stte spce systems nlysis (continued) Stbility A. Definitions A system is sid to be Asymptoticlly Stble (AS) when it stisfies ut () = 0, t > 0 lim xt () 0. t A system is AS if nd only if the impulse response
More informationAlg. Sheet (1) Department : Math Form : 3 rd prep. Sheet
Ciro Governorte Nozh Directorte of Eduction Nozh Lnguge Schools Ismili Rod Deprtment : Mth Form : rd prep. Sheet Alg. Sheet () [] Find the vlues of nd in ech of the following if : ) (, ) ( -5, 9 ) ) (,
More informationSupplementary Figure 1
Supplementary Figure 1 Supplementary Figure 1. NAD + -related genes expression in mouse tissues and in cells overexpressing NRK1. mrna (a) and protein (b) levels of NRK1, NRK2 and other enzymes involved
More informationCHM Physical Chemistry I Chapter 1 - Supplementary Material
CHM 3410 - Physicl Chemistry I Chpter 1 - Supplementry Mteril For review of some bsic concepts in mth, see Atkins "Mthemticl Bckground 1 (pp 59-6), nd "Mthemticl Bckground " (pp 109-111). 1. Derivtion
More informationSupplementary Figures
Electronic Supplementry Mteril (ESI) for Integrtie Biology. This journl is The Royl Society of Chemistry 214 Supplementry Figures CWound Are µm2 A EGTA Low Clcium 8 1 min. fter wounding Wound + 1 min.
More informationSupplementary Figure 1. Markedly decreased numbers of marginal zone B cells in DOCK8 mutant mice Supplementary Figure 2.
Supplementary Figure 1. Markedly decreased numbers of marginal zone B cells in DOCK8 mutant mice. Percentage of marginal zone B cells in the spleen of wild-type mice (+/+), mice homozygous for cpm or pri
More informationStudent Activity 3: Single Factor ANOVA
MATH 40 Student Activity 3: Single Fctor ANOVA Some Bsic Concepts In designed experiment, two or more tretments, or combintions of tretments, is pplied to experimentl units The number of tretments, whether
More informationSupplementary Information
Supplementry Informtion Lignd exchnge triggered controlled-relese trgeted drug delivery system sed on core shell superprmgnetic mesoporous microspheres cpped with nnoprticles Zhogng Teng, Xingng Zhu, Gengfeng
More informationpolyimide Spray-coated ZrP/epoxy film Spray-coated ZrP/epoxy film glass
c d e polyimide Spry-coted ZrP/epoxy film glss Spry-coted ZrP/epoxy film f g Supplementry Figure 1. Opticl microscopy of smectic ( = 0.044) α-zrp/epoxy films., Trnsmission opticl microscopy (TOM) of smectic
More informationSupplemental Data. Perrella et al. (2013). Plant Cell /tpc
Intensity Intensity Intensity Intensity Intensity Intensity 150 50 150 0 10 20 50 C 150 0 10 20 50 D 0 10 20 Distance (μm) 50 20 40 E 50 F 0 10 20 50 0 15 30 Distance (μm) Supplemental Figure 1: Co-localization
More informationGranulocytes Impose a Tight Bottleneck upon the Gut Luminal Pathogen Population during Salmonella Typhimurium Colitis
Granulocytes Impose a Tight Bottleneck upon the Gut Luminal Pathogen Population during Salmonella Typhimurium Colitis Lisa Maier 1,Médéric Diard 1, Mikael E. Sellin 1, Elsa-Sarah Chouffane 1, Kerstin Trautwein-Weidner
More informationsupplementary information
DOI:.38/nc293 KNL-3 knl- KBP- ZWL- knl- NDC-8 KLP-9 knl- KNL-3 NDC-8 knl-3 ndc-8 KLP-9 u- klp-9 ZWL- zwl- Figure S Locliztion of kinetochore proteins nd of KLP-9 on meiosis I spindles. Immunostining of
More information350 cutoff ln(growth-ratio) Rescuer candidates that localize to the plasma membrane. 1
DOI: 1.138/nc2444 Δdnf2 35 cutoff 3 25 # of strins 2 15 1 5-5 5 ln(growth-rtio) Rescuer cndidtes tht loclize to the plsm memrne. LEM3 THI73 PUN1 FUS1 ROD1 SSO1 SSO2 YPS1 PSR2 PMP3 YPS3 SNC2 LDB19 SUR7
More informationSupplementary material
10.1071/FP11237_AC CSIRO 2012 Accessory Puliction: Functionl Plnt Biology 2012, 39(5), 379 393. Supplementry mteril Tle S1. Effect of wter regime nd genotype on different growth prmeters: spike dry mtter
