CSCI1950 Z Computa3onal Methods for Biology* (*Working Title) Lecture 1. Ben Raphael January 21, Course Par3culars

Size: px
Start display at page:

Download "CSCI1950 Z Computa3onal Methods for Biology* (*Working Title) Lecture 1. Ben Raphael January 21, Course Par3culars"

Transcription

1 CSCI1950 Z Computa3onal Methods for Biology* (*Working Title) Lecture 1 Ben Raphael January 21, 2009 Course Par3culars Three major topics 1. Phylogeny: ~50% lectures 2. Func3onal Genomics: ~25% lectures 3. Network/Systems Biology: ~25% lectures Tools Computer Science: Algorithms and discrete math (e.g. graph theory), Programming Mathema3cs: Discrete Probability, Linear algebra (vectors and matrices) Biology: Basics. (What is DNA?) 1

2 Course Par3culars Webpage h\p://cs.brown.edu/courses/csci1950 z/ [readings (including some background material) Textbook: None Assignments: mens et manus 1. 4 wri\en assignments: ~40% of grade 2. 3 programming assignments: ~40% of grade 3. Take home final: ~20% of grade Graduate credit Extra assignment/project Talk to me before March 1 Survey Topic 1: Phylogeny 2

3 Early Evolu3onary Studies 200 th Anniversary of birth of Charles Darwin From Origin of the Species (1859) Darwin 1960 s Anatomical features were the dominant criteria used to derive evolu3onary rela3onships between species. Imprecise, ofen subjec3ve, observa3ons ofen led to inconclusive, contradictory, or incorrect evolu3onary rela3onships between species Molecular data (DNA and protein sequences) drama3cally improved situa3on. 3

4 Species Trees Is a panda more closely related to a bear or a raccoon? Looks Hiberna3on Pa\ern Bear Raccoon ~100 years of arguments Tree derived from DNA sequence data. Steven O Brien et al. (1985) Human Evolu3onary History From: Molecular Evolu7on a Phylogene7c Approach, R. Page & E. Holmes 4

5 More Recent Human History Out of Africa Hypothesis: Most ancient ancestor lived in Africa roughly 200,000 years ago The Origin of Humans: Out of Africa vs Mul3regional Hypothesis Out of Africa: Humans evolved in Africa ~200,000 years ago Humans migrated out of Africa, replacing other humanoids around the globe Multiregional: Humans evolved in the last two million years as a single species. Independent appearance of modern traits in different areas Humans migrated out of Africa mixing with other humanoids on the way 5

6 Human Evolu3onary Tree DNA based reconstruc3on of the human evolu3onary tree Evolu3onary Tree of Humans (mtdna) Vigilant, Stoneking, Harpending, Hawkes, and Wilson (1991) African population is the most diverse (sub-populations had more time to diverge) Evolutionary tree separates one group of Africans from a group containing all five populations. Tree rooted on branch between groups of greatest difference. 6

7 Evolu3onary Tree of Humans: (microsatellites) Neighbor joining tree for 14 human populations genotyped with 30 microsatellite loci. Lineage of Genghis Kahn? In humans, Y chromosome passed from father only. Can be used to iden3fy parental lineages. ~8% of males in parts of Asia and 0.5% world wide es3mated to be descendants of a resident of Mongolia ~1000 years ago (Zerjal et al. AGHG 2003). 7

8 Lafaye\e, Louisiana, 1994: A woman claimed her exlover (who was a physician) injected her with HIV+ blood Records show the physician had drawn blood from an HIV+ pa3ent that day Is there a way to show that blood from that HIV + pa3ent ended up in the woman? HIV Transmission HIV has a high muta3on rate, which can be used to trace paths of transmission Two people who were infected from different sources will have very different HIV sequences Alignment of fourteen amino acid sequences from V3 region of HIV 1 gp120 genes Azizi et al. BMC Immunology :25 8

9 To the Lab! Wet lab Take mul3ple samples from the pa3ent, the woman, and controls (non related HIV+ people) Obtain DNA sequence from two HIV genes HIV (gp120 and RT). Computer lab Build phylogene3c tree from the DNA sequences. Phylogene3c Tree Convic3on Three different tree reconstruc3on techniques used. In every reconstruc3on, vic3m s sequences were related to pa3ent s sequences. Nes3ng of the vic3m s sequences within the pa3ent sequence indicated the direc3on of transmission was from pa3ent to vic3m First 3me phylogene3c analysis was used in a court case as evidence (Metzker, et. al., 2002) 9

10 Phylogene3c Trees How to build a phylogene7c tree from data? Data 1. Characters/Features 2. Pairwise distances Algorithm Phylogene3c Trees What is a phylogene7c tree? Biology definition: None (picture) A branching diagram Intuition: Leaves represent existing species Branch points represent most recent common ancestor. Length of branches represent evolutionary time. Root represents the oldest evolutionary ancestor. 10

