Objectives. Comparison and Analysis of Heat Shock Proteins in Organisms of the Kingdom Viridiplantae. Emily Germain 1,2 Mentor Dr.

Size: px
Start display at page:

Download "Objectives. Comparison and Analysis of Heat Shock Proteins in Organisms of the Kingdom Viridiplantae. Emily Germain 1,2 Mentor Dr."

Transcription

1 Comparison and Analysis of Heat Shock Proteins in Organisms of the Kingdom Viridiplantae Emily Germain 1,2 Mentor Dr. Hugh Nicholas 3 1 Bioengineering & Bioinformatics Summer Institute, Department of Computational Biology, University of Pittsburgh, Pittsburgh, PA Departments of Biomedical Engineering and Biology, Rensselaer Polytechnic Institute, Troy, NY Biomedical Initiative, Pittsburgh Supercomputing Center, Pittsburgh, PA Objectives Identify characteristics and motifs of protein family Determine residues essential to structure- function relationship Organize proteins into subfamilies Locate residues unique to particular subfamilies Make predictions regarding the protein s evolution 1

2 Heat Shock Proteins Present in all living cells in cytoplasm and nuclei Transcriptionally upregulated when cell is stressed Extremes of temperature Toxins Oxygen or nutrient deprivation Chaperone refolding of denatured proteins Transport other proteins within the cell Possible role in the immune response Model Heat Shock Protein Methanococcus jannaschii 2

3 Model Heat Shock Protein Multiple Sequence Alignment 190 Viridiplantae HSP sequences extracted from iproclass sequence database Remove fragments, 167 sequences remain Align sequences with T-Coffee Perform global multiple alignment for all sequences Run MEME to locate motifs 20 highly conserved patterns identified View T-Coffee and MEME results together and refine alignment by hand Remove sequences not displaying multiple motifs, 161 sequences in final alignment 3

4 Multiple Sequence Alignment Multiple Sequence Alignment 4

5 Residues Highly Conserved Over Family MEME Patterns in Group HSP 17 5

6 PHYLIP Bootstrap and Sequence Space Analyses Input refined MSA into algorithms SeqSpace calculates clusters, defines similarity vectors from origin PHYLIP iterations created 1000 trees, compiled to create consensus tree Combined output of PHYLIP and SeqSpace used to define five subfamilies Phylogenetic Tree Cord Moss HSP Grasses HSP 17 HSP

7 Sequence Space Output Dimension 2 Dimension 3 Group Entropy Used PSC s GEnt program Calculates the group entropy distance for each defined subfamily Gives a best fit match for sequences still ungrouped Residues with higher scores are unique to a particular subfamily and essential to its specific function Group Entropy Distance = S [(p i -q ) x log i 2 (p i /q i )] p i foreground residue frequency q i background residue frequency 7

8 Group Entropy [Alignment Index][Predominate Subfamily Amino Acid]-[Predominate Family Amino Acid] High group entropy indicates conserved amino acid unique to subfamily Entropy for Group HSP 17 Group Entropy 8

9 Residues from HSP 17 with High Group Entropy Conclusions Evolutionary relationships suggest that different variations resulted from gene duplication HSPs are more closely related to others in species similar to the one in which they are found, rather than to others of comparable molecular weights in more distantly related species HSPs are highly conserved over the whole family, very specific residue alterations give particular subfamilies their individual properties The data collected in this study can be further analyzed by comparing the highly conserved residues found in each group. This can be matched up with data regarding the specific functions of each heat shock protein to generate hypothesis regarding how these specific residues contribute to functional specificity and biochemical properties. 9

10 Resources Bailey Timothy L., Elkan Fitting a mixture model by expectation maximization to discover motifs in biopolymers. Proceedings of the Second International Conference on Intelligent Systems for Molecular Biology AAAI Press, Menlo Park, California. Cassari, G., Sander, C. and Valencia, A A method to predict functional residues in proteins. Structural Biology. 2: Felsenstein J PHYLIP: Phylogeny Inference Package. Department of Genome Sciences, University of Washington. Gong L., Puri M., et al Drosophila ventral furrow morphogenesis: a proteomic analysis. Development. 131: Nicholas H.B. Jr., Ropelewski A., Deerfield D.W. II Strategies tegies for Searching Sequence Databases. BioTechniques. 28: Nicholas H.B. Jr., Ropelewski A., Deerfield D.W. II Strategies tegies of Multiple Sequence Alignment. BioTechniques.. 32: Notredame, C., Higgins, D., Heringa, J T-Coffee: A novel method for multiple sequence alignments. J. Mol. Bio. 302: Acknowledgements Dr. Hugh Nicholas Jr. Pittsburgh Supercomputing Center Rajan Munshi National Institutes of Health National Science Foundation Everyone in BBSI 10