More informationsupplementary information
DOI: 1.138/n2131 Protein levels (% of ) e Full-length protein remining (%) 1 5 1 5 1 1 5 5 Hs7 Syt1 Syt2 β-atin CSP +tsyn Hs7 Syt1 Syt2 P4 rin.1.1.1 1 [Trypsin] (g/l) f +tsyn SNARE-omplexes remining (%)
More informationSUPPLEMENTARY INFORMATION
oi:1.138/nture1233 1.2 P=.7 P=.38 P=.44 e G1+G7 Single CD34 -Flk2 - LSK ells olonies Cre: (mt) + (pt) P=.18 Normlize expression.8.4 P=.4 LoxP: 36 p WT: 296 p G1+G l: 1.9 kp Cre: (mt) + (pt) Gtm Ospl H13
More informationCorrespondence should be addressed to Ulrike Lodemann;
Hindwi Meditors of Inflmmtion Volume 217, Article ID 2748192, 13 pges https://doi.org/1.1155/217/2748192 Reserch Article Altered Cytokine Expression nd Brrier Properties fter In Vitro Infection of Porcine
More informationTremor-rich shallow dyke formation followed by silent magma flow at Bárðarbunga in Iceland
In the formt provided y the uthors nd unedited. SUPPLEMENTARY INFORMATION DOI: 1.138/NGEO9 Tremor-rich shllow dyke formtion followed y silent mgm flow t Bárðrung in Icelnd 1,, 1, 3 1, 1 1, NATURE GEOSCIENCE
More informationAb1 (57-68) Ab2 ( ) Ab3 ( ) Ab4 ( ) GBP-N domain GBP-C domain CARD domain
MDKPVCLIDTGSDGKLCVQQAALQVLQQIQQPVVVVAVVGLYRTGKSFLMNRLAG 55 KRTGFALSSNIKPKTEGIWMWCVPHPTKAGTSLVLLDTKGLGDVEKGDSKRDTYI 110 FSLTVLLSSTLVYNSRGVIDNKAMEELQYVTELIEHIKVTPDEDADDCTAFAKFF 165 PHFIWCLRDFTLELKLDGKDLTEDEYLEFALKLRPGTLKKVMMYNLPRECIQKFF
More informationInnate and Adaptive Immunity Interact to Quench Microbiome Flagellar Motility in the Gut
Article Innte nd Adptive Immunity Interct to Quench Microbiome Flgellr Motility in the Gut Tyler C. Cullender, 1,2 Benoit Chssing, 3 Anders Jnzon, 1,2 Krithik Kumr, 1,2 Ctherine E. Muller, 4 Jeffrey J.
More informationMath 42 Chapter 7 Practice Problems Set B
Mth 42 Chpter 7 Prctice Problems Set B 1. Which of the following functions is solution of the differentil eqution dy dx = 4xy? () y = e 4x (c) y = e 2x2 (e) y = e 2x (g) y = 4e2x2 (b) y = 4x (d) y = 4x
More informationA Brief Review on Akkar, Sandikkaya and Bommer (ASB13) GMPE
Southwestern U.S. Ground Motion Chrcteriztion Senior Seismic Hzrd Anlysis Committee Level 3 Workshop #2 October 22-24, 2013 A Brief Review on Akkr, Sndikky nd Bommer (ASB13 GMPE Sinn Akkr Deprtment of
More informationChapter 1. Basic Concepts
Socrtes Dilecticl Process: The Þrst step is the seprtion of subject into its elements. After this, by deþning nd discovering more bout its prts, one better comprehends the entire subject Socrtes (469-399)
More informationThe 1 th International and The 4 th National Congress on Recycling of Organic Waste in Agriculture April 2012 in Isfahan, Iran
The 1 th Interntionl nd The 4 th Ntionl Congress on The Effect of Prticle Size nd Composting Period on (C/N) Rtio of Dte- Plm Wste Min Mortzvi 1, Ahmd Mohmmdi Ghehsreh 2 nd Mhmoud Klsi 3 1. M.Sc. Student,
More informationChapter 4: Techniques of Circuit Analysis. Chapter 4: Techniques of Circuit Analysis
Chpter 4: Techniques of Circuit Anlysis Terminology Node-Voltge Method Introduction Dependent Sources Specil Cses Mesh-Current Method Introduction Dependent Sources Specil Cses Comprison of Methods Source
More informationNK cells are part of the innate immune response. Early response to injury and infection
NK cells are part of the innate immune response Early response to injury and infection Functions: Natural Killer (NK) Cells. Cytolysis: killing infected or damaged cells 2. Cytokine production: IFNγ, GM-CSF,
More informationLATE AND ABSENT HOMEWORK IS ACCEPTED UP TO THE TIME OF THE CHAPTER TEST ON HW NO. SECTIONS ASSIGNMENT DUE
Trig/Mth Anl Nme No LATE AND ABSENT HOMEWORK IS ACCEPTED UP TO THE TIME OF THE CHAPTER TEST ON HW NO. SECTIONS ASSIGNMENT DUE LG- 0-/0- Prctice Set E #,, 9,, 7,,, 9,, 7,,, 9, Prctice Set F #-9 odd Prctice
