CSCI1950 Z Computa3onal Methods for Biology* (*Working Title) Lecture 1. Ben Raphael January 21, Course Par3culars
|
|
- Rudolf Cook
- 5 years ago
- Views:
Transcription
1 CSCI1950 Z Computa3onal Methods for Biology* (*Working Title) Lecture 1 Ben Raphael January 21, 2009 Course Par3culars Three major topics 1. Phylogeny: ~50% lectures 2. Func3onal Genomics: ~25% lectures 3. Network/Systems Biology: ~25% lectures Tools Computer Science: Algorithms and discrete math (e.g. graph theory), Programming Mathema3cs: Discrete Probability, Linear algebra (vectors and matrices) Biology: Basics. (What is DNA?) 1
2 Course Par3culars Webpage h\p://cs.brown.edu/courses/csci1950 z/ [readings (including some background material) Textbook: None Assignments: mens et manus 1. 4 wri\en assignments: ~40% of grade 2. 3 programming assignments: ~40% of grade 3. Take home final: ~20% of grade Graduate credit Extra assignment/project Talk to me before March 1 Survey Topic 1: Phylogeny 2
3 Early Evolu3onary Studies 200 th Anniversary of birth of Charles Darwin From Origin of the Species (1859) Darwin 1960 s Anatomical features were the dominant criteria used to derive evolu3onary rela3onships between species. Imprecise, ofen subjec3ve, observa3ons ofen led to inconclusive, contradictory, or incorrect evolu3onary rela3onships between species Molecular data (DNA and protein sequences) drama3cally improved situa3on. 3
4 Species Trees Is a panda more closely related to a bear or a raccoon? Looks Hiberna3on Pa\ern Bear Raccoon ~100 years of arguments Tree derived from DNA sequence data. Steven O Brien et al. (1985) Human Evolu3onary History From: Molecular Evolu7on a Phylogene7c Approach, R. Page & E. Holmes 4
5 More Recent Human History Out of Africa Hypothesis: Most ancient ancestor lived in Africa roughly 200,000 years ago The Origin of Humans: Out of Africa vs Mul3regional Hypothesis Out of Africa: Humans evolved in Africa ~200,000 years ago Humans migrated out of Africa, replacing other humanoids around the globe Multiregional: Humans evolved in the last two million years as a single species. Independent appearance of modern traits in different areas Humans migrated out of Africa mixing with other humanoids on the way 5
6 Human Evolu3onary Tree DNA based reconstruc3on of the human evolu3onary tree Evolu3onary Tree of Humans (mtdna) Vigilant, Stoneking, Harpending, Hawkes, and Wilson (1991) African population is the most diverse (sub-populations had more time to diverge) Evolutionary tree separates one group of Africans from a group containing all five populations. Tree rooted on branch between groups of greatest difference. 6
7 Evolu3onary Tree of Humans: (microsatellites) Neighbor joining tree for 14 human populations genotyped with 30 microsatellite loci. Lineage of Genghis Kahn? In humans, Y chromosome passed from father only. Can be used to iden3fy parental lineages. ~8% of males in parts of Asia and 0.5% world wide es3mated to be descendants of a resident of Mongolia ~1000 years ago (Zerjal et al. AGHG 2003). 7
8 Lafaye\e, Louisiana, 1994: A woman claimed her exlover (who was a physician) injected her with HIV+ blood Records show the physician had drawn blood from an HIV+ pa3ent that day Is there a way to show that blood from that HIV + pa3ent ended up in the woman? HIV Transmission HIV has a high muta3on rate, which can be used to trace paths of transmission Two people who were infected from different sources will have very different HIV sequences Alignment of fourteen amino acid sequences from V3 region of HIV 1 gp120 genes Azizi et al. BMC Immunology :25 8
9 To the Lab! Wet lab Take mul3ple samples from the pa3ent, the woman, and controls (non related HIV+ people) Obtain DNA sequence from two HIV genes HIV (gp120 and RT). Computer lab Build phylogene3c tree from the DNA sequences. Phylogene3c Tree Convic3on Three different tree reconstruc3on techniques used. In every reconstruc3on, vic3m s sequences were related to pa3ent s sequences. Nes3ng of the vic3m s sequences within the pa3ent sequence indicated the direc3on of transmission was from pa3ent to vic3m First 3me phylogene3c analysis was used in a court case as evidence (Metzker, et. al., 2002) 9
10 Phylogene3c Trees How to build a phylogene7c tree from data? Data 1. Characters/Features 2. Pairwise distances Algorithm Phylogene3c Trees What is a phylogene7c tree? Biology definition: None (picture) A branching diagram Intuition: Leaves represent existing species Branch points represent most recent common ancestor. Length of branches represent evolutionary time. Root represents the oldest evolutionary ancestor. 10