11 Phylogene3c Trees What is a phylogene7c tree? Computer science definition tree: A connected acyclic graph G = (V, E). graph: A set V of vertices and a set E of edges, where each edge connects a pair of vertices. Tree Defini3ons tree: A connected acyclic graph G = (V, E). graph: A set V of vertices and a set E of edges, where each edge (v i, v j ) connects a pair of vertices. A path in G is a sequence (v 1, v 2,, v n ) of vertices in V such that (v i, v i+1 ) are edges in E. A graph is connected provided for every pair v i v j of vertices, there is a path between v i and v j. A cycle is a path with the same starting and ending vertices. A graph is acyclic provided it has no cycles. 11

12 Tree Defini3ons tree: A connected acyclic graph G = (V, E). degree of vertex v is the number of edges incident to v. A phylogenetic tree is a tree with a label for each leaf (vertex of degree one). A binary phylogenetic tree is a phylogenetic tree where every interior (non-leaf) vertex has degree 3; i.e. two children. A rooted (*binary) phylogenetic tree is phylogenetic tree with a single designated vertex r (* of degree 2) Rooted and Unrooted Trees In the unrooted tree the position of the root ( oldest ancestor ) is unknown. Otherwise, they are like rooted trees 12

13 Evalua3ng Different Phylogenies Value1 Value2 Mouth Smile Frown Eyebrows Normal Pointed Character Based Tree Reconstruc3on Which tree is beher? 13

14 Character Based Tree Reconstruc3on Count changes on tree Character Based Tree Reconstruc3on Parsimony: minimize number of changes on edges of tree 14

15 Character Based Tree Reconstruc3on Maximum Likelihood: Given Pr[change], what is tree with maximum probability? Iden3fying Highest Scoring Tree Naïve, exhaus3ve Algorithm: check all trees. How many possibili3es? Restrict to binary trees. 15

16 Phylogene3c Trees How to efficiently build trees from data? Data 1. Characters/Features 2. Pairwise distances Phylogene3c Trees How to efficiently build trees from data? Methods 1. Characters/Features Parsimony: Minimum number of changes Probabilistic Model 2. Pairwise distances Clustering (UPGMA, Neighbor joining, ) 16

17 Addi3onal Models and Extensions Comparing trees Distances between trees. Sta3s3cal tests: bootstrap, permuta3on tests, etc. Supertrees and consensus Gene trees vs. species trees. Whole genome phylogeny. Topic 2: Func3onal Genomics 17

18 Biology 101 Biology 101 Central Dogma 18

19 What can we measure? Sequencing (expensive) Hybridiza3on (noisy) Sequencing (expensive) Hybridiza3on (noisy) Mass spectrometry (noisy) Hybridiza3on (very noisy!) DNA Basepairing 19

20 DNA Microarrays Clustering of Gene Expression Each microarray experiment: expression vector u = (u 1,, u n ) u i = expression value for each gene. Group similar vectors. Samples Gene expression BMC Genomics 2006, 7:279 20

21 Clustering Clustering algorithms related to distance based phylogene3c algorithms. Phylogeny gives grouping of related data points Binary classifica@on Given a set of examples (x i, y i ), where y i = + 1, from unknown distribu3on D. Design func3on f: R n { 1,+1} that assigns addi3onal samples x i to one of two classes op7mally. Classifica3on 21

22 Topics Methods for Clustering Hierarchical, Matrix based (PCA), Graph based (Clique finding) Methods for Classifica3on Nearest neighbors, support vector machines Data Integra3on: Bayesian Networks Topic 3: Network and Systems Biology 22

23 Biological Interac3on Networks Many types: Protein DNA (regulatory) Protein metabolite (metabolic) Protein protein (signaling) RNA RNA (regulatory) Gene3c interac3ons (gene knockouts) Regulatory Networks 23

24 Cis regulatory Network Metabolic Networks Nodes = reactants Edges = reac3ons labeled by enzyme (protein) that catalyzes reac3on 24

25 Protein Protein (PPI) Network Protein Protein Interac3on Network? Proteins are nodes Interac3ons are edges Edges may have weights Yeast PPI network H. Jeong et al. Nature 411, 41 (2001) 25

26 Computa3onal Problems 1. Classifying Network Topology Finding paths, cliques, dense subnetworks, etc. 2. Comparing Networks Across Species 3. Using networks to explain data Dependencies revealed by network topology 4. Modeling dynamics of networks Network Mo3fs Subnetworks with more occurrences than expected by chance. How to find? How to assess sta3s3cal significance? Shen Orr et al

27 Network Alignment Sharan and Ideker. Modeling cellular machinery through biological network comparison. Nature Biotechnology 24, pp , 2006 The Network Alignment Problem Given: k different interac3on networks belonging to different species, Find: Conserved sub networks within these networks Conserved defined by protein sequence similarity (node similarity) and interac3on similarity (network topology similarity) 27