Comparison and Analysis of Heat Shock Proteins in Organisms of the Kingdom Viridiplantae. Emily Germain, Rensselaer Polytechnic Institute

Comparison and Analysis of Heat Shock Proteins in Organisms of the Kingdom Viridiplantae. Emily Germain, Rensselaer Polytechnic Institute Comparison and Analysis of Heat Shock Proteins in Organisms of the Kingdom Viridiplantae Emily Germain, Rensselaer Polytechnic Institute Mentor: Dr. Hugh Nicholas, Biomedical Initiative, Pittsburgh Supercomputing

More information

Computational Analysis of the Fungal and Metazoan Groups of Heat Shock Proteins

Computational Analysis of the Fungal and Metazoan Groups of Heat Shock Proteins Computational Analysis of the Fungal and Metazoan Groups of Heat Shock Proteins Introduction: Benjamin Cooper, The Pennsylvania State University Advisor: Dr. Hugh Nicolas, Biomedical Initiative, Carnegie

More information

A bioinformatics approach to the structural and functional analysis of the glycogen phosphorylase protein family

A bioinformatics approach to the structural and functional analysis of the glycogen phosphorylase protein family A bioinformatics approach to the structural and functional analysis of the glycogen phosphorylase protein family Jieming Shen 1,2 and Hugh B. Nicholas, Jr. 3 1 Bioengineering and Bioinformatics Summer

More information

Research Proposal. Title: Multiple Sequence Alignment used to investigate the co-evolving positions in OxyR Protein family.

Research Proposal. Title: Multiple Sequence Alignment used to investigate the co-evolving positions in OxyR Protein family. Research Proposal Title: Multiple Sequence Alignment used to investigate the co-evolving positions in OxyR Protein family. Name: Minjal Pancholi Howard University Washington, DC. June 19, 2009 Research

More information

Sequence Based Bioinformatics

Sequence Based Bioinformatics Structural and Functional Analysis of Inosine Monophosphate Dehydrogenase using Sequence-Based Bioinformatics Barry Sexton 1,2 and Troy Wymore 3 1 Bioengineering and Bioinformatics Summer Institute, Department

More information

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types

THEORY. Based on sequence Length According to the length of sequence being compared it is of following two types Exp 11- THEORY Sequence Alignment is a process of aligning two sequences to achieve maximum levels of identity between them. This help to derive functional, structural and evolutionary relationships between

More information

MEME - Motif discovery tool REFERENCE TRAINING SET COMMAND LINE SUMMARY

MEME - Motif discovery tool REFERENCE TRAINING SET COMMAND LINE SUMMARY Command line Training Set First Motif Summary of Motifs Termination Explanation MEME - Motif discovery tool MEME version 3.0 (Release date: 2002/04/02 00:11:59) For further information on how to interpret

More information

Some Problems from Enzyme Families

Some Problems from Enzyme Families Some Problems from Enzyme Families Greg Butler Department of Computer Science Concordia University, Montreal www.cs.concordia.ca/~faculty/gregb gregb@cs.concordia.ca Abstract I will discuss some problems

More information

Effects of Gap Open and Gap Extension Penalties

Effects of Gap Open and Gap Extension Penalties Brigham Young University BYU ScholarsArchive All Faculty Publications 200-10-01 Effects of Gap Open and Gap Extension Penalties Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu See

More information

Introduction to Bioinformatics Online Course: IBT

Introduction to Bioinformatics Online Course: IBT Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec1 Building a Multiple Sequence Alignment Learning Outcomes 1- Understanding Why multiple

More information

Multiple sequence alignment

Multiple sequence alignment Multiple sequence alignment Multiple sequence alignment: today s goals to define what a multiple sequence alignment is and how it is generated; to describe profile HMMs to introduce databases of multiple

More information

Matrix-based pattern discovery algorithms

Matrix-based pattern discovery algorithms Regulatory Sequence Analysis Matrix-based pattern discovery algorithms Jacques.van.Helden@ulb.ac.be Université Libre de Bruxelles, Belgique Laboratoire de Bioinformatique des Génomes et des Réseaux (BiGRe)

More information

Sequence Alignment Techniques and Their Uses

Sequence Alignment Techniques and Their Uses Sequence Alignment Techniques and Their Uses Sarah Fiorentino Since rapid sequencing technology and whole genomes sequencing, the amount of sequence information has grown exponentially. With all of this

More information

5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT

5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT 5. MULTIPLE SEQUENCE ALIGNMENT BIOINFORMATICS COURSE MTAT.03.239 03.10.2012 ALIGNMENT Alignment is the task of locating equivalent regions of two or more sequences to maximize their similarity. Homology:

More information

Engineering of Repressilator

Engineering of Repressilator The Utilization of Monte Carlo Techniques to Simulate the Repressilator: A Cyclic Oscillatory System Seetal Erramilli 1,2 and Joel R. Stiles 1,3,4 1 Bioengineering and Bioinformatics Summer Institute,

