Cyclin-Dependent Kinase
|
|
- Martina Newman
- 6 years ago
- Views:
Transcription
1 Cyclin-Dependent Kinase (At a glance) Cory Camasta
2 Cyclin-Dependent Kinase Family E.C: = Transferase 2.7 = Transfer of phosphate group = Serine/Threonine Kinase = Cyclin-dependent ser/thr kinase Also known as: Cell Division Protein Kinase Major function: Phosphorylates cell-division and other regulatory proteins in presence of cyclin Aspartate is the catalytic residue Typical phosphorylation sequence: [Ser/Thr]* Pro X [Lys/Arg] Threonine or Serine covalently hold phosphate groups (modified to phosphothreonine/phosphoserine) Three universally-conserved sequences: Interaction Helix (PSTAIRE / α1 helix) binds cyclin T-Loop (Activation Loop) flexible loop region that blocks the active site cleft when unbound contains a Threonine that is phosphorylated to yield activation L12 Helix directly adjacent to T-loop upon cyclin binding, changes its conformation to a sheet and allows T-loop to move out of active site cleft CDK7, CDK8, and CDK9 phosphorylate Serines at C-terminus of RNA Polymerase II CDK7 also phosphorylates (thus activating) CDK1 and CDK2 at the T-loops CDK5 regulates phosphin-related endocytosis, is involved in neuregulin modulation, and has some functions in gene expression and maybe cellular differentiation CDK2 phosphorylates estrogen receptors, histones (H1), progesterone receptors, retinoblastoma proteins, and is involved in every cell cycle step CDK4 and CDK6 phosphorylate retinoblastoma proteins CDK4/cyclin D1 mediates progression from G1 phase of mitosis possibly overregulated in oncogenes
3 Cyclin A2
4 Fun Facts Inhibition of these proteins (specifically CDK4) are targets of some new anti-cancer drugs CDKs exhibit basal activity without activation, but phosphorylation and cyclin binding fully activate the proteins The sequence of this protein family has been very highly conserved throughout evolution There is only one CDK gene in yeast, and it was found that, when swapped with the human gene for CDK1, the yeast was still able to proliferate unhindered
5 Cyclins CDKs can still act without the aid of cyclins, but their activities increase by multiple magnitudes in the presence of the proper cyclin Cyclins are α proteins that are actually longer than the CDK that they bind to Each cyclin potentiates multiple CDKs and each CDK is potentiated by multiple cyclins the specific combination determines what substrate will be phosphorylated For example, Cyclin A2 primarily binds to CDK2 during the S to G2 transition of mitosis, while Cyclin E is bound during the G1 to S transition The differences in cyclin sequences induce slightly different conformational changes in the complex, allowing one type of CDK to have many different cellular roles (though the main reaction is still the same) by allowing different substrates into the active catalytic pocket of the enzyme Cyclins are cyclically (pay attention to the phonology) synthesized and destroyed in vivo in order to regulate cell division, among other lessprevalent (but still very important) processes
6 Cyclin A2
7 Cyclin A2
8 Cyclin-Dependent Kinase 2 The most versatile CDK has functions relating to almost all other CDKs and functions in every step of the cell cycle Forms catalytic complexes with cyclins A, B1, B3, D, E One Mg ++ in the α/β-barrel serves as ATP chelate Mg ++ complexes with Asn132, Asp145, and inner two phosphates of ATP ATP held in place by Asn132 and Thr14 at the outer phosphate and Asp86 and Lys33 at the inner phosphate by hydrogen bonding Asp127 acts as the proton acceptor and thus the active site of substrate phosphorylation
9 1 CDK2 Inactive
10 2 CDK2 Active (2)
11 1 CDK2 Inactive (1)
12 2 CDK2 Active (2)
13 CDK2 in Complex with ATP and Cyclin A2 (cyclin not shown) Light Green ATP binding Dark Green ATP/Mg binding Royal Blue Activators Pink CDK7 associators Light Blue ATP binding Purple Inactivators Yellow Catalytic site Balls ATP
14 CDK2 in Complex with ATP and Cyclin A2 (cyclin not shown) Light Green ATP binding Dark Green ATP/Mg binding Royal Blue Activators Pink CDK7 associators Light Blue ATP binding Purple Inactivators Yellow Catalytic site Balls ATP
15 Active CDK2 in complex with Cyclin A, ATP, and Substrate Protein Orange Substrate Peptide (p27 KIP1)
16 Deductions Thr14 helps to hold ATP in place, therefore phosphorylation at it or the next reside renders it unable to participate as an H-bond donor, thereby decreasing affinity for ATP and inactivating the complex Phosphorylation of Tyr159 and/or Thr160 opens the active site pocket, possibly by electronegative repulsion force, decreasing steric bulk near catalytic pocket and allowing more streamlined action Catalytic Asp127 acts as an intermediate placeholder for the high-energy phosphate group transfer because it is perfectly aligned with the active site pocket and the covalent phosphate bond can be easily cleaved due to the electric properties of Asp CDK7-associated residues are close to the phosphorylation sites on the enzyme, allowing for quick and easy activation/deactivation upon association with the other kinase *Note that the sequence(s) examined can be found in the PBD as 1FIN, and it constitutes two p-cdk2/cyclina2 complexes; though it shouldn t make a terrible difference, these pictures were rendered simply by hiding the redundant chains. If there is a significant shift in geometry due to association of multiple complexes, then this data could be flawed. I doubt it, though.