28 Protein Signaling Networks Art Salomon Biology Department Use machine learning methods (Bayesian networks, etc. to derive network structure. Course Themes Topics: Phylogeny, Func3onal Genomics, Systems & Network Biology Mixture of theory and prac3ce (real data) Graph algorithms: Path and clique finding, isomorphism, heavy subgraphs, matching, vertex cover, spanning and Steiner problems, etc. Hypothesis tes3ng, permuta3on tests, bootstrap and resampling, enrichment (hypergeometric), etc. Data Mining and Machine Learning: Clustering and Classifica3on 28

29 Sources h\p://bioalgorithms.info (por3ons of Out of Africa and character phylogeny slides) 29

Phylogeny and Molecular Evolution. Introduction

Phylogeny and Molecular Evolution. Introduction Phylogeny and Molecular Evolution Introduction 1 Credit Serafim Batzoglou (UPGMA slides) http://www.stanford.edu/class/cs262/slides Notes by Nir Friedman, Dan Geiger, Shlomo Moran, Ron Shamir, Sagi Snir,

More information

Phylogeny and Molecular Evolution. Introduction

Phylogeny and Molecular Evolution. Introduction Phylogeny and Molecular Evolution Introduction 1 2/62 3/62 Credit Serafim Batzoglou (UPGMA slides) http://www.stanford.edu/class/cs262/slides Notes by Nir Friedman, Dan Geiger, Shlomo Moran, Ron Shamir,

More information

Phylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki

Phylogene)cs. IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, Joyce Nzioki Phylogene)cs IMBB 2016 BecA- ILRI Hub, Nairobi May 9 20, 2016 Joyce Nzioki Phylogenetics The study of evolutionary relatedness of organisms. Derived from two Greek words:» Phle/Phylon: Tribe/Race» Genetikos:

More information

CSCI1950 Z Computa3onal Methods for Biology Lecture 24. Ben Raphael April 29, hgp://cs.brown.edu/courses/csci1950 z/ Network Mo3fs

CSCI1950 Z Computa3onal Methods for Biology Lecture 24. Ben Raphael April 29, hgp://cs.brown.edu/courses/csci1950 z/ Network Mo3fs CSCI1950 Z Computa3onal Methods for Biology Lecture 24 Ben Raphael April 29, 2009 hgp://cs.brown.edu/courses/csci1950 z/ Network Mo3fs Subnetworks with more occurrences than expected by chance. How to

More information

Evolutionary trees. Describe the relationship between objects, e.g. species or genes

Evolutionary trees. Describe the relationship between objects, e.g. species or genes Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies The evolutionary relationships between

More information

CSCI1950 Z Computa4onal Methods for Biology Lecture 5

CSCI1950 Z Computa4onal Methods for Biology Lecture 5 CSCI1950 Z Computa4onal Methods for Biology Lecture 5 Ben Raphael February 6, 2009 hip://cs.brown.edu/courses/csci1950 z/ Alignment vs. Distance Matrix Mouse: ACAGTGACGCCACACACGT Gorilla: CCTGCGACGTAACAAACGC

More information

CSCI1950 Z Computa4onal Methods for Biology Lecture 4. Ben Raphael February 2, hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary

CSCI1950 Z Computa4onal Methods for Biology Lecture 4. Ben Raphael February 2, hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary CSCI1950 Z Computa4onal Methods for Biology Lecture 4 Ben Raphael February 2, 2009 hhp://cs.brown.edu/courses/csci1950 z/ Algorithm Summary Parsimony Probabilis4c Method Input Output Sankoff s & Fitch

More information

Lecture 11 Friday, October 21, 2011

Lecture 11 Friday, October 21, 2011 Lecture 11 Friday, October 21, 2011 Phylogenetic tree (phylogeny) Darwin and classification: In the Origin, Darwin said that descent from a common ancestral species could explain why the Linnaean system

More information

Networks. Can (John) Bruce Keck Founda7on Biotechnology Lab Bioinforma7cs Resource

Networks. Can (John) Bruce Keck Founda7on Biotechnology Lab Bioinforma7cs Resource Networks Can (John) Bruce Keck Founda7on Biotechnology Lab Bioinforma7cs Resource Networks in biology Protein-Protein Interaction Network of Yeast Transcriptional regulatory network of E.coli Experimental

More information

Page 1. Evolutionary Trees. Why build evolutionary tree? Outline

Page 1. Evolutionary Trees. Why build evolutionary tree? Outline Page Evolutionary Trees Russ. ltman MI S 7 Outline. Why build evolutionary trees?. istance-based vs. character-based methods. istance-based: Ultrametric Trees dditive Trees. haracter-based: Perfect phylogeny

More information

Evolutionary trees. Describe the relationship between objects, e.g. species or genes

Evolutionary trees. Describe the relationship between objects, e.g. species or genes Evolutionary trees Bonobo Chimpanzee Human Neanderthal Gorilla Orangutan Describe the relationship between objects, e.g. species or genes Early evolutionary studies Anatomical features were the dominant

More information

Phylogeny: building the tree of life

Phylogeny: building the tree of life Phylogeny: building the tree of life Dr. Fayyaz ul Amir Afsar Minhas Department of Computer and Information Sciences Pakistan Institute of Engineering & Applied Sciences PO Nilore, Islamabad, Pakistan