More information

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748 CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/15/07 CAP5510 1 EM Algorithm Goal: Find θ, Z that maximize Pr

More information

Tools and Algorithms in Bioinformatics

Tools and Algorithms in Bioinformatics Tools and Algorithms in Bioinformatics GCBA815, Fall 2015 Week-4 BLAST Algorithm Continued Multiple Sequence Alignment Babu Guda, Ph.D. Department of Genetics, Cell Biology & Anatomy Bioinformatics and

More information

Homology Modeling. Roberto Lins EPFL - summer semester 2005

Homology Modeling. Roberto Lins EPFL - summer semester 2005 Homology Modeling Roberto Lins EPFL - summer semester 2005 Disclaimer: course material is mainly taken from: P.E. Bourne & H Weissig, Structural Bioinformatics; C.A. Orengo, D.T. Jones & J.M. Thornton,

More information

Copyright 2000 N. AYDIN. All rights reserved. 1

Copyright 2000 N. AYDIN. All rights reserved. 1 Introduction to Bioinformatics Prof. Dr. Nizamettin AYDIN naydin@yildiz.edu.tr Multiple Sequence Alignment Outline Multiple sequence alignment introduction to msa methods of msa progressive global alignment

More information

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega

08/21/2017 BLAST. Multiple Sequence Alignments: Clustal Omega BLAST Multiple Sequence Alignments: Clustal Omega What does basic BLAST do (e.g. what is input sequence and how does BLAST look for matches?) Susan Parrish McDaniel College Multiple Sequence Alignments

More information

Phylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches

Phylogenies Scores for Exhaustive Maximum Likelihood and Parsimony Scores Searches Int. J. Bioinformatics Research and Applications, Vol. x, No. x, xxxx Phylogenies Scores for Exhaustive Maximum Likelihood and s Searches Hyrum D. Carroll, Perry G. Ridge, Mark J. Clement, Quinn O. Snell

More information

Absolute Entropy of a 2D Lattice Model for a Denatured Protein

Absolute Entropy of a 2D Lattice Model for a Denatured Protein Absolute Entropy of a 2D Lattice Model for a Denatured Protein Jason Funt 1,4 and Hagai Meirovitch 2,3 1 Bioengineering and Bioinformatics Summer Institute 2 Center for Computational Biology and Bioinformatics,

More information

Computational methods for predicting protein-protein interactions

Computational methods for predicting protein-protein interactions Computational methods for predicting protein-protein interactions Tomi Peltola T-61.6070 Special course in bioinformatics I 3.4.2008 Outline Biological background Protein-protein interactions Computational

More information

Goals. Structural Analysis of the EGR Family of Transcription Factors: Templates for Predicting Protein DNA Interactions

Goals. Structural Analysis of the EGR Family of Transcription Factors: Templates for Predicting Protein DNA Interactions Structural Analysis of the EGR Family of Transcription Factors: Templates for Predicting Protein DNA Interactions Jamie Duke 1,2 and Carlos Camacho 3 1 Bioengineering and Bioinformatics Summer Institute,

More information

USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES

USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES USING BLAST TO IDENTIFY PROTEINS THAT ARE EVOLUTIONARILY RELATED ACROSS SPECIES HOW CAN BIOINFORMATICS BE USED AS A TOOL TO DETERMINE EVOLUTIONARY RELATIONSHPS AND TO BETTER UNDERSTAND PROTEIN HERITAGE?

More information

Algorithms in Bioinformatics

Algorithms in Bioinformatics Algorithms in Bioinformatics Sami Khuri Department of Computer Science San José State University San José, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri Distance Methods Character Methods

More information

Cluster Analysis of Gene Expression Microarray Data. BIOL 495S/ CS 490B/ MATH 490B/ STAT 490B Introduction to Bioinformatics April 8, 2002

Cluster Analysis of Gene Expression Microarray Data. BIOL 495S/ CS 490B/ MATH 490B/ STAT 490B Introduction to Bioinformatics April 8, 2002 Cluster Analysis of Gene Expression Microarray Data BIOL 495S/ CS 490B/ MATH 490B/ STAT 490B Introduction to Bioinformatics April 8, 2002 1 Data representations Data are relative measurements log 2 ( red

More information

BIOINFORMATICS: An Introduction

BIOINFORMATICS: An Introduction BIOINFORMATICS: An Introduction What is Bioinformatics? The term was first coined in 1988 by Dr. Hwa Lim The original definition was : a collective term for data compilation, organisation, analysis and

More information

Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences

Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Statistical Machine Learning Methods for Bioinformatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD Department of Computer Science University of Missouri 2008 Free for Academic

More information

Topics in Computational Biology and Genomics

Topics in Computational Biology and Genomics Topics in Computational Biology and Genomics {MCB, PMB, BioE}{c146, c246} University of California, Berkeley Spring 2005 Instruction and discussion of topics in genomics and computational biology. Working

More information

Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis

Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis Elements of Bioinformatics 14F01 TP5 -Phylogenetic analysis 10 December 2012 - Corrections - Exercise 1 Non-vertebrate chordates generally possess 2 homologs, vertebrates 3 or more gene copies; a Drosophila

More information

Phylogenetic analysis of Cytochrome P450 Structures. Gowri Shankar, University of Sydney, Australia.