17 More on CDK2 The enzyme is activated when phosphorylated at Thr160 in the T-loop (usually by CDK1 or CDK7) the catalytic region is more mobile in this state Activation increases affinity for substrates and ATP The enzyme is inactivated when phosphorylated at Thr14 and/or Tyr15 Also inhibited by many different cyclic nitrogen compounds at the active site and 1,25-dihydroxy-Vitamin D 3 Once ATP phosphorylates target, it leaves as ADP and CDK2 picks up another ATP ATP held in the α/β-barrel domain Cyclins associate via non-covalent, α-α interactions of helicies In this complex, interactions are among C-terminal CDK2 and N-terminal cyclin A helicies, and also formed around residues 39 through 56 of CDK2 and two of the inner helicies in the cyclin, around residues 80 to 129 Isoform 2 of CDK2 is identical to Isoform 1, but is missing part of the T-Loop region and some following residues of a helix-sheet-helix motif; it probably still functions because the catalytic residue, Asp127, is still present, and the residues after the gap seem to match up in function (including a similarly-spaced Leucine where CDK7 might associate) Mice whose CDK2 gene has been knocked out can still function just fine, but they are found to be sterile this is because CDK1 can be used instead of CDK2 in mitosis, but not in meiosis
18 CDK2 Sequence >1FIN:A PDBID Human Cyclin-dependent Kinase A2 H 3 N + -MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLL H 3 N Inactivation. Alpha One helix... DVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI. NTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRR... T-Loop Region containing Tyr160 Activation. ALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQ... Alpha L14 Helix MLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL-COO -,,, -COO - *The marked sequences refer to the highlyconserved residues in the CDK family
19 Sequence Homology of Human CDK2 93% identity in humans and Gallus gallus (Red Junglefowl) 99% identity in humans and Mus musculus (House Mouse) 91% identity and 99% coverage in humans and Rana catesbeiana (American Bullfrog) 90% identity in humans and Danio rerio (Zebrafish) 90% identity in humans and Salmo salar (Atlantic Salmon) 91% identity in humans and Carassius auratus (Goldfish) 99% identity and 79% coverage in humans and Oryctolagus cuniculus (European Rabbit) 84% identity in humans and Cricetulus griseus (Chinese Hamster) 76% identity and 99% coverage in humans and Sphaerechinus granularis (Purple Sea Urchin) 76% identity and 99% coverage when compared with human CDK3 *Reference sequence obtained from 1FIN chain A **Query Coverage is 100% unless otherwise noted
20 Sequence Homology of Human Cyclin A2 98% identity and 93% coverage in humans and Oryctolagus cuniculus (European Rabbit) 87% identity between humans and Gallus gallus (Red Junglefowl) 96% identity and 85% coverage in humans and Ovis aries (Domestic Sheep) 81% identity in humans and Danio rerio (Zebrafish) 80% identity in humans and Carassius auratus (Goldfish) 98% identity in humans and Heterocephalus glaber (Naked Mole Rat) 67% identity and 99% coverage when compared to human Cyclin A1 *Reference sequence obtained from 1FIN chain B **Query Coverage is 100% unless otherwise noted
21 Genetic Divergence of CDK2
22 Sequence Homology in the Furthest Given Divergence, as Determined by BLASTp: CDK2 in Human vs. Daphnia pulex (Water Flea) Score = 431 bits (1107), Expect = 2e-156, Method: Compositional matrix adjust. Identities = 199/293 (68%), Positives = 250/293 (85%), Gaps = 2/293 (1%) Query Coverage = 97% 1 MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH 60 ME FQK+EKIGEGTYG+VYKA++ TG++VALKKIRL++E+EGVPSTAIREI++LKEL+H 5 MEQFQKIEKIGEGTYGIVYKAKDIETGKLVALKKIRLESESEGVPSTAIREITVLKELDH PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS 120 P++VKLLDV+H E K+YLVFE+L+QDLKK +D S G+ +KS+L+Q+L+G+AFCHS 65 PHVVKLLDVVHVEKKIYLVFEYLNQDLKKLLD-SMPCGLEPKAVKSFLWQMLKGIAFCHS HRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY 180 HRVLHRDLKPQNLL+N G +KLADFGLARAFG+P+R+YTHEVVTLWY+APE+LLG K Y 124 HRVLHRDLKPQNLLVNKNGLLKLADFGLARAFGLPLRSYTHEVVTLWYKAPEVLLGAKIY STAVDIWSLGCIFAEMVT-RRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPS 239 +T+VDIWS+GCIFAEM+ R ALFPGDSEIDQLFRIFRT+GTPDE WPGV+ +PD+KPS 184 TTSVDIWSIGCIFAEMLKGRTALFPGDSEIDQLFRIFRTMGTPDETCWPGVSQLPDFKPS FPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP 292 FPKW+ F ++ P LD DG +LL +++ YDPNKR+SA+ AL H +F P 244 FPKWSGSSFEEMFPRLDSDGLNLLMKLMLYDPNKRLSARQALHHRYFSGFQLP 296