11 Phylogene3c Trees What is a phylogene7c tree? Computer science definition tree: A connected acyclic graph G = (V, E). graph: A set V of vertices and a set E of edges, where each edge connects a pair of vertices. Tree Defini3ons tree: A connected acyclic graph G = (V, E). graph: A set V of vertices and a set E of edges, where each edge (v i, v j ) connects a pair of vertices. A path in G is a sequence (v 1, v 2,, v n ) of vertices in V such that (v i, v i+1 ) are edges in E. A graph is connected provided for every pair v i v j of vertices, there is a path between v i and v j. A cycle is a path with the same starting and ending vertices. A graph is acyclic provided it has no cycles. 11
12 Tree Defini3ons tree: A connected acyclic graph G = (V, E). degree of vertex v is the number of edges incident to v. A phylogenetic tree is a tree with a label for each leaf (vertex of degree one). A binary phylogenetic tree is a phylogenetic tree where every interior (non-leaf) vertex has degree 3; i.e. two children. A rooted (*binary) phylogenetic tree is phylogenetic tree with a single designated vertex r (* of degree 2) Rooted and Unrooted Trees In the unrooted tree the position of the root ( oldest ancestor ) is unknown. Otherwise, they are like rooted trees 12
13 Evalua3ng Different Phylogenies Value1 Value2 Mouth Smile Frown Eyebrows Normal Pointed Character Based Tree Reconstruc3on Which tree is beher? 13
14 Character Based Tree Reconstruc3on Count changes on tree Character Based Tree Reconstruc3on Parsimony: minimize number of changes on edges of tree 14
15 Character Based Tree Reconstruc3on Maximum Likelihood: Given Pr[change], what is tree with maximum probability? Iden3fying Highest Scoring Tree Naïve, exhaus3ve Algorithm: check all trees. How many possibili3es? Restrict to binary trees. 15
16 Phylogene3c Trees How to efficiently build trees from data? Data 1. Characters/Features 2. Pairwise distances Phylogene3c Trees How to efficiently build trees from data? Methods 1. Characters/Features Parsimony: Minimum number of changes Probabilistic Model 2. Pairwise distances Clustering (UPGMA, Neighbor joining, ) 16
17 Addi3onal Models and Extensions Comparing trees Distances between trees. Sta3s3cal tests: bootstrap, permuta3on tests, etc. Supertrees and consensus Gene trees vs. species trees. Whole genome phylogeny. Topic 2: Func3onal Genomics 17
18 Biology 101 Biology 101 Central Dogma 18
19 What can we measure? Sequencing (expensive) Hybridiza3on (noisy) Sequencing (expensive) Hybridiza3on (noisy) Mass spectrometry (noisy) Hybridiza3on (very noisy!) DNA Basepairing 19
20 DNA Microarrays Clustering of Gene Expression Each microarray experiment: expression vector u = (u 1,, u n ) u i = expression value for each gene. Group similar vectors. Samples Gene expression BMC Genomics 2006, 7:279 20
21 Clustering Clustering algorithms related to distance based phylogene3c algorithms. Phylogeny gives grouping of related data points Binary classifica@on Given a set of examples (x i, y i ), where y i = + 1, from unknown distribu3on D. Design func3on f: R n { 1,+1} that assigns addi3onal samples x i to one of two classes op7mally. Classifica3on 21
22 Topics Methods for Clustering Hierarchical, Matrix based (PCA), Graph based (Clique finding) Methods for Classifica3on Nearest neighbors, support vector machines Data Integra3on: Bayesian Networks Topic 3: Network and Systems Biology 22
23 Biological Interac3on Networks Many types: Protein DNA (regulatory) Protein metabolite (metabolic) Protein protein (signaling) RNA RNA (regulatory) Gene3c interac3ons (gene knockouts) Regulatory Networks 23
24 Cis regulatory Network Metabolic Networks Nodes = reactants Edges = reac3ons labeled by enzyme (protein) that catalyzes reac3on 24
25 Protein Protein (PPI) Network Protein Protein Interac3on Network? Proteins are nodes Interac3ons are edges Edges may have weights Yeast PPI network H. Jeong et al. Nature 411, 41 (2001) 25
26 Computa3onal Problems 1. Classifying Network Topology Finding paths, cliques, dense subnetworks, etc. 2. Comparing Networks Across Species 3. Using networks to explain data Dependencies revealed by network topology 4. Modeling dynamics of networks Network Mo3fs Subnetworks with more occurrences than expected by chance. How to find? How to assess sta3s3cal significance? Shen Orr et al
27 Network Alignment Sharan and Ideker. Modeling cellular machinery through biological network comparison. Nature Biotechnology 24, pp , 2006 The Network Alignment Problem Given: k different interac3on networks belonging to different species, Find: Conserved sub networks within these networks Conserved defined by protein sequence similarity (node similarity) and interac3on similarity (network topology similarity) 27