More informationM e a n. F l u o r e s c e n c e I n t e n s i t y P r o t e i n ( p g / m L )
0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0. 0. 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P r o t e i n ( p g / m L ) 0. 0. 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P r o t e i n ( p g / m L ) Figure. Representative
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:138/nture123 Supplementry Discussion Chrcteriztion of ABI-PP s sustrte of efflux trnsporters. Among efflux trnsporter inhiitors, oligopeptide derivtives such s PAβN re exported
More information4.4 Areas, Integrals and Antiderivatives
. res, integrls nd ntiderivtives 333. Ares, Integrls nd Antiderivtives This section explores properties of functions defined s res nd exmines some connections mong res, integrls nd ntiderivtives. In order
More information10 Vector Integral Calculus
Vector Integrl lculus Vector integrl clculus extends integrls s known from clculus to integrls over curves ("line integrls"), surfces ("surfce integrls") nd solids ("volume integrls"). These integrls hve
More informationLecture INF4350 October 12008
Biosttistics ti ti Lecture INF4350 October 12008 Anj Bråthen Kristoffersen Biomedicl Reserch Group Deprtment of informtics, UiO Gol Presenttion of dt descriptive tbles nd grphs Sensitivity, specificity,
More informationHaplotype Frequencies and Linkage Disequilibrium. Biostatistics 666
Hlotye Frequencies nd Linkge isequilirium iosttistics 666 Lst Lecture Genotye Frequencies llele Frequencies Phenotyes nd Penetrnces Hrdy-Weinerg Equilirium Simle demonstrtion Exercise: NO2 nd owel isese
More informationMuscle and serum acylcarnitine profiles in dairy cows during the periparturient period
Muscle nd serum cylcrnitine profiles in diry cows during the periprturient period Y. Yng, 1 C. Prehn, 2 J. Admski, 2 J. Rehge, 3 S. Dänicke, 4 H. Suerwein, 1 H. Sdri 1 1 Institute of Animl Science, Physiology
More informationMath 100 Review Sheet
Mth 100 Review Sheet Joseph H. Silvermn December 2010 This outline of Mth 100 is summry of the mteril covered in the course. It is designed to be study id, but it is only n outline nd should be used s
More information2 b. , a. area is S= 2π xds. Again, understand where these formulas came from (pages ).
AP Clculus BC Review Chpter 8 Prt nd Chpter 9 Things to Know nd Be Ale to Do Know everything from the first prt of Chpter 8 Given n integrnd figure out how to ntidifferentite it using ny of the following
More informationComparison Procedures
Comprison Procedures Single Fctor, Between-Subects Cse /8/ Comprison Procedures, One-Fctor ANOVA, Between Subects Two Comprison Strtegies post hoc (fter-the-fct) pproch You re interested in discovering
More informationu( t) + K 2 ( ) = 1 t > 0 Analyzing Damped Oscillations Problem (Meador, example 2-18, pp 44-48): Determine the equation of the following graph.
nlyzing Dmped Oscilltions Prolem (Medor, exmple 2-18, pp 44-48): Determine the eqution of the following grph. The eqution is ssumed to e of the following form f ( t) = K 1 u( t) + K 2 e!"t sin (#t + $
More informationz TRANSFORMS z Transform Basics z Transform Basics Transfer Functions Back to the Time Domain Transfer Function and Stability
TRASFORS Trnsform Bsics Trnsfer Functions Bck to the Time Domin Trnsfer Function nd Stility DSP-G 6. Trnsform Bsics The definition of the trnsform for digitl signl is: -n X x[ n is complex vrile The trnsform
More informationThe Atwood Machine OBJECTIVE INTRODUCTION APPARATUS THEORY
The Atwood Mchine OBJECTIVE To derive the ening of Newton's second lw of otion s it pplies to the Atwood chine. To explin how ss iblnce cn led to the ccelertion of the syste. To deterine the ccelertion
More informationHIF-1 can act as a tumor suppressor gene in murine Acute Myeloid Leukemia.