23 Interpreting Sequence Homology The greatest divergence found by BLAST from human CDK2 was in the Water Flea The sequences display a 68% identity and 85% positive match The PSTAIRE region in the alpha one helix still displays 100% identity, thus cyclins have probably been used as signal molecules for a very long time The T-Loop is very similar, but has two residues at its posterior end that do not match this probably accounts for the heterologous L14 helix that the Flea possesses Despite the mismatching residues here and there, the catalytic Aspartate, ATP-binding, and activation/inactivation residues are still conserved; suggesting that the core reaction mechanisms governing life are the same, even when comparing organisms as divergent as humans and fleas
24 Sources PDB BRENDA NCBI / BLAST Dependent-Kinase-CDK-a-1303.html The Cell Cycle: Principles of Control by David O. Morgan, 2007 P24941 (CDK2_HUMAN) Reviewed, UniProtKB/Swiss-Prot Images generated with: Swiss-pdb Viewer 4.1.0
Lecture 10: Cyclins, cyclin kinases and cell division
Chem*3560 Lecture 10: Cyclins, cyclin kinases and cell division The eukaryotic cell cycle Actively growing mammalian cells divide roughly every 24 hours, and follow a precise sequence of events know as
More informationC a h p a t p e t r e r 6 E z n y z m y e m s
Chapter 6 Enzymes 4. Examples of enzymatic reactions acid-base catalysis: give and take protons covalent catalysis: a transient covalent bond is formed between the enzyme and the substrate metal ion catalysis:
More informationCELL CYCLE AND DIFFERENTIATION
CELL CYCLE AND DIFFERENTIATION Dewajani Purnomosari Department of Histology and Cell Biology Faculty of Medicine Universitas Gadjah Mada d.purnomosari@ugm.ac.id WHAT IS CELL CYCLE? 09/12/14 d.purnomosari@ugm.ac.id
More information4 Examples of enzymes
Catalysis 1 4 Examples of enzymes Adding water to a substrate: Serine proteases. Carbonic anhydrase. Restrictions Endonuclease. Transfer of a Phosphoryl group from ATP to a nucleotide. Nucleoside monophosphate
More informationAdvanced Certificate in Principles in Protein Structure. You will be given a start time with your exam instructions
BIRKBECK COLLEGE (University of London) Advanced Certificate in Principles in Protein Structure MSc Structural Molecular Biology Date: Thursday, 1st September 2011 Time: 3 hours You will be given a start
More information16 The Cell Cycle. Chapter Outline The Eukaryotic Cell Cycle Regulators of Cell Cycle Progression The Events of M Phase Meiosis and Fertilization
The Cell Cycle 16 The Cell Cycle Chapter Outline The Eukaryotic Cell Cycle Regulators of Cell Cycle Progression The Events of M Phase Meiosis and Fertilization Introduction Self-reproduction is perhaps
More informationSupplementary Figure 1. Aligned sequences of yeast IDH1 (top) and IDH2 (bottom) with isocitrate
SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure 1. Aligned sequences of yeast IDH1 (top) and IDH2 (bottom) with isocitrate dehydrogenase from Escherichia coli [ICD, pdb 1PB1, Mesecar, A. D., and Koshland,
More informationLife Sciences 1a: Section 3B. The cell division cycle Objectives Understand the challenges to producing genetically identical daughter cells
Life Sciences 1a: Section 3B. The cell division cycle Objectives Understand the challenges to producing genetically identical daughter cells Understand how a simple biochemical oscillator can drive the
More informationViewing and Analyzing Proteins, Ligands and their Complexes 2
2 Viewing and Analyzing Proteins, Ligands and their Complexes 2 Overview Viewing the accessible surface Analyzing the properties of proteins containing thousands of atoms is best accomplished by representing
More informationChapter 8: Energy and Metabolism
Chapter 8: Energy and Metabolism Why do organisms need energy? How do organisms manage their energy needs? Defining terms and issues: energy and thermodynamics metabolic reactions and energy transfers
More informationIntroduction. Gene expression is the combined process of :
1 To know and explain: Regulation of Bacterial Gene Expression Constitutive ( house keeping) vs. Controllable genes OPERON structure and its role in gene regulation Regulation of Eukaryotic Gene Expression
More informationSerine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition
Supplementary Information to Serine-7 but not serine-5 phosphorylation primes RNA polymerase II CTD for P-TEFb recognition Nadine Czudnochowski 1,2, *, Christian A. Bösken 1, * & Matthias Geyer 1 1 Max-Planck-Institut
More informationPatrick: An Introduction to Medicinal Chemistry 5e Chapter 04
01) Which of the following statements is not true about receptors? a. Most receptors are proteins situated inside the cell. b. Receptors contain a hollow or cleft on their surface which is known as a binding
More informationCh. 9 Multiple Sequence Alignment (MSA)
Ch. 9 Multiple Sequence Alignment (MSA) - gather seqs. to make MSA - doing MSA with ClustalW - doing MSA with Tcoffee - comparing seqs. that cannot align Introduction - from pairwise alignment to MSA -
More informationSignal Transduction Phosphorylation Protein kinases. Misfolding diseases. Protein Engineering Lysozyme variants
Signal Transduction Phosphorylation Protein kinases Misfolding diseases Protein Engineering Lysozyme variants Cells and Signals Regulation The cell must be able to respond to stimuli Cellular activities
More informationFlow of Energy. Flow of Energy. Energy and Metabolism. Chapter 6
Energy and Metabolism Chapter 6 Flow of Energy Energy: the capacity to do work -kinetic energy: the energy of motion -potential energy: stored energy Energy can take many forms: mechanical electric current
More informationRegulation and signaling. Overview. Control of gene expression. Cells need to regulate the amounts of different proteins they express, depending on
Regulation and signaling Overview Cells need to regulate the amounts of different proteins they express, depending on cell development (skin vs liver cell) cell stage environmental conditions (food, temperature,
More informationRanjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India. 1 st November, 2013
Hydration of protein-rna recognition sites Ranjit P. Bahadur Assistant Professor Department of Biotechnology Indian Institute of Technology Kharagpur, India 1 st November, 2013 Central Dogma of life DNA
More informationProblems from Previous Class
1 Problems from Previous lass 1. What is K m? What are the units of K m? 2. What is V max? What are the units of V max? 3. Write down the Michaelis-Menten equation. 4. What order of reaction is the reaction
More informationSolutions In each case, the chirality center has the R configuration
CAPTER 25 669 Solutions 25.1. In each case, the chirality center has the R configuration. C C 2 2 C 3 C(C 3 ) 2 D-Alanine D-Valine 25.2. 2 2 S 2 d) 2 25.3. Pro,, Trp, Tyr, and is, Trp, Tyr, and is Arg,
More informationATP ATP. The energy needs of life. Living economy. Where do we get the energy from? 9/11/2015. Making energy! Organisms are endergonic systems
Making energy! ATP The energy needs of life rganisms are endergonic systems What do we need energy for? synthesis building biomolecules reproduction movement active transport temperature regulation 2007-2008
More informationIntroduction to Comparative Protein Modeling. Chapter 4 Part I
Introduction to Comparative Protein Modeling Chapter 4 Part I 1 Information on Proteins Each modeling study depends on the quality of the known experimental data. Basis of the model Search in the literature
More informationLectures by Kathleen Fitzpatrick
Chapter 10 Chemotrophic Energy Metabolism: Aerobic Respiration Lectures by Kathleen Fitzpatrick Simon Fraser University Figure 10-1 Figure 10-6 Conversion of pyruvate The conversion of pyruvate to acetyl
More informationAn Introduction to Metabolism
An Introduction to Metabolism I. All of an organism=s chemical reactions taken together is called metabolism. A. Metabolic pathways begin with a specific molecule, which is then altered in a series of
More informationEnergy and Cellular Metabolism
1 Chapter 4 About This Chapter Energy and Cellular Metabolism 2 Energy in biological systems Chemical reactions Enzymes Metabolism Figure 4.1 Energy transfer in the environment Table 4.1 Properties of
More informationIntroduction to Metabolism (Or Energy Management) Chapter 8
Introduction to Metabolism (Or Energy Management) Chapter 8 Metabolism of the chemical reactions in the organism Building up molecules Breaking down molecules Managing energy and materials Route to end-product
More informationCHMI 2227 EL. Biochemistry I. Test January Prof : Eric R. Gauthier, Ph.D.
