University of Warwick institutional repository:
|
|
- Roy Mason
- 1 years ago
- Views:
Transcription
1 University of Warwick institutional repository: This paper is made available online in accordance with publisher policies. Please scroll down to view the document itself. Please refer to the repository record for this item and our policy information available from the repository home page for further information. To see the final version of this paper please visit the publisher s website. Access to the published version may require a subscription. Author(s): Hironobu Fukami, Chaolun Allen Chen, Ann F Budd, Allen Collins, Carden Wallace, Yao-Yang Chuang, Chienhsun Chen, Chang- Feng Dai, Kenji Iwao, Charles Sheppard, Nancy Knowlton Article Title: Mitochondrial and Nuclear Genes Suggest that Stony Corals Are Monophyletic but Most Families of Stony Corals Are Not (Order Scleractinia, Class Anthozoa, Phylum Cnidaria) Year of publication: 2008 Link to published article: Publisher statement: Citation: Fukami H, Chen CA, Budd AF, Collins A, Wallace C, et al. (2008) Mitochondrial and Nuclear Genes Suggest that Stony Corals Are Monophyletic but Most Families of Stony Corals Are Not (Order Scleractinia, Class Anthozoa, Phylum Cnidaria). PLoS ONE 3(9): e3222. doi: /journal.pone
2 Mitochondrial and Nuclear Genes Suggest that Stony Corals Are Monophyletic but Most Families of Stony Corals Are Not (Order Scleractinia, Class Anthozoa, Phylum Cnidaria) Hironobu Fukami 1, Chaolun Allen Chen 2,3, Ann F. Budd 4, Allen Collins 5, Carden Wallace 6, Yao-Yang Chuang 2,3, Chienhsun Chen 2,3, Chang-Feng Dai 3, Kenji Iwao 7, Charles Sheppard 8, Nancy Knowlton 9,10 * 1 Seto Marine Biological Laboratory, Field Science Education and Research Center, Kyoto University, Shirahama, Wakayama, Japan, 2 Biodiversity Research Centre, Academia Sinica, Nangang, Taipei, Taiwan, 3 Institute of Oceanography, National Taiwan University, Taipei, Taiwan, 4 Department of Geoscience, University of Iowa, Iowa City, Iowa, United States of America, 5 National Systematics Laboratory, NOAA Fisheries Service, National Museum of Natural History, MRC 153, Smithsonian Institution, Washington, D. C., United States of America, 6 Museum of Tropical Queensland, Townsville, Australia, 7 Akajima Marine Science Laboratory, Zamami-son, Okinawa, Japan, 8 Department of Biological Sciences, University of Warwick, Coventry, United Kingdom, 9 Center for Marine Biodiversity and Conservation, Scripps Institution of Oceanography, University of California San Diego, La Jolla, California, United States of America, 10 Department of Invertebrate Zoology, National Museum of Natural History, Smithsonian Institution, MRC 163, Washington, D. C., United States of America Abstract Modern hard corals (Class Hexacorallia; Order Scleractinia) are widely studied because of their fundamental role in reef building and their superb fossil record extending back to the Triassic. Nevertheless, interpretations of their evolutionary relationships have been in flux for over a decade. Recent analyses undermine the legitimacy of traditional suborders, families and genera, and suggest that a non-skeletal sister clade (Order Corallimorpharia) might be imbedded within the stony corals. However, these studies either sampled a relatively limited array of taxa or assembled trees from heterogeneous data sets. Here we provide a more comprehensive analysis of Scleractinia (127 species, 75 genera, 17 families) and various outgroups, based on two mitochondrial genes (cytochrome oxidase I, cytochrome b), with analyses of nuclear genes (ßtubulin, ribosomal DNA) of a subset of taxa to test unexpected relationships. Eleven of 16 families were found to be polyphyletic. Strikingly, over one third of all families as conventionally defined contain representatives from the highly divergent robust and complex clades. However, the recent suggestion that corallimorpharians are true corals that have lost their skeletons was not upheld. Relationships were supported not only by mitochondrial and nuclear genes, but also often by morphological characters which had been ignored or never noted previously. The concordance of molecular characters and more carefully examined morphological characters suggests a future of greater taxonomic stability, as well as the potential to trace the evolutionary history of this ecologically important group using fossils. Citation: Fukami H, Chen CA, Budd AF, Collins A, Wallace C, et al. (2008) Mitochondrial and Nuclear Genes Suggest that Stony Corals Are Monophyletic but Most Families of Stony Corals Are Not (Order Scleractinia, Class Anthozoa, Phylum Cnidaria). PLoS ONE 3(9): e3222. doi: /journal.pone Editor: Niyaz Ahmed, Centre for DNA Fingerprinting and Diagnostics, India Received June 6, 2008; Accepted June 30, 2008; Published September 16, 2008 This is an open-access article distributed under the terms of the Creative Commons Public Domain declaration which stipulates that, once placed in the public domain, this work may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose. Funding: This study was supported through funding by US NSF grants to Nancy Knowlton and Ann Budd (DEB , ), by Academia Sinica Thematic grants ( , ) and a Genomics and Proteinomics grant ( ) to Chaolun Allen Chen, by a Grant-in-Aid for Young Scientists (B) (No ) to Hironobu Fukami, and by a US NSF Assembling the Tree of Life grant ( ) to Allen Collins, Daphne Fautin, and Paulyn Cartwright. Yao- Yang Chuang and Chien-Hsun Chen received PhD fellowships from the Biodiversity Research Centre, Academia Sinica. Competing Interests: The authors have declared that no competing interests exist. * Introduction Molecular analyses have been used to study higher-level relationships among the Scleractinia only comparatively recently, in part because of technical difficulties. Rates of molecular evolution in mitochondrial genes are extremely slow in anthozoans [1], and finding informative nuclear markers is generally challenging. Even so, results to date have revolutionized our understanding of relationships, suggesting that first, traditional subordinal classifications are largely unsupported by molecular data [2 4]; second, many families are not monophyletic [2 7]; and third, the order Corallimorpharia, an anthozoan group lacking skeletons, may be imbedded in the skeleton-possessing scleractinians [8], but see [9] and [10]. Despite these findings, it remains the case that no study to date has examined the phylogeny of Scleractinia using a consistent combination of genes for most genera (including both Pacific and Atlantic representatives) across most families. Here we provide such an analysis, focusing on those scleractinian taxa with large numbers of zooxanthellate species, as well as members of the Corallimorpharia and other anthozoan outgroups. We analyzed 127 species in the order Scleractinia (Online Supporting Information, Table S1), representing 75 genera and 17 families, 16 of which have important reef-building species. This represents a substantial expansion of a previous study [6] that considered only seven families of robust corals. We included a member of the azooxanthellate family Fungiacyathidae because of its possibly close relationship with corallimorpharians [11], but did PLoS ONE 1 September 2008 Volume 3 Issue 9 e3222
3 not analyze members of the largely azooxanthellate Rhizangiidae and Caryophylliidae or other exclusively azooxanthellate families studied by others [12,13], as our focus was on reef-building groups. To test the recently suggested hypothesis that the skeletonless Corallimorpharia are imbedded within the Scleractinia, we analyzed seven genera in this order, including members of both the Corallimorphidae and Discosomatidae [14]. Outgroups consisted of members of the hexacorallian orders Antipatharia, Actiniaria, and Zoanthidea, which are the closest relatives of the Scleractinia and Corallimorpharia [11]. The initial analyses were based on two mitochondrial genes: cytochrome oxidase I (cox1) and cytochrome b (cob). A subset of taxa was analyzed using two nuclear gene regions: ß-tubulin and/or parts of the nuclear ribosomal genes (it was not possible to amplify both nuclear genes for all taxa). The nuclear analyses were targeted to test mitochondrial results that strongly contradicted traditional morphological classification. Unless noted otherwise, all conclusions are supported by both the mitochondrial dataset (Fig. 1) and at least one of the two nuclear datasets (Figs. 2, 3). Results Phylogenetic relationships within the Scleractinia Our molecular results are shown in Figures 1 3, and summarized below (see also Table S2 in Online Supporting Information). Overall, of the 16 traditional families of scleractinian corals with reef-building genera that we analyzed, at least 11 are polyphyletic as currently defined: Mussidae, Faviidae, Pectiniidae, Merulinidae, Siderastreidae, Astrocoeniidae, Euphylliidae, Meandrinidae, Poritidae, Agariciidae, and Oculinidae. Five of these (Oculinidae, Euphylliidae, Meandrinidae, Siderastreidae, Astrocoeniidae) have members placed in both of the highly divergent complex and robust subgroups [2 5]. One family, the Trachyphylliidae, is trivially distinct and does not merit recognition at the family level. Traditional members of the four remaining families Acroporidae, Pocilloporidae, Fungiidae, and Dendrophylliidae cluster together, but the first three of these now contain genera previously assigned to other families. Several genera or groups of genera are so divergent that they will probably need to be assigned to new families. The azooxanthellate Fungiacyathidae was confirmed to be distinctive at the family level (but not closely related to corallimorpharians, see following section). Below we explore these results in somewhat greater detail, comparing the different sources of information (Figs. 1 3), utilizing formal tests of competing phylogenetic hypotheses (Table 1) and exploring implications for needed taxonomic revisions (Table 2, see also Online Supporting Information Table S2). The large family Faviidae Gregory, 1900 is one of the most polyphyletic of all scleractinian families in our analyses, with members scattered throughout the robust clade (groups XI, XIII, XIV, XV, XVI, XVII, XXI in Fig. 1D; groups X1-a, XI-b, XIII-a, XIII-b, XIV-b, XVI, XVII-a, XVII-b, XXI in Fig. 2; groups XI, XV, XXI-a in Fig. 3; p,.001 for all four tests of monophyly, Table 1). The type for the family (Favia fragum) is in a clade that contains the type for the family Mussidae Ortmann, 1890 (Mussa angulosa) (group XXI in Figs. 1D, 2B) [6]; thus the family name Faviidae cannot be retained in the formal taxonomic revisions to come, and the Mussidae will include most of the Atlantic faviids with the exception of the polyphyletic genus Montastraea (which falls in groups XVI and XVII, Figs. 1D and 2B). Two other families when newly revised will include other former members of the Faviidae - the Oculinidae (Solenastrea, Cladocora) (group XIII Figs. 1D, 3; group XIII-b but not XIII-a in Fig. 2A) [6] and the Fungiidae (Leptastrea) (group XI in Fig. 1D, group XI-b in Fig. 2A). Oulastrea appears to be a highly distinctive outgroup to the Fungiidae (group XI in Figs. 1D, 3) that minimally merits recognition at the subfamilial level. Plesiastrea is highly divergent, but with no consistently identified close relatives (group XIV in Fig. 1D, group XIV-b in Figs. 2A, 3). Diploastrea and Montastraea cavernosa are also highly divergent within the robust clade (groups XV and XVI in Fig. 1D, group XVI in Fig. 2B; group XV in Fig. 3). The remaining faviid genera form a well defined clade, but it also includes all or some members of three other families: the Merulinidae Verrill, 1866, some of the Pectiniidae Vaughan and Wells, 1943 (Pectinia, Mycedium; monophyly of Pectiniidae rejected at p,.001 for three of four tests, Table 1), and the Trachyphylliidae Verrill, 1901 (group XVII in Fig. 1D, group XVII-a in Fig. 2B) [6]. Thus this large group could be redescribed under the family name Merulinidae, although it should be noted that even the four original genera of this family do not form a monophyletic assemblage within the larger group (p, =.001 for three of four tests of monophyly, Table 1). The large family Mussidae is also polyphyletic (p,.001 or.028 for the four tests of monophyly, Table 1). It includes Atlantic and Pacific clades, the first of which, as noted above, will retain the family name and also include most of the Caribbean faviids (group XXI in Figs. 1D, 2B) [6]. One Pacific clade clearly includes most of the Pacific mussids and some of the pectinids (Oxypora, Echinophyllia) (group XIX in Figs. 1D, 2B), a grouping that could be recognized at the family or subfamily level. However, the relationships of Micromussa and members the genus Acanthastrea (and even the monophyly of Acanthastrea) are unstable (groups XVIII and XX in Figs. 1D, 2B, 3). Blastomussa is highly divergent and its phylogenetic placement remains unstable across analyses (group XIV in Fig. 1D, XIV-a in Fig. 2A). The family Siderastreidae Vaughan and Wells, 1943 consists of two very distantly related clades (monophyly rejected with p,.001 for all four tests, Table 1). The type genus Siderastrea (one of only three monophyletic genera with Pacific and Atlantic species, the others being Acropora and Porites) has no other close relative in our analyses (group IX in Figs. 1B, 2A, 3), whereas the Pacific genera Psammocora and Coscinaraea are probably allied to the Fungiidae (group XI in Figs. 1D, 3, but with a different placement as group XI-c in Fig. 2A). The family Astrocoeniidae Koby, 1890 also contains two highly divergent clades (monophyly rejected at p,.001 for all four tests) one represented by the Atlantic Stephanocoenia (which has no close relatives in our analyses; group VIII in Figs. 1B, 3) and the other represented by Madracis and Stylocoeniella, which are most closely related to the Pocilloporidae (group X in Figs. 1C, 3). The type genus for the family is a fossil genus (Astrocoenia) that appears to be close to Stephanocoenia in morphology. Most other families also have gains and/or losses in their memberships. The Oculinidae Gray, 1847 gains the faviids Cladocora and Solenastrea, as noted above, but loses Galaxea to the Euphylliidae Veron, 2000 (group V in Figs. 1B, 2A) (monophyly for Oculinidae rejected at p,.001 for all four tests, Table 1). The family Euphylliidae also gains Ctenella from the Meandrinidae Gray, 1847 (group V in Figs. 1B, 2A), and is allied to at least one representative of the genus Pachyseris from the family Agariciidae Gray, 1847 as a sister group (group IV in Figs. 1B, 2A) (monophyly of Euphylliidae and Meandrinidae rejected at p,.001 by four of four tests, monophyly of Agariciidae rejected at p,0.02 for two of four tests, Table 1). The former euphylliid Physogyra has no close relatives (group XIV in Fig. 1D; group XIV-c in Figs. 2A, 3), although the morphologically similar genus Plerogyra appears related based on unpublished data. The Meandrinidae and the Agariciidae are otherwise unaffected by these analyses (although two other Pacific genera remain unstudied in the Meandrinidae, PLoS ONE 2 September 2008 Volume 3 Issue 9 e3222
4 Figure 1. Phylogenetic relationships among scleractinian (mostly zooxanthellate) corals and outgroups. Topology was inferred by Bayesian analysis, based on combined mitochondrial cox1 and cob DNA sequences. Numbers on main branches show percentages of Bayesian probability (.70%) and bootstrap values (.50%) in ML analysis. Dashes mean bootstrap values,50% in ML. Numbers in circles show the connection of trees from A to D; for example, 19 in circle continues directly from 1 in circle. Bars in black indicate possible new family level groupings (see also Supporting Online Information Table 2). Numbers (1, 2) following species names indicate that different colonies of the species had different haplotypes. A. outgroups, B. complex corals and corallimorpharians, C. the family Pocilloporidae, D. robust corals. ACR: Acroporidae, AGA: Agariciidae, AST: Astrocoeniidae, DEN: Dendrophylliidae, EUP: Euphylliidae, FAV: Faviidae, FCY: Fungiacyathidae, FUN: Fungiidae, MEA: Meandrinidae, MER: Merulinidae, MUS: Mussidae, PEC: Pectiniidae, POC: Pocilloporidae, POR: Poritidae, OCU: Oculinidae, SID: Siderastreidae, TRC: Trachyphylliidae. doi: /journal.pone g001 which is otherwise Atlantic in distribution). The Fungiidae Dana, 1846, as noted above, gains Leptastrea, Psammocora, Coscinaraea and Oulastrea; although our tests did not reject monophyly for this family based on the mitochondrial data (Table 1), both mitochondrial and nuclear data support this conclusion (group XI in Figs. 1D, 3, group XI-b in Fig. 2). The families Acroporidae Verrill, 1902 and Poritidae Gray, 1842 are largely stable, although the genus Alveopora must be transferred from the latter to the former (Fig. 1B, [15]) (monophyly of Acroporidae and Poritidae rejected at p,.001 for four of four and three of four tests respectively, Table 1). The family Pocilloporidae Gray, 1842 retains all its conventionally assigned genera (and thus remains monophyletic), but gains new members via a sister clade, as noted above, that contains Stylocoeniella and Madracis (group X in Figs. 1C, 3). Only the Dendrophylliidae Gray, 1847 remains unchanged in composition and without new close relatives. PLoS ONE 3 September 2008 Volume 3 Issue 9 e3222