28 Protein Signaling Networks Art Salomon Biology Department Use machine learning methods (Bayesian networks, etc. to derive network structure. Course Themes Topics: Phylogeny, Func3onal Genomics, Systems & Network Biology Mixture of theory and prac3ce (real data) Graph algorithms: Path and clique finding, isomorphism, heavy subgraphs, matching, vertex cover, spanning and Steiner problems, etc. Hypothesis tes3ng, permuta3on tests, bootstrap and resampling, enrichment (hypergeometric), etc. Data Mining and Machine Learning: Clustering and Classifica3on 28
29 Sources h\p://bioalgorithms.info (por3ons of Out of Africa and character phylogeny slides) 29
Phylogeny and Molecular Evolution. Introduction
Phylogeny and Molecular Evolution Introduction 1 Credit Serafim Batzoglou (UPGMA slides) http://www.stanford.edu/class/cs262/slides Notes by Nir Friedman, Dan Geiger, Shlomo Moran, Ron Shamir, Sagi Snir,
More informationPhylogeny and Molecular Evolution. Introduction
Phylogeny and Molecular Evolution Introduction 1 2/62 3/62 Credit Serafim Batzoglou (UPGMA slides) http://www.stanford.edu/class/cs262/slides Notes by Nir Friedman, Dan Geiger, Shlomo Moran, Ron Shamir,
More informationPhylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki
Phylogene)cs IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, 2016 Joyce Nzioki Phylogenetics The study of evolutionary relatedness of organisms. Derived from two Greek words:» Phle/Phylon: Tribe/Race» Genetikos:
More informationCSCI1950 Z Computa3onal Methods for Biology Lecture 24. Ben Raphael April 29, hgp://cs.brown.edu/courses/csci1950 z/ Network Mo3fs
CSCI1950 Z Computa3onal Methods for Biology Lecture 24 Ben Raphael April 29, 2009 hgp://cs.brown.edu/courses/csci1950 z/ Network Mo3fs Subnetworks with more occurrences than expected by chance. How to
More informationEvolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between
More informationCSCI1950 Z Computa4onal Methods for Biology Lecture 5
CSCI1950 Z Computa4onal Methods for Biology Lecture 5 Ben Raphael February 6, 2009 hip://cs.brown.edu/courses/csci1950 z/ Alignment vs. Distance Matrix Mouse: ACAGTGACGCCACACACGT Gorilla: CCTGCGACGTAACAAACGC
More informationCSCI1950 Z Computa4onal Methods for Biology Lecture 4. Ben Raphael February 2, hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary
CSCI1950 Z Computa4onal Methods for Biology Lecture 4 Ben Raphael February 2, 2009 hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary Parsimony Probabilis4c Method Input Output Sankoff s & Fitch
More informationLecture 11 Friday, October 21, 2011
Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system
More informationNetworks. Can (John) Bruce Keck Founda7on Biotechnology Lab Bioinforma7cs Resource
Networks Can (John) Bruce Keck Founda7on Biotechnology Lab Bioinforma7cs Resource Networks in biology Protein-Protein Interaction Network of Yeast Transcriptional regulatory network of E.coli Experimental
More informationPage 1. Evolutionary Trees. Why build evolutionary tree? Outline
Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny
More informationEvolutionary trees. Describe the relationship between objects, e.g. species or genes
Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies Anatomical features were the dominant
More informationPhylogeny: building the tree of life
Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan
More information"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky
MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally
More informationIntroduction to Bioinformatics
CSCI8980: Applied Machine Learning in Computational Biology Introduction to Bioinformatics Rui Kuang Department of Computer Science and Engineering University of Minnesota kuang@cs.umn.edu History of Bioinformatics
More informationGene Regulatory Networks II Computa.onal Genomics Seyoung Kim
Gene Regulatory Networks II 02-710 Computa.onal Genomics Seyoung Kim Goal: Discover Structure and Func;on of Complex systems in the Cell Identify the different regulators and their target genes that are
More informationC3020 Molecular Evolution. Exercises #3: Phylogenetics
C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from
More informationComparative Network Analysis
Comparative Network Analysis BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2016 Anthony Gitter gitter@biostat.wisc.edu These slides, excluding third-party material, are licensed under CC BY-NC 4.0 by
More informationBINF6201/8201. Molecular phylogenetic methods
BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics
More informationA (short) introduction to phylogenetics
A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field
More informationTheory of Evolution Charles Darwin
Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
More informationPOPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics
POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the
More informationGraph Alignment and Biological Networks
Graph Alignment and Biological Networks Johannes Berg http://www.uni-koeln.de/ berg Institute for Theoretical Physics University of Cologne Germany p.1/12 Networks in molecular biology New large-scale
More informationAlgorithms in Bioinformatics
Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods
More informationExamples of Phylogenetic Reconstruction
Examples of Phylogenetic Reconstruction 1. HIV transmission Recently, an HIV-positive Florida dentist was suspected of having transmitted the HIV virus to his dental patients. Although a number of his
More informationProcesses of Evolution
15 Processes of Evolution Forces of Evolution Concept 15.4 Selection Can Be Stabilizing, Directional, or Disruptive Natural selection can act on quantitative traits in three ways: Stabilizing selection
More informationA Phylogenetic Network Construction due to Constrained Recombination
A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer
More informationChapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships
Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic
More informationMul$ple Sequence Alignment Methods. Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu
Mul$ple Sequence Alignment Methods Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu Species Tree Orangutan Gorilla Chimpanzee Human From the Tree of the Life
More informationWhat is Phylogenetics
What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)
More informationCREATING PHYLOGENETIC TREES FROM DNA SEQUENCES
INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:
More informationSCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology
SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of
More informationConstructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
More informationAmira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut
Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological
More informationEvolutionary Tree Analysis. Overview
CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based
More informationList of Code Challenges. About the Textbook Meet the Authors... xix Meet the Development Team... xx Acknowledgments... xxi
Contents List of Code Challenges xvii About the Textbook xix Meet the Authors................................... xix Meet the Development Team............................ xx Acknowledgments..................................
More informationPhylogenetic Tree Reconstruction
I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven
More informationDr. Amira A. AL-Hosary
Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological
More informationSec$on 9. Evolu$onary Rela$onships
Sec$on 9 Evolu$onary Rela$onships Sec$on 9 Learning Goals Explain why the ribosomal 16S gene is a good marker for molecular phylogene$c comparisons. Be able to interpret a phylogene$c tree. Explain the
More informationPhylogenetic inference
Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types
More informationMolecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
More informationPhylogenetics: Building Phylogenetic Trees
1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should
More informationMolecular phylogeny How to infer phylogenetic trees using molecular sequences
Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues
More informationBiological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor
Biological Networks:,, and via Relative Description Length By: Tamir Tuller & Benny Chor Presented by: Noga Grebla Content of the presentation Presenting the goals of the research Reviewing basic terms
More informationIntroduction to Bioinformatics. Shifra Ben-Dor Irit Orr
Introduction to Bioinformatics Shifra Ben-Dor Irit Orr Lecture Outline: Technical Course Items Introduction to Bioinformatics Introduction to Databases This week and next week What is bioinformatics? A
More informationModern Evolutionary Classification. Section 18-2 pgs
Modern Evolutionary Classification Section 18-2 pgs 451-455 Modern Evolutionary Classification In a sense, organisms determine who belongs to their species by choosing with whom they will mate. Taxonomic
More informationAnnouncements. Topics: Work On: - sec0ons 1.2 and 1.3 * Read these sec0ons and study solved examples in your textbook!