CHMI 2227 EL Biochemistry I Test 1 26 January 2007 Prof : Eric R. Gauthier, Ph.D. Guidelines: 1) Duration: 55 min 2) 14 questions, on 7 pages. For 70 marks (5 marks per question). Worth 15 % of the final
More information2054, Chap. 8, page 1
2054, Chap. 8, page 1 I. Metabolism: Energetics, Enzymes, and Regulation (Chapter 8) A. Energetics and work 1. overview a. energy = ability to do work (1) chemical, transport, mechanical (2) ultimate source
More informationBA, BSc, and MSc Degree Examinations
Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes
More informationChapter 6- An Introduction to Metabolism*
Chapter 6- An Introduction to Metabolism* *Lecture notes are to be used as a study guide only and do not represent the comprehensive information you will need to know for the exams. The Energy of Life
More informationEnzymes Enzyme Mechanism
Mechanisms of Enzymes BCMB 3100 Chapters 6, 7, 8 Enzymes Enzyme Mechanism 1 Energy diagrams Binding modes of enzyme catalysis Chemical modes of enzyme catalysis Acid-Base catalysis Covalent catalysis Binding
More informationThe Structure and Functions of Proteins
Wright State University CORE Scholar Computer Science and Engineering Faculty Publications Computer Science and Engineering 2003 The Structure and Functions of Proteins Dan E. Krane Wright State University
More informationProblem Set 1
2006 7.012 Problem Set 1 Due before 5 PM on FRIDAY, September 15, 2006. Turn answers in to the box outside of 68-120. PLEASE WRITE YOUR ANSWERS ON THIS PRINTOUT. 1. For each of the following parts, pick
More informationEnzymes Enzyme Mechanism
BCMB 3100 Chapters 6, 7, 8 Enzymes Enzyme Mechanism 1 Mechanisms of Enzymes Energy diagrams Binding modes of enzyme catalysis Chemical modes of enzyme catalysis Acid-Base catalysis Covalent catalysis Binding
More information9/25/2011. Outline. Overview: The Energy of Life. I. Forms of Energy II. Laws of Thermodynamics III. Energy and metabolism IV. ATP V.
Chapter 8 Introduction to Metabolism Outline I. Forms of Energy II. Laws of Thermodynamics III. Energy and metabolism IV. ATP V. Enzymes Overview: The Energy of Life Figure 8.1 The living cell is a miniature
More informationLS1a Fall 2014 Problem Set #2 Due Monday 10/6 at 6 pm in the drop boxes on the Science Center 2 nd Floor
LS1a Fall 2014 Problem Set #2 Due Monday 10/6 at 6 pm in the drop boxes on the Science Center 2 nd Floor Note: Adequate space is given for each answer. Questions that require a brief explanation should
More informationBiophysics 490M Project
Biophysics 490M Project Dan Han Department of Biochemistry Structure Exploration of aa 3 -type Cytochrome c Oxidase from Rhodobacter sphaeroides I. Introduction: All organisms need energy to live. They
More informationDiscussion Section (Day, Time): TF:
ame: Chemistry 27 Professor Gavin MacBeath arvard University Spring 2004 Final Exam Thursday, May 28, 2004 2:15 PM - 5:15 PM Discussion Section (Day, Time): Directions: TF: 1. Do not write in red ink.
More informationBSc and MSc Degree Examinations
Examination Candidate Number: Desk Number: BSc and MSc Degree Examinations 2018-9 Department : BIOLOGY Title of Exam: Molecular Biology and Biochemistry Part I Time Allowed: 1 hour and 30 minutes Marking
More informationTable 1. Crystallographic data collection, phasing and refinement statistics. Native Hg soaked Mn soaked 1 Mn soaked 2
Table 1. Crystallographic data collection, phasing and refinement statistics Native Hg soaked Mn soaked 1 Mn soaked 2 Data collection Space group P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 P2 1 2 1 2 1 Cell
More informationName: Date: Hour: Unit Four: Cell Cycle, Mitosis and Meiosis. Monomer Polymer Example Drawing Function in a cell DNA
Unit Four: Cell Cycle, Mitosis and Meiosis I. Concept Review A. Why is carbon often called the building block of life? B. List the four major macromolecules. C. Complete the chart below. Monomer Polymer
More informationGround Rules of Metabolism CHAPTER 6
Ground Rules of Metabolism CHAPTER 6 Antioxidants You ve heard the term. What s the big deal? Found naturally in many fruits and vegetables Added to many products What do they actually do? Antioxidants
More informationTransport between cytosol and nucleus
of 60 3 Gated trans Lectures 9-15 MBLG 2071 The n GATED TRANSPORT transport between cytoplasm and nucleus (bidirectional) controlled by the nuclear pore complex active transport for macro molecules e.g.