5 Figure 2. Bayesian tree based on the tubulin gene for a subset of corals shown in Fig. 1. Letter (a, b) after species names indicates that different alleles were obtained from a single coral sample; see Fig. 1 legend for other labeling conventions. A. Phylogenetic relationships among complex corals and some robust corals. B. Phylogenetic relationships within robust corals. Note that the same data for the Montastraea cavernosa clade (in box) were used in both trees. doi: /journal.pone g002 Status of the Order Corallimorpharia Medina et al. [8] suggested that corallimorpharians are scleractinian corals which have secondarily lost the skeleton. Our data do not support this hypothesis. Independent analysis of ribosomal DNA and tubulin data both strongly indicate that Corallimorpharia lies outside Scleractinia (Figs. 2A, 3). Mitochondrial data are more equivocal, in that some trees (e.g. maximum parsimony analysis, see methods) lend support to a link between the complex corals and the corallimorpharians, but our maximum likelihood/bayesian analyses of the full taxonomic data set using cox1 and cob place the corallimorpharians outside the scleractinians (see also [9]) (although the hypothesis of non-monophyly for the Scleractinia was not rejected by the mitochondrial data, Table 1). Discussion Genetic analyses have transformed our understanding of evolutionary relationships over the last decades. In some cases such as families of angiosperms, molecular data have provided important refinements or helped to resolve long-standing controversies, but left many traditional taxonomic groupings intact [16]. In other cases such as sponges, molecular data have overturned much traditional taxonomy and highlighted many previously unanticipated groupings [17]. Although taxonomic problems for corals at the species level have been compared to species ambiguities in angiosperms [18], at higher taxonomic levels the situation for corals resembles that of PLoS ONE 4 September 2008 Volume 3 Issue 9 e3222
6 Figure 3. Bayesian tree based on the rdna gene for a subset of the scleractinian corals analyzed in Fig. 1. Labeling conventions as in previous figures. doi: /journal.pone g003 many sponges, which also lack organ systems and typically a diversity of complex macro-morphological structures. Almost all the families we analyzed either gained or lost members, and in some cases the changes are very substantial. Studies of families dominated by azooxanthellate corals also indicate extensive polyphyly [4,12,13]. Most strikingly, at least seven families (five analyzed here plus the Caryophylliidae and the Guyniidae [7,13]) have conventionally defined members in both the complex and robust clades, which all analyses indicate are highly divergent genetically [2 5,10]. Although more work remains to be done, our conclusions are robust to a number of possible problems. First, nuclear and mitochondrial data sets give broadly similar results. We tested for family monophyly (Table 1) using the largest data set (cox1+cob, Fig. 1), and in every case where monophyly was rejected using formal tests (Table 1), the conclusion is also supported by nonmonphyletic topologies in the tubulin data set (Fig. 2), the r-dna data set (Fig. 3), or both. This makes mitochondrial pseudogenes a highly unlikely explanation for the extent of non-monophyly of scleractinian families in our mitochondrial analyses. Second, although geographic sampling is limited (that is, most species were collected from a single location), where samples from multiple locations were available (e.g. Montastraea cavernosa, Favia fragum, and Scolymia cubensis from Brazil and Panama; Plesiastrea versipora from Palau and Japan, Siderastrea savignyana from Taiwan and Oman; Online Supporting Information Table S1), sequences were either identical, sister taxa, or grouped with all other members of the genus on the mitochondrial tree (Fig. 1). Hybridization is unlikely to contribute to patterns at the level of families or above since it has not been reported between members of different genera. Given these results, traditional morphological characters must be plagued by convergence. Several examples emerged from our PLoS ONE 5 September 2008 Volume 3 Issue 9 e3222
7 Table 1. Results of hypothesis testing showing p-values for approximately Unbiased (AU), Kishino-Hasegawa (KH), Shimodaira-Hasegawa (SH), and weighted SH (WSH) tests. AU KH SH WSH Acroporidae is monophyletic Agariciidae is monophyletic Astrocoeniidae is monophyletic Euphylliidae is monophyletic Faviidae is monophyletic Fungiidae is monophyletic Meandrinidae is monophyletic Merulinidae is monophyletic Mussidae is monophyletic Oculinidae is monophyletic Pectiniidae is monophyletic Poritidae is monophyletic Siderastreidae is monophyletic Scleractinia is not monophyletic Bold indicates rejection at the 95% confidence level. Because the SH test appears to be too conservative [8,37] and the KH test is only valid for comparing a priori hypotheses, results of the AU test should be emphasized. doi: /journal.pone t001 previous study [6] and there are numerous others. For example, fenestrate septa are found in both complex corals (Poritidae, Siderastreidae) and robust corals (Fungiidae) and may not be homologous in the two cases. Similarly, synapticulae are found in most but not all complex corals (lacking in the Astrocoeniidae and Euphylliidae) and are absent in most but not all robust corals (present in the Fungiidae and its allies). In addition, some taxa have been included in families because of their overall similar appearance, despite having several characters atypical of the families to which they are currently assigned, including characters noted by previous authors (e.g. Oulastrea and Madracis [19], Leptastrea and Plesiastrea [20]). Other examples of morphological support for initially surprising molecular results are summarized in Online Supporting Information (Table S2). More comprehensive formal morphological analyses in light of emerging molecular data (e.g. [21,22]) are clearly needed. The results reported here also strengthen the conclusion of Fukami and colleagues [6] that the distinctiveness of the Atlantic scleractinian taxa has been underappreciated. Several families appear to be now largely or exclusively Atlantic: the newly defined Mussidae, the Meandrinidae, the Oculinidae, and the divergent taxon Montastraea cavernosa. Stephanocoenia may represent another distinctive Atlantic clade, whose modern members consist of only one genus, but the Pacific astrocoeniid genus Palauastrea must be analyzed to confirm this. The last decade has brought much change to our understanding of scleractinian relationships, but much still needs to be done. Some zooxanthellate genera remain to be analyzed (Online Supporting Information Table S2, plus many azooxanthellates), and firm conclusions about biogeographic distributions and the prevalence of families containing single genera are thus premature. Other genera require additional work either because they are so divergent that phylogenetic analyses are difficult (e.g. long branch attraction [15]) or because the genus itself contains highly divergent species so that conclusions depend on which species are studied. An example of the former is found in the uncertain phylogenetic placement of three small divergent genera [Blastomussa (2 spp), Physogyra (1 spp), and Plesiastrea (2 spp)]. Examples of the latter are several genera that appear to have members which are highly divergent even within ocean basins, for example Acanthastrea (A. hillae and A. echinata are divergent in Fig. 1D but not in Fig. 2B) and Pachyseris [one species of which is close to the Euphylliidae (Figs. 1B, 2A) whereas at least some of the others appear to be good members of the Agariciidae (Hoeksema, unpubl.)]. The need for accurate species identifications (often a challenge in corals) and skeletal vouchers to back up identifications is particularly acute in such cases. Nevertheless, an outline of the family tree based on a diverse array of molecular markers does appear to be emerging for the Scleractinia. With it comes the opportunity to redefine families based on morphological characters, which can then be traced through the fossil record. Our results also call into question the hypothesis that the corallimorpharians are naked corals that have secondarily lost their skeleton. Three independent analyses yield trees that support the monophyly of the Scleractinia within the Hexacorallia. The mitochondrial tree was rooted by taxa representing the Zoanthidea, Actiniaria and Antipatharia; the tubulin tree was rooted by a member of the Antipatharia, and the rdna tree was rooted by members of the Actiniaria and the Zoanthidea, as well as by a member of the Octocorallia, so issues of rooting are unlikely to be responsible (see [9] for an extensive analysis of the mitochondrial genome of these groups that also concludes that the Scleractinia are monophyletic). Moreover, Medina et al. [8] report strong gene order differences between the Corallimorpharia and the Scleractinia, which would be consistent with the idea that the Scleractinia are a monophyletic group that does