More information

"Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky

Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky MOLECULAR PHYLOGENY "Nothing in biology makes sense except in the light of evolution Theodosius Dobzhansky EVOLUTION - theory that groups of organisms change over time so that descendeants differ structurally

More information

Introduction to Bioinformatics

Introduction to Bioinformatics CSCI8980: Applied Machine Learning in Computational Biology Introduction to Bioinformatics Rui Kuang Department of Computer Science and Engineering University of Minnesota kuang@cs.umn.edu History of Bioinformatics

More information

Gene Regulatory Networks II Computa.onal Genomics Seyoung Kim

Gene Regulatory Networks II Computa.onal Genomics Seyoung Kim Gene Regulatory Networks II 02-710 Computa.onal Genomics Seyoung Kim Goal: Discover Structure and Func;on of Complex systems in the Cell Identify the different regulators and their target genes that are

More information

C3020 Molecular Evolution. Exercises #3: Phylogenetics

C3020 Molecular Evolution. Exercises #3: Phylogenetics C3020 Molecular Evolution Exercises #3: Phylogenetics Consider the following sequences for five taxa 1-5 and the known outgroup O, which has the ancestral states (note that sequence 3 has changed from

More information

Comparative Network Analysis

Comparative Network Analysis Comparative Network Analysis BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2016 Anthony Gitter gitter@biostat.wisc.edu These slides, excluding third-party material, are licensed under CC BY-NC 4.0 by

More information

BINF6201/8201. Molecular phylogenetic methods

BINF6201/8201. Molecular phylogenetic methods BINF60/80 Molecular phylogenetic methods 0-7-06 Phylogenetics Ø According to the evolutionary theory, all life forms on this planet are related to one another by descent. Ø Traditionally, phylogenetics

More information

A (short) introduction to phylogenetics

A (short) introduction to phylogenetics A (short) introduction to phylogenetics Thibaut Jombart, Marie-Pauline Beugin MRC Centre for Outbreak Analysis and Modelling Imperial College London Genetic data analysis with PR Statistics, Millport Field

More information

Theory of Evolution Charles Darwin

Theory of Evolution Charles Darwin Theory of Evolution Charles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (83-36) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties

More information

POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics

POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics POPULATION GENETICS Winter 2005 Lecture 17 Molecular phylogenetics - in deriving a phylogeny our goal is simply to reconstruct the historical relationships between a group of taxa. - before we review the

More information

Graph Alignment and Biological Networks

Graph Alignment and Biological Networks Graph Alignment and Biological Networks Johannes Berg http://www.uni-koeln.de/ berg Institute for Theoretical Physics University of Cologne Germany p.1/12 Networks in molecular biology New large-scale

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods

More information

Examples of Phylogenetic Reconstruction

Examples of Phylogenetic Reconstruction Examples of Phylogenetic Reconstruction 1. HIV transmission Recently, an HIV-positive Florida dentist was suspected of having transmitted the HIV virus to his dental patients. Although a number of his

More information

Processes of Evolution

Processes of Evolution 15 Processes of Evolution Forces of Evolution Concept 15.4 Selection Can Be Stabilizing, Directional, or Disruptive Natural selection can act on quantitative traits in three ways: Stabilizing selection

More information

A Phylogenetic Network Construction due to Constrained Recombination

A Phylogenetic Network Construction due to Constrained Recombination A Phylogenetic Network Construction due to Constrained Recombination Mohd. Abdul Hai Zahid Research Scholar Research Supervisors: Dr. R.C. Joshi Dr. Ankush Mittal Department of Electronics and Computer

More information

Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships

Chapter 26: Phylogeny and the Tree of Life Phylogenies Show Evolutionary Relationships Chapter 26: Phylogeny and the Tree of Life You Must Know The taxonomic categories and how they indicate relatedness. How systematics is used to develop phylogenetic trees. How to construct a phylogenetic

More information

Mul$ple Sequence Alignment Methods. Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu

Mul$ple Sequence Alignment Methods. Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu Mul$ple Sequence Alignment Methods Tandy Warnow Departments of Bioengineering and Computer Science h?p://tandy.cs.illinois.edu Species Tree Orangutan Gorilla Chimpanzee Human From the Tree of the Life

More information

What is Phylogenetics

What is Phylogenetics What is Phylogenetics Phylogenetics is the area of research concerned with finding the genetic connections and relationships between species. The basic idea is to compare specific characters (features)

More information

CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES

CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES INTRODUCTION CREATING PHYLOGENETIC TREES FROM DNA SEQUENCES This worksheet complements the Click and Learn developed in conjunction with the 2011 Holiday Lectures on Science, Bones, Stones, and Genes:

More information

SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology

SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION. Using Anatomy, Embryology, Biochemistry, and Paleontology SCIENTIFIC EVIDENCE TO SUPPORT THE THEORY OF EVOLUTION Using Anatomy, Embryology, Biochemistry, and Paleontology Scientific Fields Different fields of science have contributed evidence for the theory of