More informationTracking Protein Allostery in Evolution
Tracking Protein Allostery in Evolution Glycogen phosphorylase frees sugars to provide energy GP orthologs diverged 600,000,000 years can respond to transcription controls, metabolite concentrations and
More informationChapter 8 Notes. An Introduction to Metabolism
Chapter 8 Notes An Introduction to Metabolism Describe how allosteric regulators may inhibit or stimulate the activity of an enzyme. Objectives Distinguish between the following pairs of terms: catabolic
More informationProperties of amino acids in proteins
Properties of amino acids in proteins one of the primary roles of DNA (but not the only one!) is to code for proteins A typical bacterium builds thousands types of proteins, all from ~20 amino acids repeated
More informationCHAPTER 29 HW: AMINO ACIDS + PROTEINS
CAPTER 29 W: AMI ACIDS + PRTEIS For all problems, consult the table of 20 Amino Acids provided in lecture if an amino acid structure is needed; these will be given on exams. Use natural amino acids (L)
More informationStructure Investigation of Fam20C, a Golgi Casein Kinase
Structure Investigation of Fam20C, a Golgi Casein Kinase Sharon Grubner National Taiwan University, Dr. Jung-Hsin Lin University of California San Diego, Dr. Rommie Amaro Abstract This research project
More informationChapter 9 DNA recognition by eukaryotic transcription factors
Chapter 9 DNA recognition by eukaryotic transcription factors TRANSCRIPTION 101 Eukaryotic RNA polymerases RNA polymerase RNA polymerase I RNA polymerase II RNA polymerase III RNA polymerase IV Function
More informationAn Introduction to Metabolism
Chapter 8 An Introduction to Metabolism Edited by Shawn Lester PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley
More informationMetabolism and enzymes
Metabolism and enzymes 4-11-16 What is a chemical reaction? A chemical reaction is a process that forms or breaks the chemical bonds that hold atoms together Chemical reactions convert one set of chemical
More informationAn Introduction to Metabolism
Chapter 8 1 An Introduction to Metabolism PowerPoint Lecture Presentations for Biology Eighth Edition Neil Campbell and Jane Reece Lectures by Chris Romero, updated by Erin Barley with contributions from
More information1. Amino Acids and Peptides Structures and Properties
1. Amino Acids and Peptides Structures and Properties Chemical nature of amino acids The!-amino acids in peptides and proteins (excluding proline) consist of a carboxylic acid ( COOH) and an amino ( NH
More informationHands-On Nine The PAX6 Gene and Protein
Hands-On Nine The PAX6 Gene and Protein Main Purpose of Hands-On Activity: Using bioinformatics tools to examine the sequences, homology, and disease relevance of the Pax6: a master gene of eye formation.
More informationIt s the amino acids!
Catalytic Mechanisms HOW do enzymes do their job? Reducing activation energy sure, but HOW does an enzyme catalysis reduce the energy barrier ΔG? Remember: The rate of a chemical reaction of substrate
More informationTHE UNIVERSITY OF MANITOBA. PAPER NO: _1_ LOCATION: 173 Robert Schultz Theatre PAGE NO: 1 of 5 DEPARTMENT & COURSE NO: CHEM / MBIO 2770 TIME: 1 HOUR
THE UNIVERSITY OF MANITOBA 1 November 1, 2016 Mid-Term EXAMINATION PAPER NO: _1_ LOCATION: 173 Robert Schultz Theatre PAGE NO: 1 of 5 DEPARTMENT & COURSE NO: CHEM / MBIO 2770 TIME: 1 HOUR EXAMINATION:
More informationWelcome to Class 21!
Welcome to Class 21! Introductory Biochemistry! Lecture 21: Outline and Objectives l Regulation of Gene Expression in Prokaryotes! l transcriptional regulation! l principles! l lac operon! l trp attenuation!
More informationVisual pigments. Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2019
Visual pigments Neuroscience, Biochemistry Dr. Mamoun Ahram Third year, 2019 References Webvision: The Organization of the Retina and Visual System (http://www.ncbi.nlm.nih.gov/books/nbk11522/#a 127) The
More informationAn Introduction to Metabolism
An Introduction to Metabolism Chapter 8 Objectives Distinguish between the following pairs of terms: catabolic and anabolic pathways; kinetic and potential energy; open and closed systems; exergonic and
More informationBiomolecules: lecture 10
Biomolecules: lecture 10 - understanding in detail how protein 3D structures form - realize that protein molecules are not static wire models but instead dynamic, where in principle every atom moves (yet
More informationChapters 5-6 Enzymes. Catalyst: A substance that speeds up the rate of a chemical reaction but is not itself consumed.
hapters 56 Enzymes atalyst: A substance that speeds up the rate of a chemical reaction but is not itself consumed. Most biological catalysts are proteins but some RA are catalysts too. e.g. Peptide bonds
More informationBIOLOGY 10/11/2014. An Introduction to Metabolism. Outline. Overview: The Energy of Life
8 An Introduction to Metabolism CAMPBELL BIOLOGY TENTH EDITION Reece Urry Cain Wasserman Minorsky Jackson Outline I. Forms of Energy II. Laws of Thermodynamics III. Energy and metabolism IV. ATP V. Enzymes
More informationType II Kinase Inhibitors Show an Unexpected Inhibition Mode against Parkinson s Disease-Linked LRRK2 Mutant G2019S.
Type II Kinase Inhibitors Show an Unexpected Inhibition Mode against Parkinson s Disease-Linked LRRK2 Mutant G219S. Min Liu@&*, Samantha A. Bender%*, Gregory D Cuny@, Woody Sherman, Marcie Glicksman@ Soumya
More information5) An amino acid that doesn't exist in proteins: - Tyrosine - Tryptophan - Cysteine - ornithine* 6) How many tripeptides can be formed from using one
Biochemistry First 1) An amino acid that does not have L & D: - proline - serine - Glycine* - valine 2) An amino acid that exists in beta-bends and turns: - Gly* - Pro - Arg - Asp 3) An amino acid that
More informationComputational chemical biology to address non-traditional drug targets. John Karanicolas
Computational chemical biology to address non-traditional drug targets John Karanicolas Our computational toolbox Structure-based approaches Ligand-based approaches Detailed MD simulations 2D fingerprints
More informationCSCE555 Bioinformatics. Protein Function Annotation
CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The
More informationOverview of Kinetics
Overview of Kinetics [P] t = ν = k[s] Velocity of reaction Conc. of reactant(s) Rate of reaction M/sec Rate constant sec -1, M -1 sec -1 1 st order reaction-rate depends on concentration of one reactant
More information7.012 Problem Set 1. i) What are two main differences between prokaryotic cells and eukaryotic cells?