Phylogenetic analysis of Cytochrome P450 Structures. Gowri Shankar, University of Sydney, Australia. Phylogenetic analysis of Cytochrome P450 Structures Gowri Shankar, University of Sydney, Australia. Overview Introduction Cytochrome P450 -- Structures. Results. Conclusion. Future Work. Aims How the structure

More information

Subfamily HMMS in Functional Genomics. D. Brown, N. Krishnamurthy, J.M. Dale, W. Christopher, and K. Sjölander

Subfamily HMMS in Functional Genomics. D. Brown, N. Krishnamurthy, J.M. Dale, W. Christopher, and K. Sjölander Subfamily HMMS in Functional Genomics D. Brown, N. Krishnamurthy, J.M. Dale, W. Christopher, and K. Sjölander Pacific Symposium on Biocomputing 10:322-333(2005) SUBFAMILY HMMS IN FUNCTIONAL GENOMICS DUNCAN

More information

Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor

Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor Building a Homology Model of the Transmembrane Domain of the Human Glycine α-1 Receptor Presented by Stephanie Lee Research Mentor: Dr. Rob Coalson Glycine Alpha 1 Receptor (GlyRa1) Member of the superfamily

More information

Bioinformatics Chapter 1. Introduction

Bioinformatics Chapter 1. Introduction Bioinformatics Chapter 1. Introduction Outline! Biological Data in Digital Symbol Sequences! Genomes Diversity, Size, and Structure! Proteins and Proteomes! On the Information Content of Biological Sequences!

More information

Sequence Bioinformatics. Multiple Sequence Alignment Waqas Nasir

Sequence Bioinformatics. Multiple Sequence Alignment Waqas Nasir Sequence Bioinformatics Multiple Sequence Alignment Waqas Nasir 2010-11-12 Multiple Sequence Alignment One amino acid plays coy; a pair of homologous sequences whisper; many aligned sequences shout out

More information

Lecture 8 Learning Sequence Motif Models Using Expectation Maximization (EM) Colin Dewey February 14, 2008

Lecture 8 Learning Sequence Motif Models Using Expectation Maximization (EM) Colin Dewey February 14, 2008 Lecture 8 Learning Sequence Motif Models Using Expectation Maximization (EM) Colin Dewey February 14, 2008 1 Sequence Motifs what is a sequence motif? a sequence pattern of biological significance typically

More information

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ

Chapter 5. Proteomics and the analysis of protein sequence Ⅱ Proteomics Chapter 5. Proteomics and the analysis of protein sequence Ⅱ 1 Pairwise similarity searching (1) Figure 5.5: manual alignment One of the amino acids in the top sequence has no equivalent and

More information

Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata.

Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata. Supplementary Note S2 Phylogenetic relationship among S. castellii, S. cerevisiae and C. glabrata. Phylogenetic trees reconstructed by a variety of methods from either single-copy orthologous loci (Class

More information

Bioinformatics tools for phylogeny and visualization. Yanbin Yin

Bioinformatics tools for phylogeny and visualization. Yanbin Yin Bioinformatics tools for phylogeny and visualization Yanbin Yin 1 Homework assignment 5 1. Take the MAFFT alignment http://cys.bios.niu.edu/yyin/teach/pbb/purdue.cellwall.list.lignin.f a.aln as input and

More information

Grouping of amino acids and recognition of protein structurally conserved regions by reduced alphabets of amino acids

Grouping of amino acids and recognition of protein structurally conserved regions by reduced alphabets of amino acids Science in China Series C: Life Sciences 2007 Science in China Press Springer-Verlag Grouping of amino acids and recognition of protein structurally conserved regions by reduced alphabets of amino acids

More information

7. Tests for selection

7. Tests for selection Sequence analysis and genomics 7. Tests for selection Dr. Katja Nowick Group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute for Brain Research www. nowicklab.info

More information

Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:

Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17: Multiple Sequence Alignment, Gunnar Klau, December 9, 2005, 17:50 5001 5 Multiple Sequence Alignment The first part of this exposition is based on the following sources, which are recommended reading:

More information

Learning Sequence Motif Models Using Expectation Maximization (EM) and Gibbs Sampling