More information

Constructing Evolutionary/Phylogenetic Trees

Constructing Evolutionary/Phylogenetic Trees Constructing Evolutionary/Phylogenetic Trees 2 broad categories: istance-based methods Ultrametric Additive: UPGMA Transformed istance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood

More information

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological

More information

Evolutionary Tree Analysis. Overview

Evolutionary Tree Analysis. Overview CSI/BINF 5330 Evolutionary Tree Analysis Young-Rae Cho Associate Professor Department of Computer Science Baylor University Overview Backgrounds Distance-Based Evolutionary Tree Reconstruction Character-Based

More information

List of Code Challenges. About the Textbook Meet the Authors... xix Meet the Development Team... xx Acknowledgments... xxi

List of Code Challenges. About the Textbook Meet the Authors... xix Meet the Development Team... xx Acknowledgments... xxi Contents List of Code Challenges xvii About the Textbook xix Meet the Authors................................... xix Meet the Development Team............................ xx Acknowledgments..................................

More information

Phylogenetic Tree Reconstruction

Phylogenetic Tree Reconstruction I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven

More information

Dr. Amira A. AL-Hosary

Dr. Amira A. AL-Hosary Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

More information

Sec$on 9. Evolu$onary Rela$onships

Sec$on 9. Evolu$onary Rela$onships Sec$on 9 Evolu$onary Rela$onships Sec$on 9 Learning Goals Explain why the ribosomal 16S gene is a good marker for molecular phylogene$c comparisons. Be able to interpret a phylogene$c tree. Explain the

More information

Phylogenetic inference

Phylogenetic inference Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types

More information

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

More information

Phylogenetics: Building Phylogenetic Trees

Phylogenetics: Building Phylogenetic Trees 1 Phylogenetics: Building Phylogenetic Trees COMP 571 Luay Nakhleh, Rice University 2 Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary model should

More information

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

More information

Biological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor

Biological Networks: Comparison, Conservation, and Evolution via Relative Description Length By: Tamir Tuller & Benny Chor Biological Networks:,, and via Relative Description Length By: Tamir Tuller & Benny Chor Presented by: Noga Grebla Content of the presentation Presenting the goals of the research Reviewing basic terms

More information

Introduction to Bioinformatics. Shifra Ben-Dor Irit Orr

Introduction to Bioinformatics. Shifra Ben-Dor Irit Orr Introduction to Bioinformatics Shifra Ben-Dor Irit Orr Lecture Outline: Technical Course Items Introduction to Bioinformatics Introduction to Databases This week and next week What is bioinformatics? A

More information

Modern Evolutionary Classification. Section 18-2 pgs

Modern Evolutionary Classification. Section 18-2 pgs Modern Evolutionary Classification Section 18-2 pgs 451-455 Modern Evolutionary Classification In a sense, organisms determine who belongs to their species by choosing with whom they will mate. Taxonomic

More information

Announcements. Topics: Work On: - sec0ons 1.2 and 1.3 * Read these sec0ons and study solved examples in your textbook!

Announcements. Topics: Work On: - sec0ons 1.2 and 1.3 * Read these sec0ons and study solved examples in your textbook! Announcements Topics: - sec0ons 1.2 and 1.3 * Read these sec0ons and study solved examples in your textbook! Work On: - Prac0ce problems from the textbook and assignments from the coursepack as assigned

More information

Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University

Phylogenetics: Building Phylogenetic Trees. COMP Fall 2010 Luay Nakhleh, Rice University Phylogenetics: Building Phylogenetic Trees COMP 571 - Fall 2010 Luay Nakhleh, Rice University Four Questions Need to be Answered What data should we use? Which method should we use? Which evolutionary

More information

Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline

Phylogenetics. Applications of phylogenetics. Unrooted networks vs. rooted trees. Outline Phylogenetics Todd Vision iology 522 March 26, 2007 pplications of phylogenetics Studying organismal or biogeographic history Systematics ating events in the fossil record onservation biology Studying

More information

Algorithmic Methods Well-defined methodology Tree reconstruction those that are well-defined enough to be carried out by a computer. Felsenstein 2004,

Algorithmic Methods Well-defined methodology Tree reconstruction those that are well-defined enough to be carried out by a computer. Felsenstein 2004, Tracing the Evolution of Numerical Phylogenetics: History, Philosophy, and Significance Adam W. Ferguson Phylogenetic Systematics 26 January 2009 Inferring Phylogenies Historical endeavor Darwin- 1837

More information

Tree of Life iological Sequence nalysis Chapter http://tolweb.org/tree/ Phylogenetic Prediction ll organisms on Earth have a common ancestor. ll species are related. The relationship is called a phylogeny

More information

Announcements. Topics: Homework: - sec0ons 1.2, 1.3, and 2.1 * Read these sec0ons and study solved examples in your textbook!

Announcements. Topics: Homework: - sec0ons 1.2, 1.3, and 2.1 * Read these sec0ons and study solved examples in your textbook! Announcements Topics: - sec0ons 1.2, 1.3, and 2.1 * Read these sec0ons and study solved examples in your textbook! Homework: - review lecture notes thoroughly - work on prac0ce problems from the textbook

More information

Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5.