not include the Corallimorpharia. Thus while the traditional relationships within the Scleractinia are very poorly supported, the group itself appears to be derived from a single evolutionary lineage. Finally, accurate understanding of evolutionary relationships has implications for ecology and conservation. For example, the conclusion that members of the Faviidae are resistant to environmental stress because they are over-represented in areas of low diversity [23] needs to be reexamined in light of the fact that faviids appear in at least seven of the 21 molecular clades (Fig. 1, Table 2). Our reanalysis of extinction risks for these clades using the recently published listing for all reef-building corals [24] highlights the vulnerabilities of clades II, V, VI, XV, and XVIII+XX, and the lack of adequate information for clades VI, XII, XIII, XIV, and XXI (Table 2). Our ability to protect deep lineages most at risk [25] depends on knowing what these lineages are. Materials and Methods Collections and DNA extraction We collected 15 cm615 cm samples from the following locations: Bocas del Toro, Republic of Panama (Caribbean coast); Carrie Bow Cay, Belize; Togian Island, Indonesia; Aka Island, Okinawa and Shirahama, Wakayama, Japan; Yeiliu, Suao, Kenting National Park and Penghu Island, Taiwan (see Supporting Information Table S1). Total DNA extraction method is as described in Fukami et al. [6]. DNA sequencing The mitochondrial cox1 gene was amplified by polymerase chain reaction (PCR) with previously reported primers MCOIF and MCOIR [6] for most robust corals. For a few robust coral species (especially pocilloporids), complex corals, corallimorpharians and other hexacorallians, combinations (e.g. primer pair of AcMCOIF and SeaMCOIR for PCR) of the following newly PLoS ONE 6 September 2008 Volume 3 Issue 9 e3222
8 Table 2. Tentative groupings of reef-building scleractinian genera based on molecular clades, with total number of species, % data deficient species, and % threatened species for each clade. Clade Members # Spp % DD %. = NT/. =VU II DEN: Balanophyllia, Duncanopsammia, Heteropsammia, Turbinaria /50 III POR: Calathiscus, Goniopora, Porites, Poritipora, Stylaraea /28 IV 1 AGA: Pachyseris /40 V EUP: Catalaphyllia, Euphyllia, Nemenzophyllia /60 MEA: Ctenella, Gyrosmilia, Montigyra OCU: Galaxea, Simplastrea FAV: Parasimplastrea VI ACR: Acropora, Anacropora, Astreopora, Enigmopora, Isopora, Montipora /51 POR: Alveopora VII AGA: Agaricia, Coeloseris, Gardinoseris, Helioseris, Leptoseris, Pavona /24 VIII AST: Stephanocoenia 1 0 0/0 IX 2 SID: Pseudosiderastrea, Siderastrea /20 X POC: Pocillopora, Seriatopora, Stylophora /26 AST: Madracis, Palauastrea, Stylocoeniella XI 2,3 FUN: Cantharellus, Ctenactis, Fungia, Halomitra, Heliofungia, Herpolitha, Lithophylon, Podabacia, Polyphyllia, Sandalolitha, Zoopilus SID: Anomastraea, Coscinaraea, Craterastrea, Horastrea, Psammocora FAV: Leptastrea, Oulastrea /16 XII MEA: Dendrogyra, Dichocoenia, Eusmilia, Meandrina /40 XIII OCU: Oculina, Schizoculina /17 FAV: Cladocora, Solenastrea XIV FAV: Plesiastrea /25 EUP: Physogyra, Plerogyra 3 MUS: Blastomussa XV FAV: Diploastrea /0 XVI FAV: Montastraea (cavernosa only) 1 0 0/0 XVII FAV: Australogyra, Barabattoia, Caulastraea, Cyphastrea, Echinopora, Erythrastrea, Favia (Pacific), Favites, Goniastrea, Leptoria, Montastraea (except cavernosa), Moseleya, Oulophyllia, Platygyra /22 MER: Boninastrea, Hydnophora, Merulina, Paraclavarina, Scapophyllia PEC: Mycedium, Pectinia TRA: Trachyphyllia XVIII+XX 4 MUS: Acanthastrea, Micromussa /43 XIX MUS: Australomussa, Cynarina 5, Lobophyllia, Scolymia (Pacific), Symphyllia /20 PEC: Echinomorpha, Echinophyllia, Oxypora XXI FAV: Colpophyllia, Diploria, Favia (Atlantic), Manicina /7 MUS: Isophyllastrea, Isophyllia, Mussa, Mussismillia, Mycetophyllia, Scolymia (Atlantic) Placement of genera not studied (studied genera in bold) was based on morphological similarity and/or biogeography, and should be regarded as provisional. Names of genera taken from recent analysis of extinction risk [24], which categorized species as data deficient (DD), least concern, or levels of increasing threat [near threatened (NT), vulnerable (VU), endangered, and critically endangered]. In this table, percent of species lacking adequate data, percent of species with moderate (NT or above) and high (VU or above) risk are indicated. Family abbreviations (all capitals) and clade roman numerals are as in Figure 1. 1 Some Pachyseris (particularly P. gemmae and P. rugosa) may be cluster with remainder of Agariciidae in Clade VII. 2 Based also on other analyses [21]. 3 Based on unpublished CO1 data. 4 Based on Fig Includes Indophyllia (pers. obs.). doi: /journal.pone t002 designed primers were used: AcMCOIF (59-GAC ATG GCT ATT TTT AGC CT-39), SeaMCOIF (59-CTA CTA ATC ATA AAG ATA TCG G-39), AcMCOIR (59-AAG CAT AGG AGT GTC GTC TAA TC-39), SeaMCOIR (59-CAA AGT CAG AGT ATC GTC TTG G-39). Mitochondrial cob was amplified by PCR with previously reported primers MCytbF and MCytbR for robust corals [6], and with newly designed primers AcCytbF (59-GCC GTC TCC TTC AAA TAT AAG-39) or MCytbF, and AcCytbR (59-AAA AGG CTC TTC TAC AAC-39) for complex corals and other PLoS ONE 7 September 2008 Volume 3 Issue 9 e3222
9 hexacorallians except for the three sea anemone species. For the sea anemones, SeaCytbF (59-GTG GAA CTT CGG TTC TTT ATT-39) and SeaCytbR (59-ATA CAG AGG CTA ATT GTC C- 39) were used for PCR. The basic protocol for mitochondrial gene amplifications was 94uC for 120 s, followed by 30 cycles at 94uC for 45 s, 55uC for 45 s and 72uC for 90 s, ending with a final phase of 72uC for 5 min. In the case of amplification failure, the following protocol was used: 94uC for 120 s, followed by first 10 cycles at 94uC for 45 s, 45uC for 45 s and 72uC for 90 s, and next 20 cycles at 94uC for 45 s, 45uC for 45 s and 72uC for 90 s, ending with a final phase of 72uC for 5 min. PCR products were directly sequenced as described previously [6]. The ß-tubulin gene (intron and exon regions) was amplified, cloned, and sequenced following the methods described previously [6]. The ribosomal DNA (rdna) segment containing the 39-end of 18S, internal transcribed spacers, 5.8S, and the 59-end of 28S was amplified, cloned, and sequenced following the methods described elsewhere [15,26]. DNA sequence accession numbers of all genes analyzed here (AY722757, AY722761, AY722775, AY722781, AY722785, AY , AB AB441421) are listed in the Table S1 (Online Supporting Information). DNA phylogenetic analyses For mitochondrial DNA, we conducted phylogenetic analyses on the dataset [total 1383 bp, combined cox1 (607 bp) and cob (776 bp) without gaps; 666 parsimony-informative sites] by searching for optimal topologies, as measured by the criteria maximum likelihood (ML) and parsimony (MP) methods, as well as by taking a Bayesian approach. For the ML and Bayesian analyses, we assumed a model of nucleotide evolution obtained by using the Akaike Information Criterion (AIC) as implemented in ModelTest [27]. The most appropriate model of nucleotide evolution for the mitochondrial datasets was the GTR with gamma (G) and invariant (I) parameters (GTR+I+G). The software GARLI [28] was used to search for optimal ML topologies (10 replicate searches started with random trees) and to conduct bootstrap analyses (200 replicates). The program TNT [29] was employed to conduct searches for optimal MP trees (10 replicate tree bisection-reconnection searches with taxa added randomly) and to assess node support with re-sampling methods (1000 replicate bootstrap and jackknife searches). MrBayes [30] was used to conduct Bayesian analyses (with default priors and nruns = 3, samplefreq = 1000, nchains = 8). The number of generations and burnin in millions for the mitochondrial datasets were 8 and 4, respectively. As judged by the potential scale reduction factor (PSRF), analyses converged. Topologies from ML and Bayesian analyses were quite similar. Topology from MP analysis was also largely similar to others obtained, and most nodes in the MP tree that received bootstrap support appeared as part of the Bayesian analysis with a Bayesian posterior probability greater than However, topology of the MP tree differed in one major point, namely the phylogenetic position of the corallimorpharians. The MP tree showed a link between the corallimorpharians and the complex corals (as in [8]), whereas ML and Bayesian trees showed corallimorpharians to be outside the scleractinian corals. In this paper, we show the topology of Bayesian analysis with ML bootstrap values and a Bayesian posterior probability. Three species in the order Actiniaria (Anemonia sp., Stichodactyla sp., Metridium senile [31]), one species in the order Anthipatharia (Cirripathes sp.) and one species in the order Zoanthidea (Zoanthus sp.) were used for outgroups in the mitochondrial