Learning Sequence Motif Models Using Expectation Maximization (EM) and Gibbs Sampling Learning Sequence Motif Models Using Expectation Maximization (EM) and Gibbs Sampling BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 009 Mark Craven craven@biostat.wisc.edu Sequence Motifs what is a sequence

More information

MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE

MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE MULTIPLE SEQUENCE ALIGNMENT FOR CONSTRUCTION OF PHYLOGENETIC TREE Manmeet Kaur 1, Navneet Kaur Bawa 2 1 M-tech research scholar (CSE Dept) ACET, Manawala,Asr 2 Associate Professor (CSE Dept) ACET, Manawala,Asr

More information

CSCE555 Bioinformatics. Protein Function Annotation

CSCE555 Bioinformatics. Protein Function Annotation CSCE555 Bioinformatics Protein Function Annotation Why we need to do function annotation? Fig from: Network-based prediction of protein function. Molecular Systems Biology 3:88. 2007 What s function? The

More information

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 2009 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

More information

Molecular phylogeny How to infer phylogenetic trees using molecular sequences

Molecular phylogeny How to infer phylogenetic trees using molecular sequences Molecular phylogeny How to infer phylogenetic trees using molecular sequences ore Samuelsson Nov 200 Applications of phylogenetic methods Reconstruction of evolutionary history / Resolving taxonomy issues

More information

Ch. 9 Multiple Sequence Alignment (MSA)

Ch. 9 Multiple Sequence Alignment (MSA) Ch. 9 Multiple Sequence Alignment (MSA) - gather seqs. to make MSA - doing MSA with ClustalW - doing MSA with Tcoffee - comparing seqs. that cannot align Introduction - from pairwise alignment to MSA -

More information

Gürol M. Süel, Steve W. Lockless, Mark A. Wall, and Rama Ra

Gürol M. Süel, Steve W. Lockless, Mark A. Wall, and Rama Ra Gürol M. Süel, Steve W. Lockless, Mark A. Wall, and Rama Ranganathan, Evolutionarily conserved networks of residues mediate allosteric communication in proteins, Nature Structural Biology, vol. 10, no.

More information

Bioinformatics. Dept. of Computational Biology & Bioinformatics

Bioinformatics. Dept. of Computational Biology & Bioinformatics Bioinformatics Dept. of Computational Biology & Bioinformatics 3 Bioinformatics - play with sequences & structures Dept. of Computational Biology & Bioinformatics 4 ORGANIZATION OF LIFE ROLE OF BIOINFORMATICS

More information

Comparative Protein Modeling of Superoxide Dismutase Isoforms in Maize.

Comparative Protein Modeling of Superoxide Dismutase Isoforms in Maize. Comparative Protein Modeling of Superoxide Dismutase Isoforms in Maize. Kaliyugam Shiriga 1, 2, Rinku Sharma 1, Krishan Kumar 2, Firoz Hossain 1 and NepoleanThirunavukkarasu 1* Division of Genetics, Indian

More information

Quantifying sequence similarity

Quantifying sequence similarity Quantifying sequence similarity Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 16 th 2016 After this lecture, you can define homology, similarity, and identity

More information

Cladistics and Bioinformatics Questions 2013

Cladistics and Bioinformatics Questions 2013 AP Biology Name Cladistics and Bioinformatics Questions 2013 1. The following table shows the percentage similarity in sequences of nucleotides from a homologous gene derived from five different species

More information

Large Grain Size Stochastic Optimization Alignment

Large Grain Size Stochastic Optimization Alignment Brigham Young University BYU ScholarsArchive All Faculty Publications 2006-10-01 Large Grain Size Stochastic Optimization Alignment Hyrum Carroll hyrumcarroll@gmail.com Mark J. Clement clement@cs.byu.edu

More information

Introduction to Evolutionary Concepts

Introduction to Evolutionary Concepts Introduction to Evolutionary Concepts and VMD/MultiSeq - Part I Zaida (Zan) Luthey-Schulten Dept. Chemistry, Beckman Institute, Biophysics, Institute of Genomics Biology, & Physics NIH Workshop 2009 VMD/MultiSeq

More information

Unsupervised Learning in Spectral Genome Analysis

Unsupervised Learning in Spectral Genome Analysis Unsupervised Learning in Spectral Genome Analysis Lutz Hamel 1, Neha Nahar 1, Maria S. Poptsova 2, Olga Zhaxybayeva 3, J. Peter Gogarten 2 1 Department of Computer Sciences and Statistics, University of

More information

De novo identification of motifs in one species. Modified from Serafim Batzoglou s lecture notes

De novo identification of motifs in one species. Modified from Serafim Batzoglou s lecture notes De novo identification of motifs in one species Modified from Serafim Batzoglou s lecture notes Finding Regulatory Motifs... Given a collection of genes that may be regulated by the same transcription