Phylogenetic Trees. Phylogenetic Trees Five. Phylogeny: Inference Tool. Phylogeny Terminology. Picture of Last Quagga. Importance of Phylogeny 5. Five Sami Khuri Department of Computer Science San José State University San José, California, USA sami.khuri@sjsu.edu v Distance Methods v Character Methods v Molecular Clock v UPGMA v Maximum Parsimony

More information

Theory of Evolution. Charles Darwin

Theory of Evolution. Charles Darwin Theory of Evolution harles arwin 858-59: Origin of Species 5 year voyage of H.M.S. eagle (8-6) Populations have variations. Natural Selection & Survival of the fittest: nature selects best adapted varieties

More information

Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz

Phylogenetic Trees. What They Are Why We Do It & How To Do It. Presented by Amy Harris Dr Brad Morantz Phylogenetic Trees What They Are Why We Do It & How To Do It Presented by Amy Harris Dr Brad Morantz Overview What is a phylogenetic tree Why do we do it How do we do it Methods and programs Parallels

More information

networks in molecular biology Wolfgang Huber

networks in molecular biology Wolfgang Huber networks in molecular biology Wolfgang Huber networks in molecular biology Regulatory networks: components = gene products interactions = regulation of transcription, translation, phosphorylation... Metabolic

More information

Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab

Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab Date: Agenda Warm-Up- Review Natural Selection and Reproduction for quiz today!!!! Notes on Evidence of Evolution Work on Vocabulary and Lab Ask questions based on 5.1 and 5.2 Quiz on 5.1 and 5.2 How

More information

BIOLOGY 432 Midterm I - 30 April PART I. Multiple choice questions (3 points each, 42 points total). Single best answer.

BIOLOGY 432 Midterm I - 30 April PART I. Multiple choice questions (3 points each, 42 points total). Single best answer. BIOLOGY 432 Midterm I - 30 April 2012 Name PART I. Multiple choice questions (3 points each, 42 points total). Single best answer. 1. Over time even the most highly conserved gene sequence will fix mutations.

More information

Network alignment and querying

Network alignment and querying Network biology minicourse (part 4) Algorithmic challenges in genomics Network alignment and querying Roded Sharan School of Computer Science, Tel Aviv University Multiple Species PPI Data Rapid growth

More information

Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016

Molecular phylogeny - Using molecular sequences to infer evolutionary relationships. Tore Samuelsson Feb 2016 Molecular phylogeny - Using molecular sequences to infer evolutionary relationships Tore Samuelsson Feb 2016 Molecular phylogeny is being used in the identification and characterization of new pathogens,

More information

Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center

Phylogenetic Analysis. Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Phylogenetic Analysis Han Liang, Ph.D. Assistant Professor of Bioinformatics and Computational Biology UT MD Anderson Cancer Center Outline Basic Concepts Tree Construction Methods Distance-based methods

More information

C.DARWIN ( )

C.DARWIN ( ) C.DARWIN (1809-1882) LAMARCK Each evolutionary lineage has evolved, transforming itself, from a ancestor appeared by spontaneous generation DARWIN All organisms are historically interconnected. Their relationships

More information

Priors in Dependency network learning

Priors in Dependency network learning Priors in Dependency network learning Sushmita Roy sroy@biostat.wisc.edu Computa:onal Network Biology Biosta2s2cs & Medical Informa2cs 826 Computer Sciences 838 hbps://compnetbiocourse.discovery.wisc.edu

More information

Homework Assignment, Evolutionary Systems Biology, Spring Homework Part I: Phylogenetics:

Homework Assignment, Evolutionary Systems Biology, Spring Homework Part I: Phylogenetics: Homework Assignment, Evolutionary Systems Biology, Spring 2009. Homework Part I: Phylogenetics: Introduction. The objective of this assignment is to understand the basics of phylogenetic relationships

More information

How should we organize the diversity of animal life?

How should we organize the diversity of animal life? How should we organize the diversity of animal life? The difference between Taxonomy Linneaus, and Cladistics Darwin What are phylogenies? How do we read them? How do we estimate them? Classification (Taxonomy)

More information

8/23/2014. Phylogeny and the Tree of Life

8/23/2014. Phylogeny and the Tree of Life Phylogeny and the Tree of Life Chapter 26 Objectives Explain the following characteristics of the Linnaean system of classification: a. binomial nomenclature b. hierarchical classification List the major

More information

Phylogenetic Analysis

Phylogenetic Analysis Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)

More information

Phylogenetic Analysis

Phylogenetic Analysis Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)

More information

Phylogenetics. BIOL 7711 Computational Bioscience

Phylogenetics. BIOL 7711 Computational Bioscience Consortium for Comparative Genomics! University of Colorado School of Medicine Phylogenetics BIOL 7711 Computational Bioscience Biochemistry and Molecular Genetics Computational Bioscience Program Consortium