ame 7.01 Problem Set 1 Section Question 1 a) What are the four major types of biological molecules discussed in lecture? Give one important function of each type of biological molecule in the cell? b)
More informationDepartment of Chemistry and Biochemistry University of Lethbridge. Biochemistry II. Bioenergetics
Department of Chemistry and Biochemistry University of Lethbridge II. Bioenergetics Slide 1 Bioenergetics Bioenergetics is the quantitative study of energy relationships and energy conversion in biological
More informationCatalysis is Necessary for Life. Chapter 6 Enzymes. Why Study Enzymes? Enzymes are Biological Catalysts
Chapter 6 Enzymes Catalysis is Necessary for Life Definition: a catalyst is a substance that speeds up a chemical reaction, while emerging unchanged at the end Corollary A: a catalyst is never used up,
More informationProtein Structure. W. M. Grogan, Ph.D. OBJECTIVES
Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate
More informationObjective: Students will be able identify peptide bonds in proteins and describe the overall reaction between amino acids that create peptide bonds.
Scott Seiple AP Biology Lesson Plan Lesson: Primary and Secondary Structure of Proteins Purpose:. To understand how amino acids can react to form peptides through peptide bonds.. Students will be able
More informationAn Introduction to Metabolism
CAMPBELL BIOLOGY IN FOCUS URRY CAIN WASSERMAN MINORSKY REECE 6 An Introduction to Metabolism Lecture Presentations by Kathleen Fitzpatrick and Nicole Tunbridge, Simon Fraser University SECOND EDITION The
More informationCh 4: Cellular Metabolism, Part 1
Developed by John Gallagher, MS, DVM Ch 4: Cellular Metabolism, Part 1 Energy as it relates to Biology Energy for synthesis and movement Energy transformation Enzymes and how they speed reactions Metabolism
More informationBiochemical bases for energy transformations. Biochemical bases for energy transformations. Nutrition 202 Animal Energetics R. D.
Biochemical bases for energy transformations Biochemical bases for energy transformations Nutrition 202 Animal Energetics R. D. Sainz Lecture 02 Energy originally from radiant sun energy Captured in chemical
More informationChapter 6: Energy Flow in the Life of a Cell
Chapter 6: Energy Flow in the Life of a Cell What is Energy? Answer: The Capacity to do Work Types of Energy: 1) Kinetic Energy = Energy of movement Light (movement of photons) Heat (movement of particles)
More informationEnzymes I. Dr. Mamoun Ahram Summer semester,
Enzymes I Dr. Mamoun Ahram Summer semester, 2017-2018 Resources Mark's Basic Medical Biochemistry Other resources NCBI Bookshelf: http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=books The Medical Biochemistry
More informationLecture 15: Enzymes & Kinetics. Mechanisms ROLE OF THE TRANSITION STATE. H-O-H + Cl - H-O δ- H Cl δ- HO - + H-Cl. Margaret A. Daugherty.
Lecture 15: Enzymes & Kinetics Mechanisms Margaret A. Daugherty Fall 2004 ROLE OF THE TRANSITION STATE Consider the reaction: H-O-H + Cl - H-O δ- H Cl δ- HO - + H-Cl Reactants Transition state Products
More informationReview Quizzes Chapters 6-10
Review Quizzes Chapters 6-10 1. The product(s) of the light reactions of photosynthesis is/are a. pyruvate b. glucose c. ATP and NADPH d. CO 2 and H 2 O e. ribulose bisphosphate (RuBP) 1. The product(s)
More informationAn Introduction to Metabolism
CAMPBELL BIOLOGY IN FOCUS URRY CAIN WASSERMAN MINORSKY REECE 6 An Introduction to Metabolism Lecture Presentations by Kathleen Fitzpatrick and Nicole Tunbridge, Simon Fraser University SECOND EDITION The
More informationSUPPLEMENTARY INFORMATION
Supplementary Results DNA binding property of the SRA domain was examined by an electrophoresis mobility shift assay (EMSA) using synthesized 12-bp oligonucleotide duplexes containing unmodified, hemi-methylated,
More informationMatter and Substances Section 3-1
Matter and Substances Section 3-1 Key Idea: All matter is made up of atoms. An atom has a positively charges core surrounded by a negatively charged region. An atom is the smallest unit of matter that
More informationChapter 8: An Introduction to Metabolism. 1. Energy & Chemical Reactions 2. ATP 3. Enzymes & Metabolic Pathways
Chapter 8: An Introduction to Metabolism 1. Energy & Chemical Reactions 2. ATP 3. Enzymes & Metabolic Pathways 1. Energy & Chemical Reactions 2 Basic Forms of Energy Kinetic Energy (KE) energy in motion
More informationAn Introduction to Metabolism