More information

InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9

InDel 3-5. InDel 8-9. InDel 3-5. InDel 8-9. InDel InDel 8-9 Lecture 5 Alignment I. Introduction. For sequence data, the process of generating an alignment establishes positional homologies; that is, alignment provides the identification of homologous phylogenetic

More information

Motifs, Profiles and Domains. Michael Tress Protein Design Group Centro Nacional de Biotecnología, CSIC

Motifs, Profiles and Domains. Michael Tress Protein Design Group Centro Nacional de Biotecnología, CSIC Motifs, Profiles and Domains Michael Tress Protein Design Group Centro Nacional de Biotecnología, CSIC Comparing Two Proteins Sequence Alignment Determining the pattern of evolution and identifying conserved

More information

Session 5: Phylogenomics

Session 5: Phylogenomics Session 5: Phylogenomics B.- Phylogeny based orthology assignment REMINDER: Gene tree reconstruction is divided in three steps: homology search, multiple sequence alignment and model selection plus tree

More information

BLAST. Varieties of BLAST

BLAST. Varieties of BLAST BLAST Basic Local Alignment Search Tool (1990) Altschul, Gish, Miller, Myers, & Lipman Uses short-cuts or heuristics to improve search speed Like speed-reading, does not examine every nucleotide of database

More information

Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences

Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Statistical Machine Learning Methods for Biomedical Informatics II. Hidden Markov Model for Biological Sequences Jianlin Cheng, PhD William and Nancy Thompson Missouri Distinguished Professor Department

More information

Alignment. Peak Detection

Alignment. Peak Detection ChIP seq ChIP Seq Hongkai Ji et al. Nature Biotechnology 26: 1293-1300. 2008 ChIP Seq Analysis Alignment Peak Detection Annotation Visualization Sequence Analysis Motif Analysis Alignment ELAND Bowtie

More information

Protein Structure. W. M. Grogan, Ph.D. OBJECTIVES

Protein Structure. W. M. Grogan, Ph.D. OBJECTIVES Protein Structure W. M. Grogan, Ph.D. OBJECTIVES 1. Describe the structure and characteristic properties of typical proteins. 2. List and describe the four levels of structure found in proteins. 3. Relate

More information

Phylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction. Lesser Tenrec (Echinops telfairi)

Phylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction. Lesser Tenrec (Echinops telfairi) Phylogenetics - Orthology, phylogenetic experimental design and phylogeny reconstruction Lesser Tenrec (Echinops telfairi) Goals: 1. Use phylogenetic experimental design theory to select optimal taxa to

More information

Introduction to Bioinformatics Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics Dr. rer. nat. Gong Jing Cancer Research Center Medicine School of Shandong University 2012.11.09 1 Chapter 4 Phylogenetic Tree 2 Phylogeny Evidence from morphological ( 形态学的 ), biochemical, and gene sequence

More information

Analysis of N-terminal Acetylation data with Kernel-Based Clustering

Analysis of N-terminal Acetylation data with Kernel-Based Clustering Analysis of N-terminal Acetylation data with Kernel-Based Clustering Ying Liu Department of Computational Biology, School of Medicine University of Pittsburgh yil43@pitt.edu 1 Introduction N-terminal acetylation

More information

doi: / _25

doi: / _25 Boc, A., P. Legendre and V. Makarenkov. 2013. An efficient algorithm for the detection and classification of horizontal gene transfer events and identification of mosaic genes. Pp. 253-260 in: B. Lausen,

More information

The PRALINE online server: optimising progressive multiple alignment on the web

The PRALINE online server: optimising progressive multiple alignment on the web Computational Biology and Chemistry 27 (2003) 511 519 Software Note The PRALINE online server: optimising progressive multiple alignment on the web V.A. Simossis a,b, J. Heringa a, a Bioinformatics Unit,

More information

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment

Algorithms in Bioinformatics FOUR Pairwise Sequence Alignment. Pairwise Sequence Alignment. Convention: DNA Sequences 5. Sequence Alignment Algorithms in Bioinformatics FOUR Sami Khuri Department of Computer Science San José State University Pairwise Sequence Alignment Homology Similarity Global string alignment Local string alignment Dot

More information

CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018

CONCEPT OF SEQUENCE COMPARISON. Natapol Pornputtapong 18 January 2018 CONCEPT OF SEQUENCE COMPARISON Natapol Pornputtapong 18 January 2018 SEQUENCE ANALYSIS - A ROSETTA STONE OF LIFE Sequence analysis is the process of subjecting a DNA, RNA or peptide sequence to any of

More information

An Introduction to Sequence Similarity ( Homology ) Searching

An Introduction to Sequence Similarity ( Homology ) Searching An Introduction to Sequence Similarity ( Homology ) Searching Gary D. Stormo 1 UNIT 3.1 1 Washington University, School of Medicine, St. Louis, Missouri ABSTRACT Homologous sequences usually have the same,