HIF-1 can act as a tumor suppressor gene in murine Acute Myeloid Leukemia. Velasco, Talia; Hyrenius Wittsten, Axel; Rehn, Matilda; Bryder, David; Cammenga, Jörg Published in: Blood DOI: 1.1182/blood-14-4-56765
More informationColorimetric detection and separation of chiral tyrosine. based on N-acetyl-L-cysteine modified gold. nanoparticles
Colorimetric detection nd seprtion of chirl tyrosine sed on N-cetyl-L-cysteine modified gold nnoprticles Hiyn Su, Qiuling Zheng nd Hiing Li* Key Lortory of Pesticide nd Chemicl Biology (CCNU), Ministry
More informationSilicon Nanowire Based Single-Molecule SERS Sensor
Supporting informtion Silicon Nnowire Bsed Single-Molecule SERS Sensor Hui Wng, Xuemei Hn, Xuemei Ou, Chun-Sing Lee, Xiohong Zhng* nd Shuit-Tong Lee S1, A series of Si nnowires coted with compct ggregtes
More informationEnhanced zinc-finger-nuclease activity with improved obligate heterodimeric architectures
Nature Methods Enhanced zinc-finger-nuclease activity with improved obligate heterodimeric architectures Yannick Doyon, Thuy D Vo, Matthew C Mendel, Shon G Greenberg, Jianbin Wang, Danny F Xia, Jeffrey
More informationCharacterization of the Murine T-Lymphocyte Response to Salmonella enterica Serovar Typhimurium Infection
INFECTION AND IMMUNITY, Jan. 2002, p. 199 203 Vol. 70, No. 1 0019-9567/02/$04.00 0 DOI: 10.1128/IAI.70.1.199 203.2002 Copyright 2002, American Society for Microbiology. All Rights Reserved. Characterization
More informationSUPPLEMENTARY INFORMATION
doi:3/nture5 Δp y Pr ric ol rb in * e c mrna fold chnge reltive to wild type in NHCl medi < / >6 Supplementl Figure. Glol nd pyrimidine-relted gene expression in ΔpyrI crb* strin.. Fold chnges of RNA trnscripts
More informationStandardized and flexible eight colour flow cytometry panels harmonized between different. laboratories to study human NK cell phenotype and function
Standardized and flexible eight colour flow cytometry panels harmonized between different laboratories to study human NK cell phenotype and function John P Veluchamy 1,2, María Delso-Vallejo 3, Nina Kok
More informationFundamentals of Analytical Chemistry
Homework Fundmentls of nlyticl hemistry hpter 9 0, 1, 5, 7, 9 cids, Bses, nd hpter 9(b) Definitions cid Releses H ions in wter (rrhenius) Proton donor (Bronsted( Lowry) Electron-pir cceptor (Lewis) hrcteristic
More informationDYNAMIC HARDNESS DURING DIFFERENT PHASES OF INDENTATION. Vytautas Vasauskas Kaunas University of Technology, Lithuania.
DYNAMIC HARDNESS DURING DIFFERENT PHASES OF INDENTATION ytuts susks Kuns University of Technology, Lithuni. Abstrct. The pper reports on the underlying concept for securing the mesuring bsis used in the
More informationSupplementary Figure 1: To test the role of mir-17~92 in orthologous genetic model of ADPKD, we generated Ksp/Cre;Pkd1 F/F (Pkd1-KO) and Ksp/Cre;Pkd1
Supplementary Figure 1: To test the role of mir-17~92 in orthologous genetic model of ADPKD, we generated Ksp/Cre;Pkd1 F/F (Pkd1-KO) and Ksp/Cre;Pkd1 F/F ;mir-17~92 F/F (Pkd1-miR-17~92KO) mice. (A) Q-PCR
More information: IPREM/LCABIE, UMR VNRS Université de Pau et des Pays de l Adour (UPPA), F Pau Cedex 09 b. : CEA, DAM, DIF, F Arpajon, Cedex.
Are polytomic interferences, cross contmintion, mixing-effect, etc., ostcles for use of Lser ltion - ICP-MS coupling s n opertionl technique for urnium isotope rtio prticle nlysis? Arine DONARD,, Fien
More informationTable S1. Sequence of primers used in RT-qPCR
Table S1. Sequence of primers used in RT-qPCR Primer Name P16Ink4a-F P16Ink4a-R P15Ink4b-F P15Ink4b-R P19Arf-F P19Arf-R P53-F P53-R P21cip1-F P21cip1-R P27kip1-F P27kip1-R P18Ink4c-F P18Ink4c-R P19Ink4d-F
More information