CAMPBELL BIOLOGY IN FOCUS Urry Cain Wasserman Minorsky Jackson Reece 6 An Introduction to Metabolism Lecture Presentations by Kathleen Fitzpatrick and Nicole Tunbridge Overview: The Energy of Life The
More informationProtein Structure. Role of (bio)informatics in drug discovery. Bioinformatics
Bioinformatics Protein Structure Principles & Architecture Marjolein Thunnissen Dep. of Biochemistry & Structural Biology Lund University September 2011 Homology, pattern and 3D structure searches need
More information7.014 Quiz I Handout
7.014 Quiz I andout Quiz I announcements: Quiz I: Friday, February 27 12:05 12:55 Walker Gym, rd floor (room 5040) **This will be a closed book exam** Quiz Review Session: Wednesday, February 25 7:00 9:00
More informationA Review of camp-dependent Protein Kinase A Catalytic Subunit Structure, Function and Regulation
A Review of camp-dependent Protein Kinase A Catalytic Subunit Structure, Function and Regulation Kaitlyn McLeod* Department of Chemistry and Biochemistry, University of Arizona, Tucson, AZ 85721, USA Abstract
More informationF. Piazza Center for Molecular Biophysics and University of Orléans, France. Selected topic in Physical Biology. Lecture 1
Zhou Pei-Yuan Centre for Applied Mathematics, Tsinghua University November 2013 F. Piazza Center for Molecular Biophysics and University of Orléans, France Selected topic in Physical Biology Lecture 1
More informationEnhancing Specificity in the Janus Kinases: A Study on the Thienopyridine. JAK2 Selective Mechanism Combined Molecular Dynamics Simulation
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2015 Supporting Information Enhancing Specificity in the Janus Kinases: A Study on the Thienopyridine
More information1.9 Practice Problems
1.9 Practice Problems 1. Solution: B It s not only chlorophyll a but a combination of pigments. 2. Solution: D See at what wavelength rate of photosynthesis is the highest. 3. Solution: D It s a fact.
More informationAn Introduction to Metabolism
Chapter 8 An Introduction to Metabolism Dr. Wendy Sera Houston Community College Biology 1406 Key Concepts in Chapter 8 1. An organism s metabolism transforms matter and energy, subject to the laws of
More informationUNIT 6 PART 3 *REGULATION USING OPERONS* Hillis Textbook, CH 11
UNIT 6 PART 3 *REGULATION USING OPERONS* Hillis Textbook, CH 11 REVIEW: Signals that Start and Stop Transcription and Translation BUT, HOW DO CELLS CONTROL WHICH GENES ARE EXPRESSED AND WHEN? First of
More informationSUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES Supplementary Figure 1 Protein sequence alignment of Vibrionaceae with either a 40-residue insertion or a 44-residue insertion. Identical residues are indicated by red background.
More informationChapter 15: Enyzmatic Catalysis
Chapter 15: Enyzmatic Catalysis Voet & Voet: Pages 496-508 Slide 1 Catalytic Mechanisms Catalysis is a process that increases the rate at which a reaction approaches equilibrium Rate enhancement depends
More informationModel Mélange. Physical Models of Peptides and Proteins
Model Mélange Physical Models of Peptides and Proteins In the Model Mélange activity, you will visit four different stations each featuring a variety of different physical models of peptides or proteins.
More informationThree different fusions led to three basic ideas: 1) If one fuses a cell in mitosis with a cell in any other stage of the cell cycle, the chromosomes
Section Notes The cell division cycle presents an interesting system to study because growth and division must be carefully coordinated. For many cells it is important that it reaches the correct size
More informationProtein Struktur (optional, flexible)
Protein Struktur (optional, flexible) 22/10/2009 [ 1 ] Andrew Torda, Wintersemester 2009 / 2010, AST nur für Informatiker, Mathematiker,.. 26 kt, 3 ov 2009 Proteins - who cares? 22/10/2009 [ 2 ] Most important
More informationSupplementary Materials for
advances.sciencemag.org/cgi/content/full/3/4/e1600663/dc1 Supplementary Materials for A dynamic hydrophobic core orchestrates allostery in protein kinases Jonggul Kim, Lalima G. Ahuja, Fa-An Chao, Youlin
More informationNUCLEOTIDE BINDING ENZYMES
NUCLEOTIDE BINDING ENZYMES The Rossmann fold Relationship between sequence, structure and function. Anna Casas, Júlia Gasull and Nerea Vega Index 1. Introduction: Adenine nucleotides 1. The most commonly
More informationRex-Family Repressor/NADH Complex
Kasey Royer Michelle Lukosi Rex-Family Repressor/NADH Complex Part A The biological sensing protein that we selected is the Rex-family repressor/nadh complex. We chose this sensor because it is a calcium
More information