More information

Phylogenomics, Multiple Sequence Alignment, and Metagenomics. Tandy Warnow University of Illinois at Urbana-Champaign

Phylogenomics, Multiple Sequence Alignment, and Metagenomics. Tandy Warnow University of Illinois at Urbana-Champaign Phylogenomics, Multiple Sequence Alignment, and Metagenomics Tandy Warnow University of Illinois at Urbana-Champaign Phylogeny (evolutionary tree) Orangutan Gorilla Chimpanzee Human From the Tree of the

More information

Multiple Sequence Alignment. Sequences

Multiple Sequence Alignment. Sequences Multiple Sequence Alignment Sequences > YOR020c mstllksaksivplmdrvlvqrikaqaktasglylpe knveklnqaevvavgpgftdangnkvvpqvkvgdqvl ipqfggstiklgnddevilfrdaeilakiakd > crassa mattvrsvksliplldrvlvqrvkaeaktasgiflpe

More information

Neyman-Pearson. More Motifs. Weight Matrix Models. What s best WMM?

Neyman-Pearson. More Motifs. Weight Matrix Models. What s best WMM? Neyman-Pearson More Motifs WMM, log odds scores, Neyman-Pearson, background; Greedy & EM for motif discovery Given a sample x 1, x 2,..., x n, from a distribution f(... #) with parameter #, want to test

More information

A profile-based protein sequence alignment algorithm for a domain clustering database

A profile-based protein sequence alignment algorithm for a domain clustering database A profile-based protein sequence alignment algorithm for a domain clustering database Lin Xu,2 Fa Zhang and Zhiyong Liu 3, Key Laboratory of Computer System and architecture, the Institute of Computing

More information

Bioinformatics. Proteins II. - Pattern, Profile, & Structure Database Searching. Robert Latek, Ph.D. Bioinformatics, Biocomputing

Bioinformatics. Proteins II. - Pattern, Profile, & Structure Database Searching. Robert Latek, Ph.D. Bioinformatics, Biocomputing Bioinformatics Proteins II. - Pattern, Profile, & Structure Database Searching Robert Latek, Ph.D. Bioinformatics, Biocomputing WIBR Bioinformatics Course, Whitehead Institute, 2002 1 Proteins I.-III.

More information

Using Phylogenomics to Predict Novel Fungal Pathogenicity Genes

Using Phylogenomics to Predict Novel Fungal Pathogenicity Genes Using Phylogenomics to Predict Novel Fungal Pathogenicity Genes David DeCaprio, Ying Li, Hung Nguyen (sequenced Ascomycetes genomes courtesy of the Broad Institute) Phylogenomics Combining whole genome

More information

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut

Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic analysis Phylogenetic Basics: Biological

More information

Discovering Binding Motif Pairs from Interacting Protein Groups

Discovering Binding Motif Pairs from Interacting Protein Groups Discovering Binding Motif Pairs from Interacting Protein Groups Limsoon Wong Institute for Infocomm Research Singapore Copyright 2005 by Limsoon Wong Plan Motivation from biology & problem statement Recasting

More information

Comparative Genomics II

Comparative Genomics II Comparative Genomics II Advances in Bioinformatics and Genomics GEN 240B Jason Stajich May 19 Comparative Genomics II Slide 1/31 Outline Introduction Gene Families Pairwise Methods Phylogenetic Methods

More information

Multiple Sequence Alignment: HMMs and Other Approaches

Multiple Sequence Alignment: HMMs and Other Approaches Multiple Sequence Alignment: HMMs and Other Approaches Background Readings: Durbin et. al. Section 3.1, Ewens and Grant, Ch4. Wing-Kin Sung, Ch 6 Beerenwinkel N, Siebourg J. Statistics, probability, and

More information

Monte Carlo Simulations of Protein Folding using Lattice Models

Monte Carlo Simulations of Protein Folding using Lattice Models Monte Carlo Simulations of Protein Folding using Lattice Models Ryan Cheng 1,2 and Kenneth Jordan 1,3 1 Bioengineering and Bioinformatics Summer Institute, Department of Computational Biology, University

More information

Graph Alignment and Biological Networks

Graph Alignment and Biological Networks Graph Alignment and Biological Networks Johannes Berg http://www.uni-koeln.de/ berg Institute for Theoretical Physics University of Cologne Germany p.1/12 Networks in molecular biology New large-scale

More information

Phylogenetic Tree Reconstruction

Phylogenetic Tree Reconstruction I519 Introduction to Bioinformatics, 2011 Phylogenetic Tree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Evolution theory Speciation Evolution of new organisms is driven

More information

A Phylogenetic Gibbs Recursive Sampler for Locating Transcription Factor Binding Sites