Announcements Topics: - sec0ons 1.2 and 1.3 * Read these sec0ons and study solved examples in your textbook! Work On: - Prac0ce problems from the textbook and assignments from the coursepack as assigned
More informationPhylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University
Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary
More informationPhylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline
Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying
More informationAlgorithmic Methods Well-defined methodology Tree reconstruction those that are well-defined enough to be carried out by a computer. Felsenstein 2004,
Tracing the Evolution of Numerical Phylogenetics: History, Philosophy, and Significance Adam W. Ferguson Phylogenetic Systematics 26 January 2009 Inferring Phylogenies Historical endeavor Darwin- 1837
More informationTree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny
More informationAnnouncements. Topics: Homework: - sec0ons 1.2, 1.3, and 2.1 * Read these sec0ons and study solved examples in your textbook!
Announcements Topics: - sec0ons 1.2, 1.3, and 2.1 * Read these sec0ons and study solved examples in your textbook! Homework: - review lecture notes thoroughly - work on prac0ce problems from the textbook
More informationPhylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.
Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony
More informationTheory of Evolution. Charles Darwin
Theory of Evolution harles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (8-6) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties
More informationPhylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz
Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels
More informationnetworks in molecular biology Wolfgang Huber
networks in molecular biology Wolfgang Huber networks in molecular biology Regulatory networks: components = gene products interactions = regulation of transcription, translation, phosphorylation... Metabolic
More informationWarm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab
Date: Agenda Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab Ask questions based on 5.1 and 5.2 Quiz on 5.1 and 5.2 How
More informationBIOLOGY 432 Midterm I - 30 April PART I. Multiple choice questions (3 points each, 42 points total). Single best answer.
BIOLOGY 432 Midterm I - 30 April 2012 Name PART I. Multiple choice questions (3 points each, 42 points total). Single best answer. 1. Over time even the most highly conserved gene sequence will fix mutations.
More informationNetwork alignment and querying
Network biology minicourse (part 4) Algorithmic challenges in genomics Network alignment and querying Roded Sharan School of Computer Science, Tel Aviv University Multiple Species PPI Data Rapid growth
More informationMolecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016
Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,
More informationPhylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center
Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods
More informationC.DARWIN ( )
C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships
More informationPriors in Dependency network learning
Priors in Dependency network learning Sushmita Roy sroy@biostat.wisc.edu Computa:onal Network Biology Biosta2s2cs & Medical Informa2cs 826 Computer Sciences 838 hbps://compnetbiocourse.discovery.wisc.edu
More informationHomework Assignment, Evolutionary Systems Biology, Spring Homework Part I: Phylogenetics:
Homework Assignment, Evolutionary Systems Biology, Spring 2009. Homework Part I: Phylogenetics: Introduction. The objective of this assignment is to understand the basics of phylogenetic relationships
More informationHow should we organize the diversity of animal life?
How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)
More information8/23/2014. Phylogeny and the Tree of Life
Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major
More informationPhylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
More informationPhylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
More informationPhylogenetics. BIOL 7711 Computational Bioscience
Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium
More informationConstructing Evolutionary/Phylogenetic Trees
Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood
More informationEvolu&on, Popula&on Gene&cs, and Natural Selec&on Computa.onal Genomics Seyoung Kim
Evolu&on, Popula&on Gene&cs, and Natural Selec&on 02-710 Computa.onal Genomics Seyoung Kim Phylogeny of Mammals Phylogene&cs vs. Popula&on Gene&cs Phylogene.cs Assumes a single correct species phylogeny
More informationPhylogeny Fig Overview: Inves8ga8ng the Tree of Life Phylogeny Systema8cs
Ch. 26 Phylogeny BIOL 22 Fig. Fig.26 26 Overview: Inves8ga8ng the Tree of Life Phylogeny evoluonary history of a species or group of related species Systema8cs classifies organisms and determines their
More informationEVOLUTIONARY DISTANCES
EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:
More informationBioinformatics tools for phylogeny and visualization. Yanbin Yin
Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and
More information6.047 / Computational Biology: Genomes, Networks, Evolution Fall 2008
MIT OpenCourseWare http://ocw.mit.edu 6.047 / 6.878 Computational Biology: Genomes, Networks, Evolution Fall 2008 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms.
More informationCS 6140: Machine Learning Spring What We Learned Last Week 2/26/16
Logis@cs CS 6140: Machine Learning Spring 2016 Instructor: Lu Wang College of Computer and Informa@on Science Northeastern University Webpage: www.ccs.neu.edu/home/luwang Email: luwang@ccs.neu.edu Sign
More informationBioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony
ioinformatics -- lecture 9 Phylogenetic trees istance-based tree building Parsimony (,(,(,))) rees can be represented in "parenthesis notation". Each set of parentheses represents a branch-point (bifurcation),
More informationCasey Leonard. Multiregional model vs. Out of Africa theory SLCC
Casey Leonard Multiregional model vs. Out of Africa theory SLCC 2 It is debated where humans came from and how they spread across the world. Since people don't all look the same, or are categorized into
More informationPhylogenetic Trees. How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species?