More information

Constructing Evolutionary/Phylogenetic Trees

Constructing Evolutionary/Phylogenetic Trees Constructing Evolutionary/Phylogenetic Trees 2 broad categories: Distance-based methods Ultrametric Additive: UPGMA Transformed Distance Neighbor-Joining Character-based Maximum Parsimony Maximum Likelihood

More information

Evolu&on, Popula&on Gene&cs, and Natural Selec&on Computa.onal Genomics Seyoung Kim

Evolu&on, Popula&on Gene&cs, and Natural Selec&on Computa.onal Genomics Seyoung Kim Evolu&on, Popula&on Gene&cs, and Natural Selec&on 02-710 Computa.onal Genomics Seyoung Kim Phylogeny of Mammals Phylogene&cs vs. Popula&on Gene&cs Phylogene.cs Assumes a single correct species phylogeny

More information

Phylogeny Fig Overview: Inves8ga8ng the Tree of Life Phylogeny Systema8cs

Phylogeny Fig Overview: Inves8ga8ng the Tree of Life Phylogeny Systema8cs Ch. 26 Phylogeny BIOL 22 Fig. Fig.26 26 Overview: Inves8ga8ng the Tree of Life Phylogeny evoluonary history of a species or group of related species Systema8cs classifies organisms and determines their

More information

EVOLUTIONARY DISTANCES

EVOLUTIONARY DISTANCES EVOLUTIONARY DISTANCES FROM STRINGS TO TREES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 14 th November 2007 OUTLINE 1 STRINGS:

More information

Bioinformatics tools for phylogeny and visualization. Yanbin Yin

Bioinformatics tools for phylogeny and visualization. Yanbin Yin Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and

More information

6.047 / Computational Biology: Genomes, Networks, Evolution Fall 2008

6.047 / Computational Biology: Genomes, Networks, Evolution Fall 2008 MIT OpenCourseWare http://ocw.mit.edu 6.047 / 6.878 Computational Biology: Genomes, Networks, Evolution Fall 2008 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms.

More information

CS 6140: Machine Learning Spring What We Learned Last Week 2/26/16

CS 6140: Machine Learning Spring What We Learned Last Week 2/26/16 Logis@cs CS 6140: Machine Learning Spring 2016 Instructor: Lu Wang College of Computer and Informa@on Science Northeastern University Webpage: www.ccs.neu.edu/home/luwang Email: luwang@ccs.neu.edu Sign

More information

Bioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony

Bioinformatics 1 -- lecture 9. Phylogenetic trees Distance-based tree building Parsimony ioinformatics -- lecture 9 Phylogenetic trees istance-based tree building Parsimony (,(,(,))) rees can be represented in "parenthesis notation". Each set of parentheses represents a branch-point (bifurcation),

More information

Casey Leonard. Multiregional model vs. Out of Africa theory SLCC

Casey Leonard. Multiregional model vs. Out of Africa theory SLCC Casey Leonard Multiregional model vs. Out of Africa theory SLCC 2 It is debated where humans came from and how they spread across the world. Since people don't all look the same, or are categorized into

More information

Phylogenetic Trees. How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species?

Phylogenetic Trees. How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species? Why? Phylogenetic Trees How do the changes in gene sequences allow us to reconstruct the evolutionary relationships between related species? The saying Don t judge a book by its cover. could be applied

More information

Phylogenetic Analysis

Phylogenetic Analysis Phylogenetic Analysis Aristotle Through classification, one might discover the essence and purpose of species. Nelson & Platnick (1981) Systematics and Biogeography Carl Linnaeus Swedish botanist (1700s)

More information

How to read and make phylogenetic trees Zuzana Starostová

How to read and make phylogenetic trees Zuzana Starostová How to read and make phylogenetic trees Zuzana Starostová How to make phylogenetic trees? Workflow: obtain DNA sequence quality check sequence alignment calculating genetic distances phylogeny estimation

More information

Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science

Phylogeny and Evolution. Gina Cannarozzi ETH Zurich Institute of Computational Science Phylogeny and Evolution Gina Cannarozzi ETH Zurich Institute of Computational Science History Aristotle (384-322 BC) classified animals. He found that dolphins do not belong to the fish but to the mammals.

More information

Basics on bioinforma-cs Lecture 7. Nunzio D Agostino

Basics on bioinforma-cs Lecture 7. Nunzio D Agostino Basics on bioinforma-cs Lecture 7 Nunzio D Agostino nunzio.dagostino@entecra.it; nunzio.dagostino@gmail.com Multiple alignments One sequence plays coy a pair of homologous sequence whisper many aligned

More information

PHYLOGENY AND SYSTEMATICS

PHYLOGENY AND SYSTEMATICS AP BIOLOGY EVOLUTION/HEREDITY UNIT Unit 1 Part 11 Chapter 26 Activity #15 NAME DATE PERIOD PHYLOGENY AND SYSTEMATICS PHYLOGENY Evolutionary history of species or group of related species SYSTEMATICS Study

More information

METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task.