analyses (Fig. 1). In order to further assess various phylogenetic hypotheses not found in our best trees, we tested whether our mitochondrial data significantly contradict these suboptimal hypotheses. Using GARLI [28], we conducted ten replicate searches for most likely topologies constrained to conform to each of 14 hypotheses (Table 1). The program CONSEL [32] was then used to calculate p-values for several tests including the Approximately Unbiased (AU) [33], Kishino-Hasegawa (KH) [34], Shimodaira-Hasegawa (SH); [35], and the weighted SH (WSH) [30] tests aimed at measuring how strongly the various hypotheses are contradicted by the data. Because the SH test is only valid when numerous plausible trees are being compared, all resulting trees from the constrained and unconstrained searches were compared. For ß-tubulin, previously published DNA sequences [6] were retrieved from the database and added to newly obtained sequences for phylogenetic analysis. For the phylogenetic tree construction, only the exon region of ß-tubulin was utilized, since the intron region is too diverse to produce reliable alignments above the generic level [6]. When all taxa were used for the phylogenetic analyses, Bayesian probability and ML bootstrap values were too low to support the main branches due to the limited number of informative sites, probably because of the phylogenetically distant relationships among species. Therefore, data were separated into two data sets (Tub1 for the complex group plus some robust corals; Tub2 for most robust corals). The aligned ß-tubulin fragment was 443 bp in length, with 123 and 87 phylogenetically informative sites for Tub1 and Tub2, respectively. As described for the mitochondrial analyses, the most appropriate models of nucleotide evolution for the ML and Bayesian analyses were determined to be HKY+I+G for Tub1 and TrN+I+G for Tub2. PAUP 4.0b10 [36] was used for both Tub1 and Tub2 to reconstruct the ML tree. The robustness of the phylogenies was assessed using the 300 bootstrap option. Bayesian trees for Tub1 and Tub2 were constructed as described for mitochondrial analyses. Four simultaneous Markov chains were run for 1,200,000 (Tub1) or 2,000,000 (Tub2) generations; trees were sampled every 100 generations, with 300,000 (Tub1) or 500,000 (Tub2) initial trees discarded as burn-in, based on visual inspection. In this paper, we show the topology of the Bayesian analysis with ML bootstrap values and Bayesian posterior probabilities. One species in the Antipatharia (Cirripathes sp.) was used as an outgroup to the Scleractinia and Corallimorpharia. For ribosomal DNA, previously published DNA sequences [15,26] were retrieved from the database and added to new sequences for phylogenetic analysis. For the phylogenetic tree construction, only the 39-end of 18S, 5.8S, and the 59-end of 28S rdna were utilized, since the internal transcribed spacers are too divergent to produce reliable alignments above the generic level [15,21]. The Acroporidae were also excluded from the analysis due to their extremely high rates of rdna evolution compared to other scleractinian corals [15]. The aligned rdna fragment was 554 bp in length, and 70 sites were phylogenetically informative. As described for the mitochondrial analyses, the most appropriate model of nucleotide evolution for the ML and Bayesian analyses was determined to be the TIM+I+G model. PAUP 4.0b10 was used to reconstruct the ML tree. The robustness of the phylogenies was assessed using the 1000 bootstrap option. The Bayesian tree was constructed as described for the mitochondrial analyses. Five simultaneous Markov chains were run for 1,000,000 generations with trees sampled every 10 generations, with 50,000 initial trees discarded as burn-in, based on visual inspection. In this paper, we show the topology of the Bayesian analysis with ML bootstrap values and Bayesian posterior probabil- PLoS ONE 8 September 2008 Volume 3 Issue 9 e3222
10 ities. One member of the Octocorallia (Heliopora coerulea), one member of the Zoanthidea (Sphenopus marsupialis) and one member of the Actiniaria (Condylactis sp.) were used as outgroups to the Scleractinia and Corallimorpharia. Supporting Information Table S1 Species lists, localities, and accession numbers. Found at: doi: /journal.pone s001 (0.42 MB DOC) Table S2 Summary of possible changes to current taxonomy of reef-building corals [(1) for most corals, (2) for Fungiidae] and evidence supporting those changes. We list provisional placement based on mitochondrial data (from cox1 and cob from Fig. 1 unless otherwise noted); sources of additional evidence that supports the mitochondrial data are indicated in footnotes [some of these data also appeared in Fukami et al. (3)]. Note that not all members of speciose genera have been examined; in some cases these genera may ultimately be distributed among families, and we list species names where we know that different species have substantially different phylogenetic placements. This table suggests an outline for a revised taxonomy but does not represent a formal taxonomic revision. Families that are exclusively or almost exclusively azooxanthellate (Rhizangiidae, Caryophylliidae) are not included. In addition, the genera Blastomussa, Micromussa, References 1. Shearer TL, van Oppen MJH, Romano SL, Wörheide G (2002) Slow mitochondrial DNA sequence evolution in the Anthozoa (Cnidaria). Mol Ecol 11: Romano SL, Palumbi SR (1996) Evolution of scleractinian corals inferred from molecular systematics. Science 271: Romano SL, Palumbi SR (1997) Molecular evolution of a portion of the mitochondrial 16S ribosomal gene region in scleractinian corals. J Mol Evol 45: Romano SL, Cairns SD (2000) Molecular phylogenetic hypotheses for the evolution of scleractinian corals. Bull Mar Sci 67: Chen CA, Wallace CC, Wolstenholme J (2002) Analysis of mitochondrial 12S RNA gene supports a two-clade hypothesis of the evolutionary history of scleractinian corals. Mol Phyl Evol 23: Fukami H, Budd AF, Paulay G, Sole-Cava A, Chen CA, et al. (2004) Conventional taxonomy obscures deep divergence between Pacific and Atlantic corals. Nature 427: Kerr AM (2005) Molecular and morphological supertree of stony corals (Anthozoa: Scleractinia) using matrix representation parsimony. Biol Rev 80: Medina M, Collins AG, Takaoka TL, Kuehl JV, Boore JL (2006) Naked corals: Skeleton loss in Scleractinia. Proc Natl Acad Sci U S A 103: Brugler MR, France SC (2007) The complete mitochondrial genome of the black coral Chrysopathes formosa (Cnidaria:Anthozoa:Antipatharia) supports classification of antipatharians within the subclass Hexacorallia. Mol Phyl Evol 42: Veron JEN, Odorico DM, Chen CA, Miller DJ (1996) Reassessing evolutionary relationships of scleractinian corals. Coral Reefs 15: Daly M, Fautin DG, Cappola VA (2003) Systematics of the Hexacorallia (Cnidaria: Anthozoa). Zool J Linn Soc 139: Le Goff-Vitry MC, Rogers AD, Baglow D (2004) A deep-sea slant on the molecular phylogeny of the Scleractinia. Mol Phyl Evol 30: Cuif JP, Lecointre G, Perrin C, Tillier A, Tillier S (2003) Patterns of septal biomineralization in Scleractinia compared with their 28S rrna phylogeny: a dual approach for a new taxonomic framework. Zool Scri 32: den Hartog JC (1980) Caribbean shallow water Corallimorpharia. Zool Verhand Leiden 176: Wei WV, Wallace CC, Dai CF, Moothien Pillay RK, Chen CA (2006) Analyses of the ribosomal internal transcribed spacers (ITS) and the 5.8S gene indicate that extremely high rdna heterogeneity is a unique feature in the scleractinian coral genus Acropora (Scleractinia; Acroporidae). Zool Stud 45: Chace MW, Fay MF, Savolainen V (2000) Higher-level classification in the angiosperms: new insights from the perspective of DNA sequence data. Taxon 49: Boury-Esnault N (2006) Systematics and evolution of Demospongiae. Can J Zool 84: Willis BL, van Oppen MJH, Miller DJ, Vollmer SV, Ayre DJ (2006) The role of hybridization in the evolution of reef corals. Ann Rev Ecol Evol Syst 37: Physogyra, and Plesiastrea are not included in lists of new affiliations because mitochondrial and nuclear data provide no consistent indication of likely close relatives. Found at: doi: /journal.pone s002 (0.10 MB DOC) Acknowledgments We thank Bert Hoeksema and Steve Cairns for their advice and assistance, Javier Jara for his help in the field, Eyda Gomez for her help in the laboratory, and Dan Janies for help conducting parsimony analyses of the mitochondrial data set. Permits for new collections were granted by the Kenting National Park, Minister of Interior Affairs and Department of Fishery, Penghu County, Taiwan. Author Contributions Conceived and designed the experiments: HF CAC. Performed the experiments: HF CAC YYC CC. Analyzed the data: HF CAC AC YYC. Contributed reagents/materials/analysis tools: HF CAC AC CFD KI CS. Wrote the paper: HF CAC AC NK. Provided financial support and guided the integration of the various contributions from different team members: NK. Provided information on the traditional systematics of corals that contributed to the interpretation of results and data in table 2 in supplementary information: AFB CW. Commented on manuscript: AFB CW. 19. Vaughan TW, Wells JW (1943) Revision of the suborders, families and genera of the Scleratinia. Geol Soc Am Spec Pap 44: 1 363, pl Alloiteau J (1957) Contribution a la systématique des madréporaires fossiles. CNRS, Paris. pp 1 462, 286 figs, 20 pls. 21. Benzoni F, Stefani F, Stolarski J, Pichon M, Mitta G, et al. (2007) Debating phylogenetic relationships of the scleractinian Psammocora: molecular and morphological evidences. Contr Zool 76: Budd AF, Stolarksi J (2008) Searching for new morphological characters in the systematics of scleractinian reef corals: comparison of septal teeth and granules between Atlantic and Pacific Mussidae. Acta Zool 89: (in press). 