Why? Phylogenetic Trees How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species? The saying Don t judge a book by its cover. could be applied
More informationPhylogenetic Analysis
Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)
More informationHow to read and make phylogenetic trees Zuzana Starostová
How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation
More informationPhylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science
Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.
More informationBasics on bioinforma-cs Lecture 7. Nunzio D Agostino
Basics on bioinforma-cs Lecture 7 Nunzio D Agostino nunzio.dagostino@entecra.it; nunzio.dagostino@gmail.com Multiple alignments One sequence plays coy a pair of homologous sequence whisper many aligned
More informationPHYLOGENY AND SYSTEMATICS
AP BIOLOGY EVOLUTION/HEREDITY UNIT Unit 1 Part 11 Chapter 26 Activity #15 NAME DATE PERIOD PHYLOGENY AND SYSTEMATICS PHYLOGENY Evolutionary history of species or group of related species SYSTEMATICS Study
More informationMETHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.
Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern
More informationComputational Biology Course Descriptions 12-14
Computational Biology Course Descriptions 12-14 Course Number and Title INTRODUCTORY COURSES BIO 311C: Introductory Biology I BIO 311D: Introductory Biology II BIO 325: Genetics CH 301: Principles of Chemistry
More informationPhylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them?
Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them? Carolus Linneaus:Systema Naturae (1735) Swedish botanist &
More informationEvolu&on Cont d. h:p:// content/uploads/2009/09/evolu&on.jpg. 7 th Grade Biology Mr. Joanides
Evolu&on Cont d h:p://www.buildamovement.com/blog/wp- content/uploads/2009/09/evolu&on.jpg 7 th Grade Biology Mr. Joanides The Fossil Record Fossil Preserved remains or markings lem by organisms that live
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein
More informationMultiple Sequence Alignment. Sequences
Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe
More informationTHEORY. Based on sequence Length According to the length of sequence being compared it is of following two types
Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between
More informationI. Short Answer Questions DO ALL QUESTIONS
EVOLUTION 313 FINAL EXAM Part 1 Saturday, 7 May 2005 page 1 I. Short Answer Questions DO ALL QUESTIONS SAQ #1. Please state and BRIEFLY explain the major objectives of this course in evolution. Recall
More informationPhylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?
Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species
More informationOverview: In addi:on to considering various summary sta:s:cs, it is also common to consider some visual display of the data Outline:
Lecture 2: Visual Display of Data Overview: In addi:on to considering various summary sta:s:cs, it is also common to consider some visual display of the data Outline: 1. Histograms 2. ScaCer Plots 3. Assignment
More informationBayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies
Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies 1 What is phylogeny? Essay written for the course in Markov Chains 2004 Torbjörn Karfunkel Phylogeny is the evolutionary development
More informationMichael Yaffe Lecture #5 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D
7.91 Lecture #5 Database Searching & Molecular Phylogenetics Michael Yaffe B C D B C D (((,B)C)D) Outline Distance Matrix Methods Neighbor-Joining Method and Related Neighbor Methods Maximum Likelihood
More information9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)
I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by
More informationPhylogenetics in the Age of Genomics: Prospects and Challenges
Phylogenetics in the Age of Genomics: Prospects and Challenges Antonis Rokas Department of Biological Sciences, Vanderbilt University http://as.vanderbilt.edu/rokaslab http://pubmed2wordle.appspot.com/
More informationBIOL 1010 Introduction to Biology: The Evolution and Diversity of Life. Spring 2011 Sections A & B
BIOL 1010 Introduction to Biology: The Evolution and Diversity of Life. Spring 2011 Sections A & B Steve Thompson: stthompson@valdosta.edu http://www.bioinfo4u.net 1 ʻTree of Life,ʼ ʻprimitive,ʼ ʻprogressʼ
More informationCHAPTERS 24-25: Evidence for Evolution and Phylogeny
CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology
More informationSupplementary Materials for
advances.sciencemag.org/cgi/content/full/1/8/e1500527/dc1 Supplementary Materials for A phylogenomic data-driven exploration of viral origins and evolution The PDF file includes: Arshan Nasir and Gustavo
More information