METHODS FOR DETERMINING PHYLOGENY. In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Chapter 12 (Strikberger) Molecular Phylogenies and Evolution METHODS FOR DETERMINING PHYLOGENY In Chapter 11, we discovered that classifying organisms into groups was, and still is, a difficult task. Modern

More information

Computational Biology Course Descriptions 12-14

Computational Biology Course Descriptions 12-14 Computational Biology Course Descriptions 12-14 Course Number and Title INTRODUCTORY COURSES BIO 311C: Introductory Biology I BIO 311D: Introductory Biology II BIO 325: Genetics CH 301: Principles of Chemistry

More information

Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them?

Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them? Phylogenies & Classifying species (AKA Cladistics & Taxonomy) What are phylogenies & cladograms? How do we read them? How do we estimate them? Carolus Linneaus:Systema Naturae (1735) Swedish botanist &

More information

Evolu&on Cont d. h:p:// content/uploads/2009/09/evolu&on.jpg. 7 th Grade Biology Mr. Joanides

Evolu&on Cont d. h:p://  content/uploads/2009/09/evolu&on.jpg. 7 th Grade Biology Mr. Joanides Evolu&on Cont d h:p://www.buildamovement.com/blog/wp- content/uploads/2009/09/evolu&on.jpg 7 th Grade Biology Mr. Joanides The Fossil Record Fossil Preserved remains or markings lem by organisms that live

More information

CISC 636 Computational Biology & Bioinformatics (Fall 2016)

CISC 636 Computational Biology & Bioinformatics (Fall 2016) CISC 636 Computational Biology & Bioinformatics (Fall 2016) Predicting Protein-Protein Interactions CISC636, F16, Lec22, Liao 1 Background Proteins do not function as isolated entities. Protein-Protein

More information

Multiple Sequence Alignment. Sequences

Multiple Sequence Alignment. Sequences Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe

More information

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between

More information

I. Short Answer Questions DO ALL QUESTIONS

I. Short Answer Questions DO ALL QUESTIONS EVOLUTION 313 FINAL EXAM Part 1 Saturday, 7 May 2005 page 1 I. Short Answer Questions DO ALL QUESTIONS SAQ #1. Please state and BRIEFLY explain the major objectives of this course in evolution. Recall

More information

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other?

Phylogeny and systematics. Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Why are these disciplines important in evolutionary biology and how are they related to each other? Phylogeny and systematics Phylogeny: the evolutionary history of a species

More information

Overview: In addi:on to considering various summary sta:s:cs, it is also common to consider some visual display of the data Outline:

Overview: In addi:on to considering various summary sta:s:cs, it is also common to consider some visual display of the data Outline: Lecture 2: Visual Display of Data Overview: In addi:on to considering various summary sta:s:cs, it is also common to consider some visual display of the data Outline: 1. Histograms 2. ScaCer Plots 3. Assignment

More information

Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies

Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies Bayesian Inference using Markov Chain Monte Carlo in Phylogenetic Studies 1 What is phylogeny? Essay written for the course in Markov Chains 2004 Torbjörn Karfunkel Phylogeny is the evolutionary development

More information

Michael Yaffe Lecture #5 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D

Michael Yaffe Lecture #5 (((A,B)C)D) Database Searching & Molecular Phylogenetics A B C D B C D 7.91 Lecture #5 Database Searching & Molecular Phylogenetics Michael Yaffe B C D B C D (((,B)C)D) Outline Distance Matrix Methods Neighbor-Joining Method and Related Neighbor Methods Maximum Likelihood

More information

9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)

9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree) I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by

More information

Phylogenetics in the Age of Genomics: Prospects and Challenges

Phylogenetics in the Age of Genomics: Prospects and Challenges Phylogenetics in the Age of Genomics: Prospects and Challenges Antonis Rokas Department of Biological Sciences, Vanderbilt University http://as.vanderbilt.edu/rokaslab http://pubmed2wordle.appspot.com/

More information

BIOL 1010 Introduction to Biology: The Evolution and Diversity of Life. Spring 2011 Sections A & B

BIOL 1010 Introduction to Biology: The Evolution and Diversity of Life. Spring 2011 Sections A & B BIOL 1010 Introduction to Biology: The Evolution and Diversity of Life. Spring 2011 Sections A & B Steve Thompson: stthompson@valdosta.edu http://www.bioinfo4u.net 1 ʻTree of Life,ʼ ʻprimitive,ʼ ʻprogressʼ

More information

CHAPTERS 24-25: Evidence for Evolution and Phylogeny

CHAPTERS 24-25: Evidence for Evolution and Phylogeny CHAPTERS 24-25: Evidence for Evolution and Phylogeny 1. For each of the following, indicate how it is used as evidence of evolution by natural selection or shown as an evolutionary trend: a. Paleontology

More information

Supplementary Materials for

Supplementary Materials for advances.sciencemag.org/cgi/content/full/1/8/e1500527/dc1 Supplementary Materials for A phylogenomic data-driven exploration of viral origins and evolution The PDF file includes: Arshan Nasir and Gustavo

More information