23. Bellwood DR, Hughes TP (2001) Regional-scale assembly rules and biodiversity of coral reefs. Science 292: Carpenter KE, Abrar M, Aeby G, Aronson RB, Banks S, et al. (2008) One third of reef-building corals face elevated extinction risk from climate change and local impacts. Science 321: Mace GM, Gittleman JL, Purvis A (2003) Preserving the tree of life. Science 300: Chen CA, Chang CC, Wei NV, Chen CH, Lein IT, et al. (2004) Secondary structure and phylogenetic utility of the ribosomal internal transcribed spacer 2 in the scleractinian corals. Zool Stud 43: Posada D, Crandall KA (1998) Modeltest: Testing the model of DNA substitution. Bioinformatics 14: Zwickl DJ (2006) Genetic algorithm approaches for the phylogenetic analysis of large biological sequence datasets under the maximum likelihood criterion, ver Ph.D. ( 29. Goloboff P, Farris S, Nixon K (2000) TNT:Tree analysis using New Technology (BETA), ver Argentina: Tucumán. 30. Ronquist R, Huelsenbeck JP (2003) MrBayes 3: Bayesian phylogenetic inference under mixed models. Bioinformatics 19: Beagley CT, Okimoto R, Wolstenholme DR (1998) The mitochondrial genome of the sea anemone Metridium senile (Cnidaria): introns, a paucity of trna genes, and a near-standard genetic code. Genetics 148: Shimodaira H, Hasegawa M (2001) CONSEL: For assessing the confidence of phylogenetic tree selection. Bioinformatics 17: Shimodaira H (2002) An approximately unbiased test of phylogenetic tree selection. Syst Biol 51: Kishino H, Hasegawa M (1989) Evaluation of the maximum-likelihood estimate of the evolutionary tree topologies from DNA sequence data, and the branching order in Hominoidea. J Mol Evol 29: Shimodaira H, Hasegawa M (1999) Multiple comparisons of log-likelihoods with applications to phylogenetic inference. Mol Biol Evol 16: Swofford DL (2002) PAUP*:Phylogenetic Analysis Using Parsimony (and Other Methods), version 4.0b10. Sunderland, MA: Sinauer. 37. Buckley TR (2002) Model misspecification and probabilistic tests of topology: Evidence from empirical data sets. Syst Biol 51: PLoS ONE 9 September 2008 Volume 3 Issue 9 e3222
PATRICK SCAPS, VIANNEY DENIS, SIEGFRIED BERHIMPON AND FRANKY RUNTUKAHU
ATOLL RESEARCH BULLETIN NO. 553 Zooxanthellate scleractinian corals of the northern coast of Sulawesi BY PATRICK SCAPS, VIANNEY DENIS, SIEGFRIED BERHIMPON AND FRANKY RUNTUKAHU ISSUED BY NATIONAL MUSEUM
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
Consensus Methods. * You are only responsible for the first two
Consensus Trees * consensus trees reconcile clades from different trees * consensus is a conservative estimate of phylogeny that emphasizes points of agreement * philosophy: agreement among data sets is
Amy Driskell. Laboratories of Analytical Biology National Museum of Natural History Smithsonian Institution, Wash. DC
DNA Barcoding Amy Driskell Laboratories of Analytical Biology National Museum of Natural History Smithsonian Institution, Wash. DC 1 Outline 1. Barcoding in general 2. Uses & Examples 3. Barcoding Bocas
Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
SUPPORTING INFORMATION FOR. SEquence-Enabled Reassembly of β-lactamase (SEER-LAC): a Sensitive Method for the Detection of Double-Stranded DNA
SUPPORTING INFORMATION FOR SEquence-Enabled Reassembly of β-lactamase (SEER-LAC): a Sensitive Method for the Detection of Double-Stranded DNA Aik T. Ooi, Cliff I. Stains, Indraneel Ghosh *, David J. Segal
Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2018 University of California, Berkeley
Integrative Biology 200 "PRINCIPLES OF PHYLOGENETICS" Spring 2018 University of California, Berkeley B.D. Mishler Feb. 14, 2018. Phylogenetic trees VI: Dating in the 21st century: clocks, & calibrations;
8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
Phylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
Outline. Classification of Living Things
Outline Classification of Living Things Chapter 20 Mader: Biology 8th Ed. Taxonomy Binomial System Species Identification Classification Categories Phylogenetic Trees Tracing Phylogeny Cladistic Systematics
Bootstrapping and Tree reliability. Biol4230 Tues, March 13, 2018 Bill Pearson Pinn 6-057
Bootstrapping and Tree reliability Biol4230 Tues, March 13, 2018 Bill Pearson wrp@virginia.edu 4-2818 Pinn 6-057 Rooting trees (outgroups) Bootstrapping given a set of sequences sample positions randomly,
C3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
Journal of Coastal Development ISSN : NATURAL CORAL COLONIZATION OF A MARINA SEAWALL IN SINGAPORE
Original Paper NATURAL CORAL COLONIZATION OF A MARINA SEAWALL IN SINGAPORE Chou Loke Ming, NG Chin Soon Lionel, Chan Sek Meng Jeremy, and Seow Liyun Angie Department of Biological Sciences, National University
PHYLOGENY & THE TREE OF LIFE
PHYLOGENY & THE TREE OF LIFE PREFACE In this powerpoint we learn how biologists distinguish and categorize the millions of species on earth. Early we looked at the process of evolution here we look at
Classification, Phylogeny yand Evolutionary History
Classification, Phylogeny yand Evolutionary History The diversity of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize
CHAPTERS 24-25: Evidence for Evolution and Phylogeny
CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology
AN INVENTORY OF ZOOXANTHELLATE SCLERACTINIAN CORALS IN SINGAPORE, INCLUDING 33 NEW RECORDS
THE RAFFLES BULLETIN OF ZOOLOGY 2009 RAFFLES BULLETIN OF ZOOLOGY Supplement No. 22: 69 80 Date of Publication: 30 Dec.2009 National University of Singapore AN INVENTORY OF ZOOXANTHELLATE SCLERACTINIAN
Likelihood Ratio Tests for Detecting Positive Selection and Application to Primate Lysozyme Evolution
Likelihood Ratio Tests for Detecting Positive Selection and Application to Primate Lysozyme Evolution Ziheng Yang Department of Biology, University College, London An excess of nonsynonymous substitutions
Letter to the Editor. The Effect of Taxonomic Sampling on Accuracy of Phylogeny Estimation: Test Case of a Known Phylogeny Steven Poe 1
Letter to the Editor The Effect of Taxonomic Sampling on Accuracy of Phylogeny Estimation: Test Case of a Known Phylogeny Steven Poe 1 Department of Zoology and Texas Memorial Museum, University of Texas
Supplemental data. Pommerrenig et al. (2011). Plant Cell /tpc
Supplemental Figure 1. Prediction of phloem-specific MTK1 expression in Arabidopsis shoots and roots. The images and the corresponding numbers showing absolute (A) or relative expression levels (B) of
The Phylogenetic Reconstruction of the Grass Family (Poaceae) Using matk Gene Sequences
The Phylogenetic Reconstruction of the Grass Family (Poaceae) Using matk Gene Sequences by Hongping Liang Dissertation submitted to the Faculty of the Virginia Polytechnic Institute and State University
Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies
Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies 1 What is phylogeny? Essay written for the course in Markov Chains 2004 Torbjörn Karfunkel Phylogeny is the evolutionary development
Classification and Phylogeny
Classification and Phylogeny The diversity it of life is great. To communicate about it, there must be a scheme for organization. There are many species that would be difficult to organize without a scheme
PGA: A Program for Genome Annotation by Comparative Analysis of. Maximum Likelihood Phylogenies of Genes and Species
PGA: A Program for Genome Annotation by Comparative Analysis of Maximum Likelihood Phylogenies of Genes and Species Paulo Bandiera-Paiva 1 and Marcelo R.S. Briones 2 1 Departmento de Informática em Saúde
Three Monte Carlo Models. of Faunal Evolution PUBLISHED BY NATURAL HISTORY THE AMERICAN MUSEUM SYDNEY ANDERSON AND CHARLES S.
AMERICAN MUSEUM Notltates PUBLISHED BY THE AMERICAN MUSEUM NATURAL HISTORY OF CENTRAL PARK WEST AT 79TH STREET NEW YORK, N.Y. 10024 U.S.A. NUMBER 2563 JANUARY 29, 1975 SYDNEY ANDERSON AND CHARLES S. ANDERSON
Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?
Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species
Phylogeny 9/8/2014. Evolutionary Relationships. Data Supporting Phylogeny. Chapter 26
Phylogeny Chapter 26 Taxonomy Taxonomy: ordered division of organisms into categories based on a set of characteristics used to assess similarities and differences Carolus Linnaeus developed binomial nomenclature,
Coral communities and reef growth in the southern Great Barrier Reef
Coral Reefs (1997) 16: 103 115 Coral communities and reef growth in the southern Great Barrier Reef R. van Woesik, T. J. Done Department of Marine Sciences, University of the Ryukyus, Senbaru 1 Nishihara,
Most scleractinian corals and octocorals host a single symbiotic zooxanthella clade
MARINE ECOLOGY PROGRESS SERIES Vol. 335: 243 248, 2007 Published April 16 Mar Ecol Prog Ser REPLY COMMENT Most scleractinian corals and octocorals host a single symbiotic zooxanthella clade Tamar L. Goulet*
Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2012 University of California, Berkeley
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2012 University of California, Berkeley B.D. Mishler Feb. 7, 2012. Morphological data IV -- ontogeny & structure of plants The last frontier
Phylogeny. November 7, 2017
Phylogeny November 7, 2017 Phylogenetics Phylon = tribe/race, genetikos = relative to birth Phylogenetics: study of evolutionary relationships among organisms, sequences, or anything in between Related
Chapter 26 Phylogeny and the Tree of Life
Chapter 26 Phylogeny and the Tree of Life Biologists estimate that there are about 5 to 100 million species of organisms living on Earth today. Evidence from morphological, biochemical, and gene sequence
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2008
Integrative Biology 200A "PRINCIPLES OF PHYLOGENETICS" Spring 2008 University of California, Berkeley B.D. Mishler March 18, 2008. Phylogenetic Trees I: Reconstruction; Models, Algorithms & Assumptions
Phylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
Letter to the Editor. Temperature Hypotheses. David P. Mindell, Alec Knight,? Christine Baer,$ and Christopher J. Huddlestons
Letter to the Editor Slow Rates of Molecular Evolution Temperature Hypotheses in Birds and the Metabolic Rate and Body David P. Mindell, Alec Knight,? Christine Baer,$ and Christopher J. Huddlestons *Department
Corals of Rottnest Island
Corals of Rottnest Island MScience Pty Ltd June 2012 Volume 1, Issue 1 MARINE RESEARCH Produced with the Assistance of the Rottnest Island Authority Cover picture courtesy of H. Shortland Jones * Several
Microbial Taxonomy and the Evolution of Diversity
19 Microbial Taxonomy and the Evolution of Diversity Copyright McGraw-Hill Global Education Holdings, LLC. Permission required for reproduction or display. 1 Taxonomy Introduction to Microbial Taxonomy
Using algebraic geometry for phylogenetic reconstruction
Using algebraic geometry for phylogenetic reconstruction Marta Casanellas i Rius (joint work with Jesús Fernández-Sánchez) Departament de Matemàtica Aplicada I Universitat Politècnica de Catalunya IMA
III. Distribution and Abundance of Acropora Corals
III. Distribution and Abundance of Acropora Corals Background The declines in abundance of two of the principal Caribbean reef-building corals, staghorn coral (Acropora cervicornis) and elkhorn coral (A.
Microbial Taxonomy. Microbes usually have few distinguishing properties that relate them, so a hierarchical taxonomy mainly has not been possible.
Microbial Taxonomy Traditional taxonomy or the classification through identification and nomenclature of microbes, both "prokaryote" and eukaryote, has been in a mess we were stuck with it for traditional
Index. C Cañada de Zamba, 91, 129, 195, 197, 204, , 219, 220. D Deep Sea Drilling Project, 4 Deposition, 30, 34, 36 40
Index A Acropora, 148, 194, 213 216 Agaricia, 150, 216, 219, 268 Agariciidae or agariciid, 6, 194 Age models, 29, 30, 257, 258, 260, 266, 268, 272, 273 Angostura Gorge, 32, 33 Antigua, 259 Antillia, 3,
C.DARWIN ( )
C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships
Electronic supplementary material
Electronic supplementary material Historical biogeography and mitogenomics of two endemic Mediterranean gorgonians (Holaxonia, Plexauridae) Angelo Poliseno 1, Alvaro Altuna 2, Carlo Cerrano 3, Gert Wörheide
Homoplasy. Selection of models of molecular evolution. Evolutionary correction. Saturation
Homoplasy Selection of models of molecular evolution David Posada Homoplasy indicates identity not produced by descent from a common ancestor. Graduate class in Phylogenetics, Campus Agrário de Vairão,
ZOOLOGISCHE MEDEDELINGEN
ZOOLOGISCHE MEDEDELINGEN UITGEGEVEN DOOR HET RIJKSMUSEUM VAN NATUURLIJKE HISTORIE TE LEIDEN (MINISTERIE VAN WELZIJN, VOLKSGEZONDHEID EN CULTUUR) Deel 61 no. 27 14 oktober 1987 ISSN 0024-0672 NEW OBSERVATIONS
Estimating Phylogenies (Evolutionary Trees) II. Biol4230 Thurs, March 2, 2017 Bill Pearson Jordan 6-057
Estimating Phylogenies (Evolutionary Trees) II Biol4230 Thurs, March 2, 2017 Bill Pearson wrp@virginia.edu 4-2818 Jordan 6-057 Tree estimation strategies: Parsimony?no model, simply count minimum number
Scleractinian Corals and Reefs of Vietnam as a Part of the Pacific Reef Ecosystem
Open Journal of Marine Science, 2011, 1, 50-68 http://dx.doi.org/10.4236/ojms.2011.12006 Published Online July 2011 (http://www.scirp.org/journal/ojms) Scleractinian Corals and Reefs of Vietnam as a Part
Algorithmic Methods Well-defined methodology Tree reconstruction those that are well-defined enough to be carried out by a computer. Felsenstein 2004,
Tracing the Evolution of Numerical Phylogenetics: History, Philosophy, and Significance Adam W. Ferguson Phylogenetic Systematics 26 January 2009 Inferring Phylogenies Historical endeavor Darwin- 1837
Evolutionary Analysis of Viral Genomes
University of Oxford, Department of Zoology Evolutionary Biology Group Department of Zoology University of Oxford South Parks Road Oxford OX1 3PS, U.K. Fax: +44 1865 271249 Evolutionary Analysis of Viral
Need for systematics. Applications of systematics. Linnaeus plus Darwin. Approaches in systematics. Principles of cladistics
Topics Need for systematics Applications of systematics Linnaeus plus Darwin Approaches in systematics Principles of cladistics Systematics pp. 474-475. Systematics - Study of diversity and evolutionary
CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny
CHAPTER 26 PHYLOGENY AND THE TREE OF LIFE Connecting Classification to Phylogeny To trace phylogeny or the evolutionary history of life, biologists use evidence from paleontology, molecular data, comparative
Lab 9: Maximum Likelihood and Modeltest
Integrative Biology 200A University of California, Berkeley "PRINCIPLES OF PHYLOGENETICS" Spring 2010 Updated by Nick Matzke Lab 9: Maximum Likelihood and Modeltest In this lab we re going to use PAUP*
MOLECULAR PHYLOGENY AND GENETIC DIVERSITY ANALYSIS. Masatoshi Nei"
MOLECULAR PHYLOGENY AND GENETIC DIVERSITY ANALYSIS Masatoshi Nei" Abstract: Phylogenetic trees: Recent advances in statistical methods for phylogenetic reconstruction and genetic diversity analysis were
The process by which the genetic structure of populations changes over time.
Evolution The process by which the genetic structure of populations changes over time. Divergent evolution is the accumulation of differences between groups which can lead to the formation of new species.
Estimating Divergence Dates from Molecular Sequences
Estimating Divergence Dates from Molecular Sequences Andrew Rambaut and Lindell Bromham Department of Zoology, University of Oxford The ability to date the time of divergence between lineages using molecular
Today's project. Test input data Six alignments (from six independent markers) of Curcuma species
DNA sequences II Analyses of multiple sequence data datasets, incongruence tests, gene trees vs. species tree reconstruction, networks, detection of hybrid species DNA sequences II Test of congruence of
The Tree of Life. Chapter 17
The Tree of Life Chapter 17 1 17.1 Taxonomy The science of naming and classifying organisms 2000 years ago Aristotle Grouped plants and animals Based on structural similarities Greeks and Romans included
The California Hotspots Project: I.
The California Hotspots Project: I. Identifying regions of rapid diversification of mammals Ed Davis, M. Koo, C. Conroy, J. Patton & C. Moritz Museum of Vertebrate Zoology, UC Berkeley *Funded by Resources
A Fitness Distance Correlation Measure for Evolutionary Trees
A Fitness Distance Correlation Measure for Evolutionary Trees Hyun Jung Park 1, and Tiffani L. Williams 2 1 Department of Computer Science, Rice University hp6@cs.rice.edu 2 Department of Computer Science
Molecular Evolution and DNA systematics
Biology 4505 - Biogeography & Systematics Dr. Carr Molecular Evolution and DNA systematics Ultimately, the source of all organismal variation that we have examined in this course is the genome, written
Chapter 26: Phylogeny and the Tree of Life
Chapter 26: Phylogeny and the Tree of Life 1. Key Concepts Pertaining to Phylogeny 2. Determining Phylogenies 3. Evolutionary History Revealed in Genomes 1. Key Concepts Pertaining to Phylogeny PHYLOGENY
Genetic characterization of the invasive populations of Vespa velutina in France
Genetic characterization of the invasive populations of Vespa velutina in France M.ARCA 1,2, C.CAPDEVIELLE-DULAC DULAC 1, C.NADEAU 1, C.VILLEMANT 3, G.ARNOLD 2, J.F. SILVAIN 1 (1) IRD, UR 072, Laboratoire
Mar. Ecol. Prog. Ser. Coral communities of the Namsu Islands (Gulf of Siam, South China Sea) Yu. Ya. Latypov
Vol. 9: 6-70, 986 l MARINE ECOLOGY - PROGRESS SERIES Published March 6 Mar. Ecol. Prog. Ser. Coral communities of the Namsu Islands (Gulf of Siam, South China Sea) Yu. Ya. Latypov Institute of Marine Biology,
Electronic supplementary material
Applied Microbiology and Biotechnology Electronic supplementary material A family of AA9 lytic polysaccharide monooxygenases in Aspergillus nidulans is differentially regulated by multiple substrates and
6.047 / Computational Biology: Genomes, Networks, Evolution Fall 2008
MIT OpenCourseWare http://ocw.mit.edu 6.047 / 6.878 Computational Biology: Genomes, Networks, Evolution Fall 2008 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms.
BINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
Cyphastrea kausti sp. n. (Cnidaria, Anthozoa, Scleractinia), a new species of reef coral from the Red Sea
ZooKeys 496: 1 13 (2015) doi: 10.3897/zookeys.496.9433 http://zookeys.pensoft.net Cyphastrea kausti sp. n. (Cnidaria, Anthozoa, Scleractinia)... 1 RESEARCH ARTICLE A peer-reviewed open-access journal Launched
Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata.
Supplementary Note S2 Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata. Phylogenetic trees reconstructed by a variety of methods from either single-copy orthologous loci (Class
Phylogenetic relationships of Pseudohynobius (Urodela, Hynobiidae) inferred from DNA barcoding analysis
Phylogenetic relationships of Pseudohynobius (Urodela, Hynobiidae) inferred from DNA barcoding analysis Y.-Y. Zhao 1 *, L.-N. Su 3 *, Z.-M. Zhang 1 and X.-Y. Wang 2 1 Department of Genetics, Zunyi Medical
Fine-Scale Phylogenetic Discordance across the House Mouse Genome
Fine-Scale Phylogenetic Discordance across the House Mouse Genome Michael A. White 1,Cécile Ané 2,3, Colin N. Dewey 4,5,6, Bret R. Larget 2,3, Bret A. Payseur 1 * 1 Laboratory of Genetics, University of
Chapter 18 Systematics: Seeking Order Amidst Diversity
Chapter 18 Systematics: Seeking Order Amidst Diversity Bird Diversity in Indonesia Chapter 18 At a Glance 18.1 How Are Organisms Named and Classified? 18.2 What Are the Domains of Life? 18.1 How Are Organisms
Points of View. Congruence Versus Phylogenetic Accuracy: Revisiting the Incongruence Length Difference Test
Points of View Syst. Biol. 53(1):81 89, 2004 Copyright c Society of Systematic Biologists ISSN: 1063-5157 print / 1076-836X online DOI: 10.1080/10635150490264752 Congruence Versus Phylogenetic Accuracy:
The process by which the genetic structure of populations changes over time.
Evolution The process by which the genetic structure of populations changes over time. Divergent evolution Goldfields and Ahinahina (silversword) a highly evolved member of the composite family. Evolution
New observations on Scleractinian corals from Indonesia: 3. Species belonging to the Merulinidae with new records of Merulina and Boninastrea
New observations on Scleractinian corals from Indonesia: 3. Species belonging to the Merulinidae with new records of Merulina and Boninastrea M.B. Best & Suharsono Best, M.B. & Suharsono. New observations
Number-controlled spatial arrangement of gold nanoparticles with
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2016 Number-controlled spatial arrangement of gold nanoparticles with DNA dendrimers Ping Chen,*
Zoological Systematics & Taxonomy
Name: PRE-LAB This lab is designed to introduce you to the basics of animal classification (systematics) and taxonomy of animals. This is a field that is constantly changing with the discovery of new animals,
Multiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
Chapter 7: Models of discrete character evolution
Chapter 7: Models of discrete character evolution pdf version R markdown to recreate analyses Biological motivation: Limblessness as a discrete trait Squamates, the clade that includes all living species
Modern Evolutionary Classification. Section 18-2 pgs
Modern Evolutionary Classification Section 18-2 pgs 451-455 Modern Evolutionary Classification In a sense, organisms determine who belongs to their species by choosing with whom they will mate. Taxonomic
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of
part 3: analysis of natural selection pressure
part 3: analysis of natural selection pressure markov models are good phenomenological codon models do have many benefits: o principled framework for statistical inference o avoiding ad hoc corrections
Integrating Fossils into Phylogenies. Throughout the 20th century, the relationship between paleontology and evolutionary biology has been strained.
IB 200B Principals of Phylogenetic Systematics Spring 2011 Integrating Fossils into Phylogenies Throughout the 20th century, the relationship between paleontology and evolutionary biology has been strained.
PLANT VARIATION AND EVOLUTION
PLANT VARIATION AND EVOLUTION D. BRIGGS Department of Plant Sciences, University of Cambridge S. M. WALTERS Former Director of the University Botanic Garden, Cambridge 3rd EDITION CAMBRIDGE UNIVERSITY
Mixture Models in Phylogenetic Inference. Mark Pagel and Andrew Meade Reading University.
Mixture Models in Phylogenetic Inference Mark Pagel and Andrew Meade Reading University m.pagel@rdg.ac.uk Mixture models in phylogenetic inference!some background statistics relevant to phylogenetic inference!mixture
Fast coalescent-based branch support using local quartet frequencies
Fast coalescent-based branch support using local quartet frequencies Molecular Biology and Evolution (2016) 33 (7): 1654 68 Erfan Sayyari, Siavash Mirarab University of California, San Diego (ECE) anzee
Unit 9: CORAL GROWTH. Coral Reef. Ecology Curriculum
Unit 9: CORAL GROWTH Coral Reef Ecology Curriculum This unit is part of the Coral Reef Ecology Curriculum that was developed by the Education Department of the Khaled bin Sultan Living Oceans Foundation.
a,bD (modules 1 and 10 are required)
This form should be used for all taxonomic proposals. Please complete all those modules that are applicable (and then delete the unwanted sections). For guidance, see the notes written in blue and the
METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
Phylogeography and genetic differentiation between Loxigilla noctis and L. barbadensis in the Lesser Antilles
Phylogeography and genetic differentiation between Loxigilla noctis and L. barbadensis in the Lesser Antilles Sophie Arnaud-Haond 1, Carla Daniel 2, Sébastien Motreuil 3, Julia Horrocks 2 & Frank Cézilly
Microbial Diversity and Assessment (II) Spring, 2007 Guangyi Wang, Ph.D. POST103B
Microbial Diversity and Assessment (II) Spring, 007 Guangyi Wang, Ph.D. POST03B guangyi@hawaii.edu http://www.soest.hawaii.edu/marinefungi/ocn403webpage.htm General introduction and overview Taxonomy [Greek
Probability Distribution of Molecular Evolutionary Trees: A New Method of Phylogenetic Inference
J Mol Evol (1996) 43:304 311 Springer-Verlag New York Inc. 1996 Probability Distribution of Molecular Evolutionary Trees: A New Method of Phylogenetic Inference Bruce Rannala, Ziheng Yang Department of
Autotrophs capture the light energy from sunlight and convert it to chemical energy they use for food.
Prokaryotic Cell Eukaryotic Cell Autotrophs capture the light energy from sunlight and convert it to chemical energy they use for food. Heterotrophs must get energy by eating autotrophs or other heterotrophs.
8/23/2014. Introduction to Animal Diversity
Introduction to Animal Diversity Chapter 32 Objectives List the characteristics that combine to define animals Summarize key events of the Paleozoic, Mesozoic, and Cenozoic eras Distinguish between the
Chapter 10. Classification and Phylogeny of Animals. Order in Diversity. Hierarchy of taxa. Table Linnaeus introduced binomial nomenclature
Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. Chapter 10 Classification and Phylogeny of Animals Order in Diversity History Systematic zoologists have three
CONSERVATION AND THE GENETICS OF POPULATIONS
CONSERVATION AND THE GENETICS OF POPULATIONS FredW.Allendorf University of Montana and Victoria University of Wellington and Gordon Luikart Universite Joseph Fourier, CNRS and University of Montana With
BIOL 428: Introduction to Systematics Midterm Exam
Midterm exam page 1 BIOL 428: Introduction to Systematics Midterm Exam Please, write your name on each page! The exam is worth 150 points. Verify that you have all 8 pages. Read the questions carefully,
Phylogenetic analysis. Characters
Typical steps: Phylogenetic analysis Selection of taxa. Selection of characters. Construction of data matrix: character coding. Estimating the best-fitting tree (model) from the data matrix: phylogenetic
Biology 2. Lecture Material. For. Macroevolution. Systematics
Biology 2 Macroevolution & Systematics 1 Biology 2 Lecture Material For Macroevolution & Systematics Biology 2 Macroevolution & Systematics 2 Microevolution: Biological Species: Two Patterns of Evolutionary
CHUCOA ILICIFOLIA, A SPINY ONOSERIS (ASTERACEAE, MUTISIOIDEAE: ONOSERIDEAE)
Phytologia (December 2009) 91(3) 537 CHUCOA ILICIFOLIA, A SPINY ONOSERIS (ASTERACEAE, MUTISIOIDEAE: ONOSERIDEAE) Jose L. Panero Section of Integrative Biology, 1 University Station, C0930, The University