A Phylogenetic Gibbs Recursive Sampler for Locating Transcription Factor Binding Sites A for Locating Transcription Factor Binding Sites Sean P. Conlan 1 Lee Ann McCue 2 1,3 Thomas M. Smith 3 William Thompson 4 Charles E. Lawrence 4 1 Wadsworth Center, New York State Department of Health

More information

Phylogenetic inference

Phylogenetic inference Phylogenetic inference Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, March 7 th 016 After this lecture, you can discuss (dis-) advantages of different information types

More information

Orthology Part I: concepts and implications Toni Gabaldón Centre for Genomic Regulation (CRG), Barcelona

Orthology Part I: concepts and implications Toni Gabaldón Centre for Genomic Regulation (CRG), Barcelona Orthology Part I: concepts and implications Toni Gabaldón Centre for Genomic Regulation (CRG), Barcelona (tgabaldon@crg.es) http://gabaldonlab.crg.es Homology the same organ in different animals under

More information

COPIA: A New Software for Finding Consensus Patterns. Chengzhi Liang. A thesis. presented to the University ofwaterloo. in fulfilment of the

COPIA: A New Software for Finding Consensus Patterns. Chengzhi Liang. A thesis. presented to the University ofwaterloo. in fulfilment of the COPIA: A New Software for Finding Consensus Patterns in Unaligned Protein Sequences by Chengzhi Liang A thesis presented to the University ofwaterloo in fulfilment of the thesis requirement for the degree

More information

Multiple Sequence Alignment: A Critical Comparison of Four Popular Programs

Multiple Sequence Alignment: A Critical Comparison of Four Popular Programs Multiple Sequence Alignment: A Critical Comparison of Four Popular Programs Shirley Sutton, Biochemistry 218 Final Project, March 14, 2008 Introduction For both the computational biologist and the research

More information

Dr. Amira A. AL-Hosary

Dr. Amira A. AL-Hosary Phylogenetic analysis Amira A. AL-Hosary PhD of infectious diseases Department of Animal Medicine (Infectious Diseases) Faculty of Veterinary Medicine Assiut University-Egypt Phylogenetic Basics: Biological

More information

Phylogenetic analyses. Kirsi Kostamo

Phylogenetic analyses. Kirsi Kostamo Phylogenetic analyses Kirsi Kostamo The aim: To construct a visual representation (a tree) to describe the assumed evolution occurring between and among different groups (individuals, populations, species,

More information

1 Abstract. 2 Introduction. 3 Requirements. 4 Procedure

1 Abstract. 2 Introduction. 3 Requirements. 4 Procedure 1 Abstract None 2 Introduction The archaeal core set is used in testing the completeness of the archaeal draft genomes. The core set comprises of conserved single copy genes from 25 genomes. Coverage statistic

More information

Lecture 8 Multiple Alignment and Phylogeny

Lecture 8 Multiple Alignment and Phylogeny Introduction to Bioinformatics for Medical Research Gideon Greenspan gdg@cs.technion.ac.il Lecture 8 Multiple Alignment and Phylogeny Multiple Alignment & Phylogeny Multiple Alignment Scoring Complexity

More information

Multiple Sequence Alignment

Multiple Sequence Alignment Multiple Sequence Alignment BMI/CS 576 www.biostat.wisc.edu/bmi576.html Colin Dewey cdewey@biostat.wisc.edu Multiple Sequence Alignment: Tas Definition Given a set of more than 2 sequences a method for

More information

Sequence Database Search Techniques I: Blast and PatternHunter tools

Sequence Database Search Techniques I: Blast and PatternHunter tools Sequence Database Search Techniques I: Blast and PatternHunter tools Zhang Louxin National University of Singapore Outline. Database search 2. BLAST (and filtration technique) 3. PatternHunter (empowered

More information

Inferring Transcriptional Regulatory Networks from Gene Expression Data II

Inferring Transcriptional Regulatory Networks from Gene Expression Data II Inferring Transcriptional Regulatory Networks from Gene Expression Data II Lectures 9 Oct 26, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday

More information

9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree)

9/30/11. Evolution theory. Phylogenetic Tree Reconstruction. Phylogenetic trees (binary trees) Phylogeny (phylogenetic tree) I9 Introduction to Bioinformatics, 0 Phylogenetic ree Reconstruction Yuzhen Ye (yye@indiana.edu) School of Informatics & omputing, IUB Evolution theory Speciation Evolution of new organisms is driven by

More information

SWEEPFINDER2: Increased sensitivity, robustness, and flexibility

SWEEPFINDER2: Increased sensitivity, robustness, and flexibility SWEEPFINDER2: Increased sensitivity, robustness, and flexibility Michael DeGiorgio 1,*, Christian D. Huber 2, Melissa J. Hubisz 3, Ines Hellmann 4, and Rasmus Nielsen 5 1 Department of Biology, Pennsylvania

More information